A0A087X0C6_HUMAN Loading...

BRCA1 associated RING domain 1

AlphaFold DB , UniProt , Accession A0A087X0C6, Species HUMAN (Homo sapiens, Human), Gene BARD1, Length 63 aa.

						>A0A087X0C6_HUMAN|A0A087X0C6|BARD1
MPDNRQPRNRQPRIRSGNEPRSAPAMEPDGRGAWAHSRAALDRLEKLLRCSRWGKSMSTKKSM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.9	Low	58.7	Low	230 Å²	230	158 Å²	158	100%	1.133	75%	0.749	S	S	*	*				0	118	0	-62.9	-56.4	151.3	0	0	107.3
2	P	55	Low	59.2	Low	131 Å²	131	153.3 Å²	153.3	85%	0.851	74%	0.742	S	S	*	*			trans	-72.4	133.5	-177.8	29.5	-31.4	0	0	0	110.3	N4	P2-N4 PolarHBondContact O-N 3.21Å
3	D	57.8	Low	59.5	Low	108 Å²	108	159.3 Å²	159.3	58%	0.578	75%	0.752	S	S	*	*			trans	-73.2	107.1	-178.2	-170.5	-106.1	0	0	0	109.7	R5	D3-R5 VanDerWaalsContact CG-NH1 3.29Å; D3-R5 PolarHBondContact O-N 2.71Å; D3-R5 WeakPolarHBondContact OD1-CD 3.43Å; D3-R5 WeakPolarHBondContact OD1-CG 3.44Å; D3-R5 IonicContact OD1-CZ 3.37Å; D3-R5 IonicContact OD1-NE 3.48Å; D3-R5 PolarHBondContact OD1-NE 2.97Å; D3-R5 IonicContact OD1-NH1 2.75Å; D3-R5 PolarHBondContact OD1-NH1 3.23Å; D3-R5 IonicContact OD2-CZ 3.53Å; D3-R5 IonicContact OD2-NH1 3.23Å; D3-R5 PolarHBondContact OD2-NH1 3.36Å
4	N	61.4	Low	59.7	Low	136 Å²	136	158.5 Å²	158.5	73%	0.727	75%	0.752	S	S	*	*			trans	-81.7	49.6	-176.3	-171.8	32.6	0	0	0	112.6	P2 Q6	P2-N4 PolarHBondContact O-N 3.21Å; N4-Q6 PolarHBondContact O-N 3.4Å; N4-Q6 VanDerWaalsContact O-N 3.07Å
5	R	62.2	Low	60.1	Low	203 Å²	203	162.7 Å²	162.7	77%	0.766	76%	0.758	S	S	*	*			trans	-83.9	52.6	175	-75.1	-174	-171.8	117.9	-7	112.2	D3	D3-R5 VanDerWaalsContact CG-NH1 3.29Å; D3-R5 PolarHBondContact O-N 2.71Å; D3-R5 WeakPolarHBondContact OD1-CD 3.43Å; D3-R5 WeakPolarHBondContact OD1-CG 3.44Å; D3-R5 IonicContact OD1-CZ 3.37Å; D3-R5 IonicContact OD1-NE 3.48Å; D3-R5 PolarHBondContact OD1-NE 2.97Å; D3-R5 IonicContact OD1-NH1 2.75Å; D3-R5 PolarHBondContact OD1-NH1 3.23Å; D3-R5 IonicContact OD2-CZ 3.53Å; D3-R5 IonicContact OD2-NH1 3.23Å; D3-R5 PolarHBondContact OD2-NH1 3.36Å
6	Q	62.8	Low	60.5	Low	151 Å²	151	156.4 Å²	156.4	71%	0.706	74%	0.738	S	S	*	*			trans	-65.7	129.7	161.3	-65.7	-173.5	-7	0	0	108.1	N4 R8	N4-Q6 PolarHBondContact O-N 3.4Å; N4-Q6 VanDerWaalsContact O-N 3.07Å; Q6-R8 PolarHBondContact O-N 3.48Å
7	P	56.8	Low	61	Low	83 Å²	83	152.5 Å²	152.5	54%	0.539	75%	0.748	S	S	.	*			trans	-66.6	92.9	163.4	27.1	-28.9	0	0	0	106.5	N9	P7-N9 PolarHBondContact O-N 3.01Å
8	R	54.8	Low	61.3	Low	230 Å²	230	150.8 Å²	150.8	87%	0.868	74%	0.743	S	S	*	*	T	Hydrogen-bonded Turn	trans	-34.9	102.7	174.6	-176.1	176.7	-173.7	-122.1	6.1	109.1	Q6 R10	Q6-R8 PolarHBondContact O-N 3.48Å; R8-R10 PolarHBondContact O-N 3.05Å
9	N	60.2	Low	61.6	Low	117 Å²	117	151.2 Å²	151.2	63%	0.626	74%	0.743	S	S	*	*	T	Hydrogen-bonded Turn	trans	21.5	73.5	164.9	-167.9	14.9	0	0	0	113.5	P7 Q11	P7-N9 PolarHBondContact O-N 3.01Å; N9-Q11 PolarHBondContact O-N 3.04Å; N9-Q11 WeakPolarHBondContact OD1-CG 3.43Å
10	R	60.2	Low	61.8	Low	208 Å²	208	149.4 Å²	149.4	79%	0.785	74%	0.743	S	S	*	*			trans	-73.9	46.2	172.2	-65.4	-175.1	-176.6	127.9	-2.2	110.4	R8 P12	R8-R10 PolarHBondContact O-N 3.05Å; R10-P12 WeakPolarHBondContact O-CD 3.32Å
11	Q	63.9	Low	62.2	Low	141 Å²	141	153.6 Å²	153.6	66%	0.659	75%	0.751	S	S	*	*			trans	-66.9	115.1	164.7	-85.1	177.2	-10	0	0	106.5	N9 R13	N9-Q11 PolarHBondContact O-N 3.04Å; N9-Q11 WeakPolarHBondContact OD1-CG 3.43Å; Q11-R13 PolarHBondContact O-N 3.22Å
12	P	64.3	Low	63	Low	102 Å²	102	148.1 Å²	148.1	66%	0.662	74%	0.735	S	S	*	*			trans	-59.6	116.5	167.1	24.4	-26.5	0	0	0	105.1	R10 I14	R10-P12 WeakPolarHBondContact O-CD 3.32Å; P12-I14 HydrophobicContact CG-CG1 4.46Å; P12-I14 PolarHBondContact O-N 3.34Å
13	R	63.7	Low	63.7	Low	231 Å²	231	145.9 Å²	145.9	87%	0.872	73%	0.727	S	S	*	*			trans	-66.4	85.8	168.1	-77.2	170.2	79.4	154.8	1.7	105.4	Q11 R15	Q11-R13 PolarHBondContact O-N 3.22Å; R13-R15 PolarHBondContact O-N 2.81Å
14	I	62.1	Low	64.3	Low	148 Å²	148	146.2 Å²	146.2	76%	0.759	74%	0.736	S	S	*	*			trans	-61.6	96	170	-60.3	170.8	0	0	0	104.2	P12 S16	P12-I14 HydrophobicContact CG-CG1 4.46Å; P12-I14 PolarHBondContact O-N 3.34Å; I14-S16 PolarHBondContact O-N 3.29Å; I14-S16 VanDerWaalsContact O-N 3.08Å
15	R	65.4	Low	64.7	Low	221 Å²	221	144.2 Å²	144.2	83%	0.834	74%	0.738	S	S	*	*			trans	-67	106.4	166	-69.7	-173.3	173	-162	-2.5	104.7	R13 G17	R13-R15 PolarHBondContact O-N 2.81Å; R15-G17 PolarHBondContact O-N 3.44Å
16	S	67.1	Low	64.9	Low	63 Å²	63	142.1 Å²	142.1	44%	0.441	74%	0.738	S	S	.	*			trans	-57.3	107.7	173.4	-172.9	0	0	0	0	107.3	I14 N18 E19	I14-S16 PolarHBondContact O-N 3.29Å; I14-S16 VanDerWaalsContact O-N 3.08Å; S16-N18 WeakPolarHBondContact CB-OD1 3.38Å; S16-N18 PolarHBondContact O-N 3.36Å; S16-N18 PolarHBondContact OG-ND2 2.84Å; S16-N18 PolarHBondContact OG-OD1 2.94Å; S16-E19 PolarHBondContact O-N 3.44Å; S16-E19 VanDerWaalsContact O-N 3.13Å
17	G	68.1	Low	65.2	Low	89 Å²	89	142.3 Å²	142.3	92%	0.918	74%	0.739	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.2	8.9	-178	0	0	0	0	0	114.1	R15	R15-G17 PolarHBondContact O-N 3.44Å
18	N	66.1	Low	65.5	Low	123 Å²	123	143.8 Å²	143.8	66%	0.658	75%	0.749	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.5	2.8	175.3	73.1	6.7	0	0	0	113.1	S16 P20	S16-N18 WeakPolarHBondContact CB-OD1 3.38Å; S16-N18 PolarHBondContact O-N 3.36Å; S16-N18 PolarHBondContact OG-ND2 2.84Å; S16-N18 PolarHBondContact OG-OD1 2.94Å; N18-P20 WeakPolarHBondContact O-CD 3.37Å
19	E	67.4	Low	65.9	Low	158 Å²	158	137.6 Å²	137.6	74%	0.738	73%	0.733	S	S	*	*	S	Bend	trans	-55	111.9	172.3	-158.8	168.7	-164.8	0	0	105.6	S16 R21	S16-E19 PolarHBondContact O-N 3.44Å; S16-E19 VanDerWaalsContact O-N 3.13Å; E19-R21 VanDerWaalsContact C-N 3.27Å; E19-R21 PolarHBondContact O-N 2.9Å
20	P	65.3	Low	65.8	Low	115 Å²	115	135 Å²	135	75%	0.747	74%	0.735	S	S	*	*			trans	-64.9	100.3	-169.6	23.2	-30.5	0	0	0	105.5	N18 S22	N18-P20 WeakPolarHBondContact O-CD 3.37Å; P20-S22 VanDerWaalsContact C-N 3.34Å; P20-S22 PolarHBondContact O-N 3.48Å
21	R	69.8	Low	65.9	Low	238 Å²	238	135.8 Å²	135.8	90%	0.898	74%	0.737	S	S	*	*			trans	-58.2	108.5	175.3	-174	176.3	-174.1	167.4	0.9	103.6	E19 A23	E19-R21 VanDerWaalsContact C-N 3.27Å; E19-R21 PolarHBondContact O-N 2.9Å; R21-A23 VanDerWaalsContact C-N 3.33Å; R21-A23 PolarHBondContact O-N 3.38Å
22	S	68.7	Low	66	Low	115 Å²	115	129.5 Å²	129.5	80%	0.804	71%	0.71	S	S	*	*			trans	-42.8	105.4	-177.3	-60.1	0	0	0	0	106.9	P20	P20-S22 VanDerWaalsContact C-N 3.34Å; P20-S22 PolarHBondContact O-N 3.48Å
23	A	69.4	Low	66.2	Low	84 Å²	84	128.6 Å²	128.6	69%	0.694	71%	0.711	S	S	*	*			trans	-57.5	130.9	-180	0	0	0	0	0	104.3	R21 A25	R21-A23 VanDerWaalsContact C-N 3.33Å; R21-A23 PolarHBondContact O-N 3.38Å; A23-A25 PolarHBondContact O-N 3.36Å; A23-A25 VanDerWaalsContact O-N 3.15Å
24	P	71.7	Confident	66.6	Low	115 Å²	115	126.6 Å²	126.6	75%	0.747	70%	0.704	S	S	*	*			trans	-49.2	132.5	174.5	21.1	-30.7	0	0	0	106.7	M26	P24-M26 PolarHBondContact O-N 3.47Å
25	A	69.5	Low	67.4	Low	93 Å²	93	121.8 Å²	121.8	77%	0.769	69%	0.686	S	S	*	*			trans	-55.2	98.2	179.1	0	0	0	0	0	106.7	A23 E27	A23-A25 PolarHBondContact O-N 3.36Å; A23-A25 VanDerWaalsContact O-N 3.15Å; A25-E27 PolarHBondContact O-N 3.05Å; A25-E27 VanDerWaalsContact O-N 3.13Å
26	M	66	Low	68.1	Low	159 Å²	159	117.7 Å²	117.7	78%	0.783	68%	0.676	S	S	*	*			trans	-69.6	115.7	178.7	-174	165.5	-175	0	0	103.6	P24 P28	P24-M26 PolarHBondContact O-N 3.47Å; M26-P28 VanDerWaalsContact O-N 3.11Å
27	E	68	Low	68.8	Low	155 Å²	155	116 Å²	116	72%	0.724	67%	0.665	S	S	*	*			trans	-44.2	125.6	172.8	-71.7	-64.7	105.5	0	0	106.7	A25 D29	A25-E27 PolarHBondContact O-N 3.05Å; A25-E27 VanDerWaalsContact O-N 3.13Å; E27-D29 VanDerWaalsContact C-N 3.3Å; E27-D29 PolarHBondContact O-N 3.41Å
28	P	63.6	Low	69.5	Low	114 Å²	114	120.2 Å²	120.2	74%	0.74	65%	0.653	S	S	*	*			trans	-57.5	108.8	176.4	23.8	-30.4	0	0	0	104.3	M26 G30	M26-P28 VanDerWaalsContact O-N 3.11Å; P28-G30 WeakPolarHBondContact O-CA 3.28Å; P28-G30 PolarHBondContact O-N 2.82Å
29	D	62.6	Low	70.3	Confident	100 Å²	100	116.6 Å²	116.6	54%	0.535	64%	0.64	S	S	.	*			trans	-69.4	77.1	-173.2	-152.7	-8.4	0	0	0	105.5	E27 R31 G32	E27-D29 VanDerWaalsContact C-N 3.3Å; E27-D29 PolarHBondContact O-N 3.41Å; D29-R31 PolarHBondContact O-N 2.75Å; D29-G32 PolarHBondContact O-N 3.37Å; D29-G32 VanDerWaalsContact OD1-CA 3.22Å; D29-G32 WeakPolarHBondContact OD1-CA 3.48Å; D29-G32 PolarHBondContact OD1-N 3.05Å; D29-G32 WeakPolarHBondContact OD2-CA 3.48Å
30	G	59.9	Low	71.3	Confident	64 Å²	64	111.9 Å²	111.9	66%	0.66	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.1	-14.1	-158.9	0	0	0	0	0	111.3	P28	P28-G30 WeakPolarHBondContact O-CA 3.28Å; P28-G30 PolarHBondContact O-N 2.82Å
31	R	61.1	Low	72.3	Confident	224 Å²	224	111.3 Å²	111.3	85%	0.845	62%	0.618	S	S	*	*	T	Hydrogen-bonded Turn	trans	-144.6	36.8	169.8	-70.5	-176.6	168.3	-86.7	0.1	110.6	D29	D29-R31 PolarHBondContact O-N 2.75Å
32	G	66.9	Low	73.1	Confident	9 Å²	9	103.6 Å²	103.6	9%	0.093	59%	0.594	C	S	.	*			trans	-59.1	166.3	174.5	0	0	0	0	0	111.2	D29 W34 A35	D29-G32 PolarHBondContact O-N 3.37Å; D29-G32 VanDerWaalsContact OD1-CA 3.22Å; D29-G32 WeakPolarHBondContact OD1-CA 3.48Å; D29-G32 PolarHBondContact OD1-N 3.05Å; D29-G32 WeakPolarHBondContact OD2-CA 3.48Å; G32-W34 PolarHBondContact O-N 3.2Å; G32-A35 WeakPolarHBondContact O-CB 3.14Å; G32-A35 PolarHBondContact O-N 2.93Å
33	A	68.4	Low	74	Confident	82 Å²	82	106.6 Å²	106.6	68%	0.678	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	-44.6	-19.7	-178.6	0	0	0	0	0	115.1	H36	A33-H36 PolarHBondContact O-CE1 2.77Å; A33-H36 PolarHBondContact O-ND1 3.04Å
34	W	71.2	Confident	75	Confident	190 Å²	190	107 Å²	107	72%	0.72	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.6	3.7	178.7	-58.8	90.5	0	0	0	115.8	G32 H36 S37 R38	G32-W34 PolarHBondContact O-N 3.2Å; W34-H36 PolarHBondContact O-N 3.08Å; W34-S37 WeakPolarHBondContact O-CB 3.15Å; W34-S37 PolarHBondContact O-N 3.31Å; W34-R38 PolarHBondContact O-N 3.41Å
35	A	79.1	Confident	75.8	Confident	46 Å²	46	106.4 Å²	106.4	38%	0.38	57%	0.565	S	S	.	*	H	α-helix	trans	-57.5	-38.4	178.2	0	0	0	0	0	112	G32 R38 A39	G32-A35 WeakPolarHBondContact O-CB 3.14Å; G32-A35 PolarHBondContact O-N 2.93Å; A35-R38 PolarHBondContact O-N 2.84Å; A35-A39 PolarHBondContact O-N 3.37Å; A35-A39 VanDerWaalsContact O-N 3.09Å
36	H	79.8	Confident	76.5	Confident	135 Å²	135	107.6 Å²	107.6	63%	0.625	55%	0.553	S	S	*	*	H	α-helix	trans	-65.8	-38.8	174.8	71.7	-83.7	0	0	0	111.9	A33 W34 A39 A40	A33-H36 PolarHBondContact O-CE1 2.77Å; A33-H36 PolarHBondContact O-ND1 3.04Å; W34-H36 PolarHBondContact O-N 3.08Å; H36-A39 PolarHBondContact O-N 3.09Å; H36-A40 WeakPolarHBondContact O-CB 3.28Å; H36-A40 PolarHBondContact O-N 2.95Å
37	S	82.1	Confident	77.4	Confident	29 Å²	29	105.8 Å²	105.8	20%	0.203	55%	0.546	C	S	.	.	H	α-helix	trans	-67.2	-39.7	178.1	-34.9	0	0	0	0	111.2	W34 A40 L41	W34-S37 WeakPolarHBondContact O-CB 3.15Å; W34-S37 PolarHBondContact O-N 3.31Å; S37-A40 PolarHBondContact O-N 2.95Å; S37-L41 WeakPolarHBondContact O-CG 3.38Å; S37-L41 PolarHBondContact O-N 3.3Å
38	R	83.1	Confident	78.1	Confident	177 Å²	177	102.6 Å²	102.6	67%	0.668	53%	0.533	S	S	*	.	H	α-helix	trans	-62.3	-44.4	173.5	-79.1	-179.1	147.1	166.6	-4.9	112.3	W34 A35 A40 L41 D42	W34-R38 PolarHBondContact O-N 3.41Å; A35-R38 PolarHBondContact O-N 2.84Å; R38-A40 VanDerWaalsContact C-N 3.32Å; R38-A40 PolarHBondContact O-N 3.46Å; R38-L41 PolarHBondContact O-N 2.71Å; R38-D42 PolarHBondContact O-N 2.59Å
39	A	83.8	Confident	78.7	Confident	47 Å²	47	105.1 Å²	105.1	39%	0.388	53%	0.528	S	S	.	.	H	α-helix	trans	-64.7	-36.2	176.2	0	0	0	0	0	112.3	A35 H36 R43	A35-A39 PolarHBondContact O-N 3.37Å; A35-A39 VanDerWaalsContact O-N 3.09Å; H36-A39 PolarHBondContact O-N 3.09Å; A39-R43 WeakPolarHBondContact O-CG 3.5Å; A39-R43 PolarHBondContact O-N 2.71Å
40	A	87.3	Confident	78.9	Confident	58 Å²	58	104.9 Å²	104.9	48%	0.479	53%	0.534	S	S	.	.	H	α-helix	trans	-66.7	-41.5	174.7	0	0	0	0	0	112.1	H36 S37 R38 R43 L44	H36-A40 WeakPolarHBondContact O-CB 3.28Å; H36-A40 PolarHBondContact O-N 2.95Å; S37-A40 PolarHBondContact O-N 2.95Å; R38-A40 VanDerWaalsContact C-N 3.32Å; R38-A40 PolarHBondContact O-N 3.46Å; A40-R43 PolarHBondContact O-N 2.94Å; A40-L44 WeakPolarHBondContact O-CB 3.4Å; A40-L44 PolarHBondContact O-N 3.47Å
41	L	87.2	Confident	79.1	Confident	103 Å²	103	104 Å²	104	54%	0.539	52%	0.517	S	S	.	.	H	α-helix	trans	-64	-44.1	176	-75.3	171.9	0	0	0	112.3	S37 R38 R43 L44 E45	S37-L41 WeakPolarHBondContact O-CG 3.38Å; S37-L41 PolarHBondContact O-N 3.3Å; R38-L41 PolarHBondContact O-N 2.71Å; L41-R43 VanDerWaalsContact C-N 3.3Å; L41-R43 PolarHBondContact O-N 2.82Å; L41-L44 WeakPolarHBondContact O-CB 3.41Å; L41-L44 PolarHBondContact O-N 3.31Å; L41-L44 VanDerWaalsContact O-N 3.13Å; L41-E45 WeakPolarHBondContact O-CG 3.22Å; L41-E45 PolarHBondContact O-N 2.75Å
42	D	85.9	Confident	79.2	Confident	76 Å²	76	101.3 Å²	101.3	41%	0.406	51%	0.507	S	S	.	.	H	α-helix	trans	-59.4	-41.1	176.7	175.8	-96.4	0	0	0	111.9	R38 E45 K46	R38-D42 PolarHBondContact O-N 2.59Å; D42-E45 PolarHBondContact O-N 3.13Å; D42-K46 WeakPolarHBondContact O-CG 3.47Å; D42-K46 PolarHBondContact O-N 3.32Å; D42-K46 WeakPolarHBondContact OD1-CE 3.4Å; D42-K46 IonicContact OD1-NZ 2.71Å; D42-K46 PolarHBondContact OD1-NZ 2.69Å; D42-K46 IonicContact OD2-NZ 3.71Å
43	R	86.8	Confident	78.7	Confident	179 Å²	179	110.8 Å²	110.8	68%	0.675	54%	0.54	S	S	*	.	H	α-helix	trans	-65.2	-43.4	174.6	-70.5	172.9	-178.8	-173.3	0.4	111.7	A39 A40 L41 K46 L47	A39-R43 WeakPolarHBondContact O-CG 3.5Å; A39-R43 PolarHBondContact O-N 2.71Å; A40-R43 PolarHBondContact O-N 2.94Å; L41-R43 VanDerWaalsContact C-N 3.3Å; L41-R43 PolarHBondContact O-N 2.82Å; R43-K46 PolarHBondContact O-N 3.13Å; R43-L47 WeakPolarHBondContact O-CG 3.47Å; R43-L47 PolarHBondContact O-N 3.15Å
44	L	90.6	Very high	78	Confident	91 Å²	91	109.2 Å²	109.2	48%	0.476	53%	0.532	S	S	.	.	H	α-helix	trans	-61.8	-44.7	176.9	-170.8	87.7	0	0	0	111.1	A40 L41 K46 L47 L48	A40-L44 WeakPolarHBondContact O-CB 3.4Å; A40-L44 PolarHBondContact O-N 3.47Å; L41-L44 WeakPolarHBondContact O-CB 3.41Å; L41-L44 PolarHBondContact O-N 3.31Å; L41-L44 VanDerWaalsContact O-N 3.13Å; L44-K46 VanDerWaalsContact C-N 3.33Å; L44-K46 PolarHBondContact O-N 2.94Å; L44-L47 PolarHBondContact O-N 2.74Å; L44-L48 HydrophobicContact CD2-CD1 4.07Å; L44-L48 HydrophobicContact CG-CD1 4.03Å; L44-L48 HydrophobicContact CG-CG 4.45Å; L44-L48 WeakPolarHBondContact O-CB 3.43Å; L44-L48 WeakPolarHBondContact O-CG 3.32Å; L44-L48 PolarHBondContact O-N 2.71Å
45	E	88.5	Confident	77.2	Confident	103 Å²	103	107.3 Å²	107.3	48%	0.481	53%	0.528	S	S	.	.	H	α-helix	trans	-61.9	-40.1	177.3	-77.1	-169.3	94.7	0	0	112	L41 D42 L48 R49	L41-E45 WeakPolarHBondContact O-CG 3.22Å; L41-E45 PolarHBondContact O-N 2.75Å; D42-E45 PolarHBondContact O-N 3.13Å; E45-L48 PolarHBondContact O-N 3.13Å; E45-R49 WeakPolarHBondContact O-CB 3.42Å; E45-R49 VanDerWaalsContact O-CG 3.28Å; E45-R49 WeakPolarHBondContact O-CG 3.48Å; E45-R49 PolarHBondContact O-N 2.94Å
46	K	84.6	Confident	75.6	Confident	118 Å²	118	109.4 Å²	109.4	51%	0.513	54%	0.541	S	S	.	.	H	α-helix	trans	-60.6	-47.2	173	-77.9	168	177.7	155.9	0	111.5	D42 R43 L44 L48 R49 C50	D42-K46 WeakPolarHBondContact O-CG 3.47Å; D42-K46 PolarHBondContact O-N 3.32Å; D42-K46 WeakPolarHBondContact OD1-CE 3.4Å; D42-K46 IonicContact OD1-NZ 2.71Å; D42-K46 PolarHBondContact OD1-NZ 2.69Å; D42-K46 IonicContact OD2-NZ 3.71Å; R43-K46 PolarHBondContact O-N 3.13Å; L44-K46 VanDerWaalsContact C-N 3.33Å; L44-K46 PolarHBondContact O-N 2.94Å; K46-L48 VanDerWaalsContact C-N 3.34Å; K46-L48 PolarHBondContact O-N 2.62Å; K46-R49 PolarHBondContact O-N 2.83Å; K46-C50 WeakPolarHBondContact O-CB 3.44Å; K46-C50 PolarHBondContact O-N 2.91Å; K46-C50 PolarHBondContact O-SG 2.87Å
47	L	84.8	Confident	73.9	Confident	122 Å²	122	110.7 Å²	110.7	64%	0.639	55%	0.549	S	S	*	.	H	α-helix	trans	-62.1	-40.4	176.4	-69	172.1	0	0	0	112.4	R43 L44 C50 S51	R43-L47 WeakPolarHBondContact O-CG 3.47Å; R43-L47 PolarHBondContact O-N 3.15Å; L44-L47 PolarHBondContact O-N 2.74Å; L47-C50 PolarHBondContact O-N 3.08Å; L47-S51 WeakPolarHBondContact O-CB 3.44Å; L47-S51 PolarHBondContact O-N 2.85Å; L47-S51 PolarHBondContact O-OG 2.85Å
48	L	83.2	Confident	72.2	Confident	87 Å²	87	113.5 Å²	113.5	46%	0.455	57%	0.568	S	S	.	*	H	α-helix	trans	-70.6	-34.2	177.3	-72.5	173.2	0	0	0	112.7	L44 E45 K46 S51 R52	L44-L48 HydrophobicContact CD2-CD1 4.07Å; L44-L48 HydrophobicContact CG-CD1 4.03Å; L44-L48 HydrophobicContact CG-CG 4.45Å; L44-L48 WeakPolarHBondContact O-CB 3.43Å; L44-L48 WeakPolarHBondContact O-CG 3.32Å; L44-L48 PolarHBondContact O-N 2.71Å; E45-L48 PolarHBondContact O-N 3.13Å; K46-L48 VanDerWaalsContact C-N 3.34Å; K46-L48 PolarHBondContact O-N 2.62Å; L48-S51 WeakPolarHBondContact CA-OG 3.16Å; L48-S51 PolarHBondContact O-OG 3.24Å; L48-S51 VanDerWaalsContact O-OG 3.05Å; L48-R52 WeakPolarHBondContact O-CB 3.46Å; L48-R52 PolarHBondContact O-N 2.86Å
49	R	76.3	Confident	70.8	Confident	167 Å²	167	111 Å²	111	63%	0.63	57%	0.573	S	S	*	*	H	α-helix	trans	-68.5	-42.3	172.8	-76.3	177.3	-178.8	-139.2	3.5	111.1	E45 K46 S51 R52 W53	E45-R49 WeakPolarHBondContact O-CB 3.42Å; E45-R49 VanDerWaalsContact O-CG 3.28Å; E45-R49 WeakPolarHBondContact O-CG 3.48Å; E45-R49 PolarHBondContact O-N 2.94Å; K46-R49 PolarHBondContact O-N 2.83Å; R49-S51 VanDerWaalsContact C-N 3.34Å; R49-S51 PolarHBondContact O-N 2.78Å; R49-R52 PolarHBondContact O-N 3Å; R49-W53 PolarHBondContact O-N 3.23Å
50	C	66.6	Low	69.4	Low	96 Å²	96	118.1 Å²	118.1	65%	0.649	60%	0.595	S	S	*	*	H	α-helix	trans	-61.3	-42.2	173.5	-67.8	0	0	0	0	111.6	K46 L47 W53 G54	K46-C50 WeakPolarHBondContact O-CB 3.44Å; K46-C50 PolarHBondContact O-N 2.91Å; K46-C50 PolarHBondContact O-SG 2.87Å; L47-C50 PolarHBondContact O-N 3.08Å; C50-W53 PolarHBondContact O-N 2.99Å; C50-G54 PolarHBondContact O-N 2.74Å
51	S	64.4	Low	68	Low	46 Å²	46	125.2 Å²	125.2	32%	0.322	62%	0.615	S	S	.	*	H	α-helix	trans	-72.7	-28.2	175.4	74.3	0	0	0	0	112.9	L47 L48 R49 W53 G54 K55	L47-S51 WeakPolarHBondContact O-CB 3.44Å; L47-S51 PolarHBondContact O-N 2.85Å; L47-S51 PolarHBondContact O-OG 2.85Å; L48-S51 WeakPolarHBondContact CA-OG 3.16Å; L48-S51 PolarHBondContact O-OG 3.24Å; L48-S51 VanDerWaalsContact O-OG 3.05Å; R49-S51 VanDerWaalsContact C-N 3.34Å; R49-S51 PolarHBondContact O-N 2.78Å; S51-W53 VanDerWaalsContact C-N 3.32Å; S51-G54 CarbonylContact O-C 3.4Å; S51-G54 WeakPolarHBondContact O-CA 3.16Å; S51-G54 PolarHBondContact O-N 2.75Å; S51-G54 VanDerWaalsContact O-N 3.08Å; S51-K55 WeakPolarHBondContact O-CB 3.16Å; S51-K55 WeakPolarHBondContact O-CG 3.45Å; S51-K55 PolarHBondContact O-N 3.48Å
52	R	62	Low	66.3	Low	167 Å²	167	125.3 Å²	125.3	63%	0.63	62%	0.624	S	S	*	*	H	α-helix	trans	-69.1	-28	173.7	-168	179	-61.1	-103	1.9	112.2	L48 R49 G54 K55 S56	L48-R52 WeakPolarHBondContact O-CB 3.46Å; L48-R52 PolarHBondContact O-N 2.86Å; R49-R52 PolarHBondContact O-N 3Å; R52-G54 VanDerWaalsContact C-N 3.31Å; R52-K55 PolarHBondContact O-N 3.3Å; R52-S56 WeakPolarHBondContact O-CB 3.15Å; R52-S56 PolarHBondContact O-N 3.07Å
53	W	57.4	Low	64.3	Low	208 Å²	208	134.2 Å²	134.2	79%	0.788	67%	0.666	S	S	*	*	H	α-helix	trans	-76.1	-21.7	168.8	-74.9	18.3	0	0	0	112.6	R49 C50 S51	R49-W53 PolarHBondContact O-N 3.23Å; C50-W53 PolarHBondContact O-N 2.99Å; S51-W53 VanDerWaalsContact C-N 3.32Å
54	G	54.5	Low	63.2	Low	48 Å²	48	132 Å²	132	50%	0.495	67%	0.666	S	S	.	*	H	α-helix	trans	-80.9	-24.9	165.3	0	0	0	0	0	114.6	C50 S51 R52 S58	C50-G54 PolarHBondContact O-N 2.74Å; S51-G54 CarbonylContact O-C 3.4Å; S51-G54 WeakPolarHBondContact O-CA 3.16Å; S51-G54 PolarHBondContact O-N 2.75Å; S51-G54 VanDerWaalsContact O-N 3.08Å; R52-G54 VanDerWaalsContact C-N 3.31Å; G54-S58 VanDerWaalsContact O-CB 3.28Å; G54-S58 WeakPolarHBondContact O-CB 3.1Å
55	K	52.8	Low	61.7	Low	150 Å²	150	134.1 Å²	134.1	65%	0.652	68%	0.676	S	S	*	*	H	α-helix	trans	-101.3	-23.2	-177.1	-71.1	-179.6	-177.4	-71	0	114.2	S51 R52 M57 S58	S51-K55 WeakPolarHBondContact O-CB 3.16Å; S51-K55 WeakPolarHBondContact O-CG 3.45Å; S51-K55 PolarHBondContact O-N 3.48Å; R52-K55 PolarHBondContact O-N 3.3Å; K55-M57 VanDerWaalsContact C-N 3.31Å; K55-S58 PolarHBondContact O-N 3.01Å
56	S	45.3	Very low	60.3	Low	91 Å²	91	135.8 Å²	135.8	64%	0.636	69%	0.687	S	S	*	*	S	Bend	trans	-80	-14.1	171.4	-162.3	0	0	0	0	112.8	R52	R52-S56 WeakPolarHBondContact O-CB 3.15Å; R52-S56 PolarHBondContact O-N 3.07Å
57	M	45	Very low	58.8	Low	162 Å²	162	136.9 Å²	136.9	80%	0.798	70%	0.697	S	S	*	*	S	Bend	trans	-98.4	-3.5	165.1	-63	-149	-61.2	0	0	113.1	K55	K55-M57 VanDerWaalsContact C-N 3.31Å
58	S	46.1	Very low	57.2	Low	88 Å²	88	137.8 Å²	137.8	62%	0.615	70%	0.701	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.2	40.3	177.2	-170.2	0	0	0	0	112.2	G54 K55	G54-S58 VanDerWaalsContact O-CB 3.28Å; G54-S58 WeakPolarHBondContact O-CB 3.1Å; K55-S58 PolarHBondContact O-N 3.01Å
59	T	53.7	Low	55.5	Low	123 Å²	123	141.2 Å²	141.2	76%	0.755	72%	0.717	S	S	*	*	T	Hydrogen-bonded Turn	trans	-128.6	21.6	158.8	53	0	0	0	0	112.3
60	K	54.9	Low	54	Low	197 Å²	197	139.4 Å²	139.4	86%	0.857	72%	0.723	S	S	*	*	S	Bend	trans	-132.2	68.6	164	-80.5	-171.9	178.3	-175.4	0	111.3
61	K	57.8	Low	53	Low	208 Å²	208	142.7 Å²	142.7	90%	0.904	73%	0.729	S	S	*	*			trans	-173.3	107.6	143.2	-146.5	170.5	179.8	-168.6	0	109.8
62	S	50.5	Low	52.1	Low	105 Å²	105	150.8 Å²	150.8	73%	0.734	76%	0.763	S	S	*	*				162.7	111.9	121.8	-165.7	0	0	0	0	110.1
63	M	44.8	Very low	51.2	Low	262 Å²	262	149.3 Å²	149.3	100%	1.291	78%	0.775	S	S	*	*			trans	69.8	0	166.6	-71.1	161.6	79.8	0	0	118.2

Retrieved 63 of 63 residues in 147.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).