A0A087X0F4_HUMAN Loading...

Serrate, RNA effector molecule

AlphaFold DB , UniProt , Accession A0A087X0F4, Species HUMAN (Homo sapiens, Human), Gene SRRT, Length 50 aa.

						>A0A087X0F4_HUMAN|A0A087X0F4|SRRT
MGDSDDEYDRRRRDKFRRERSDYDRSRERDERRRGDDWNDRDRVSLCHPG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.6	Low	72.1	Confident	255 Å²	255	125.4 Å²	125.4	100%	1.256	63%	0.634	S	S	*	*				0	95.2	0	-69.9	-159.2	175	0	0	107.6
2	G	66.7	Low	73.1	Confident	61 Å²	61	126.5 Å²	126.5	63%	0.629	63%	0.625	S	S	*	*			trans	-164.4	30	-176.3	0	0	0	0	0	111.8
3	D	56.7	Low	74.1	Confident	121 Å²	121	129.2 Å²	129.2	65%	0.647	62%	0.624	S	S	*	*			trans	-92.5	-25.1	-176.8	-92.2	-89	0	0	0	112.9	E7	D3-E7 VanDerWaalsContact O-CB 3.23Å; D3-E7 WeakPolarHBondContact O-CB 3.34Å; D3-E7 PolarHBondContact O-N 3.43Å
4	S	54.2	Low	75.2	Confident	99 Å²	99	126.6 Å²	126.6	69%	0.692	61%	0.614	S	S	*	*	H	α-helix	trans	-81	-25.6	-168.6	-58.2	0	0	0	0	115.6	Y8	S4-Y8 PolarHBondContact O-N 3.09Å
5	D	66.4	Low	76.4	Confident	126 Å²	126	126.5 Å²	126.5	67%	0.674	61%	0.61	S	S	*	*	H	α-helix	trans	-79.6	-48.1	179.3	-171.6	-115.5	0	0	0	110.9	E7 Y8 D9	D5-E7 VanDerWaalsContact C-N 3.26Å; D5-E7 PolarHBondContact O-N 3.34Å; D5-Y8 PolarHBondContact O-N 2.95Å; D5-Y8 VanDerWaalsContact O-N 3.1Å; D5-D9 PolarHBondContact O-N 3.42Å
6	D	75	Confident	77	Confident	80 Å²	80	126.6 Å²	126.6	43%	0.428	61%	0.607	S	S	.	*	H	α-helix	trans	-62.3	-34	175.3	-130.3	-82.5	0	0	0	111.8	R10	D6-R10 WeakPolarHBondContact O-CB 3.42Å; D6-R10 WeakPolarHBondContact O-CD 3.45Å; D6-R10 WeakPolarHBondContact O-CG 3.47Å; D6-R10 PolarHBondContact O-N 2.86Å; D6-R10 IonicContact OD1-CZ 3.21Å; D6-R10 IonicContact OD1-NE 2.95Å; D6-R10 PolarHBondContact OD1-NE 3.19Å; D6-R10 IonicContact OD1-NH2 2.72Å; D6-R10 PolarHBondContact OD1-NH2 2.95Å
7	E	77.9	Confident	77.5	Confident	92 Å²	92	128.2 Å²	128.2	43%	0.43	61%	0.605	S	S	.	*	H	α-helix	trans	-67.7	-37	175.2	-163.6	-165.9	153.6	0	0	112.4	D3 D5 R10 R11	D3-E7 VanDerWaalsContact O-CB 3.23Å; D3-E7 WeakPolarHBondContact O-CB 3.34Å; D3-E7 PolarHBondContact O-N 3.43Å; D5-E7 VanDerWaalsContact C-N 3.26Å; D5-E7 PolarHBondContact O-N 3.34Å; E7-R10 PolarHBondContact O-N 3.21Å; E7-R11 WeakPolarHBondContact O-CB 3.43Å; E7-R11 PolarHBondContact O-N 2.91Å; E7-R11 IonicContact OE1-CZ 2.85Å; E7-R11 IonicContact OE1-NH2 3.88Å; E7-R11 PolarHBondContact OE1-NH2 3.06Å
8	Y	83.4	Confident	78.1	Confident	151 Å²	151	131.2 Å²	131.2	59%	0.592	61%	0.61	S	S	*	*	H	α-helix	trans	-65.7	-45.1	178	-174.2	-96.7	0	0	0	111.1	S4 D5 R11 R12	S4-Y8 PolarHBondContact O-N 3.09Å; D5-Y8 PolarHBondContact O-N 2.95Å; D5-Y8 VanDerWaalsContact O-N 3.1Å; Y8-R11 PolarHBondContact O-N 3.03Å; Y8-R12 VanDerWaalsContact O-CB 3.27Å; Y8-R12 WeakPolarHBondContact O-CB 3.22Å; Y8-R12 PolarHBondContact O-N 3.33Å
9	D	84.6	Confident	78.6	Confident	88 Å²	88	129.4 Å²	129.4	47%	0.471	60%	0.601	S	S	.	*	H	α-helix	trans	-65.6	-39.8	177.2	-83.2	-33.7	0	0	0	112.5	D5 R12 R13	D5-D9 PolarHBondContact O-N 3.42Å; D9-R12 PolarHBondContact O-N 3.41Å; D9-R13 WeakPolarHBondContact O-CB 3.09Å; D9-R13 PolarHBondContact O-N 2.84Å
10	R	84.6	Confident	78.5	Confident	142 Å²	142	133.5 Å²	133.5	54%	0.536	61%	0.611	S	S	.	*	H	α-helix	trans	-61.3	-49.8	172.7	-71.6	167.8	-158.2	176.2	3.7	110.9	D6 E7 R12 R13 D14	D6-R10 WeakPolarHBondContact O-CB 3.42Å; D6-R10 WeakPolarHBondContact O-CD 3.45Å; D6-R10 WeakPolarHBondContact O-CG 3.47Å; D6-R10 PolarHBondContact O-N 2.86Å; D6-R10 IonicContact OD1-CZ 3.21Å; D6-R10 IonicContact OD1-NE 2.95Å; D6-R10 PolarHBondContact OD1-NE 3.19Å; D6-R10 IonicContact OD1-NH2 2.72Å; D6-R10 PolarHBondContact OD1-NH2 2.95Å; E7-R10 PolarHBondContact O-N 3.21Å; R10-R12 VanDerWaalsContact C-N 3.32Å; R10-R12 PolarHBondContact O-N 3.4Å; R10-R13 PolarHBondContact O-N 2.74Å; R10-D14 WeakPolarHBondContact O-CB 3.34Å; R10-D14 PolarHBondContact O-N 3.19Å
11	R	85.9	Confident	78.8	Confident	164 Å²	164	129.5 Å²	129.5	62%	0.619	60%	0.599	S	S	*	*	H	α-helix	trans	-60.8	-41.3	179.9	-173.6	-179.2	-66	-160.9	2.5	111.6	E7 Y8 D14 K15	E7-R11 WeakPolarHBondContact O-CB 3.43Å; E7-R11 PolarHBondContact O-N 2.91Å; E7-R11 IonicContact OE1-CZ 2.85Å; E7-R11 IonicContact OE1-NH2 3.88Å; E7-R11 PolarHBondContact OE1-NH2 3.06Å; Y8-R11 PolarHBondContact O-N 3.03Å; R11-D14 PolarHBondContact O-N 3.07Å; R11-K15 WeakPolarHBondContact O-CB 3.31Å; R11-K15 PolarHBondContact O-N 3.5Å
12	R	84.5	Confident	80	Confident	139 Å²	139	121.8 Å²	121.8	53%	0.525	56%	0.563	S	S	.	*	H	α-helix	trans	-64.1	-47.6	177	-173.7	179.3	-173.2	-179.4	2.8	111.3	Y8 D9 R10 D14 K15 F16	Y8-R12 VanDerWaalsContact O-CB 3.27Å; Y8-R12 WeakPolarHBondContact O-CB 3.22Å; Y8-R12 PolarHBondContact O-N 3.33Å; D9-R12 PolarHBondContact O-N 3.41Å; R10-R12 VanDerWaalsContact C-N 3.32Å; R10-R12 PolarHBondContact O-N 3.4Å; R12-D14 VanDerWaalsContact C-N 3.34Å; R12-D14 PolarHBondContact O-N 2.71Å; R12-K15 PolarHBondContact O-N 2.79Å; R12-F16 HydrophobicContact CG-CD2 4.14Å; R12-F16 HydrophobicContact CG-CE2 3.69Å; R12-F16 WeakPolarHBondContact O-CD2 3.4Å; R12-F16 PolarHBondContact O-N 3.14Å
13	R	86.1	Confident	80.9	Confident	162 Å²	162	127 Å²	127	61%	0.611	57%	0.565	S	S	*	*	H	α-helix	trans	-62.3	-41.7	177	-172.8	179.6	-68.6	-137.3	1.1	111.9	D9 R10 F16 R17	D9-R13 WeakPolarHBondContact O-CB 3.09Å; D9-R13 PolarHBondContact O-N 2.84Å; R10-R13 PolarHBondContact O-N 2.74Å; R13-F16 PolarHBondContact O-N 2.7Å; R13-R17 WeakPolarHBondContact O-CG 3.36Å; R13-R17 PolarHBondContact O-N 3.44Å; R13-R17 VanDerWaalsContact O-N 3.12Å
14	D	89.6	Confident	82.2	Confident	92 Å²	92	126.4 Å²	126.4	49%	0.492	56%	0.561	S	S	.	*	H	α-helix	trans	-66.6	-40.3	179.7	-145.3	-99	0	0	0	111.5	R10 R11 R12 F16 R17 R18	R10-D14 WeakPolarHBondContact O-CB 3.34Å; R10-D14 PolarHBondContact O-N 3.19Å; R11-D14 PolarHBondContact O-N 3.07Å; R12-D14 VanDerWaalsContact C-N 3.34Å; R12-D14 PolarHBondContact O-N 2.71Å; D14-F16 PolarHBondContact O-N 3.21Å; D14-R17 PolarHBondContact O-N 2.95Å; D14-R18 WeakPolarHBondContact O-CB 3.43Å; D14-R18 PolarHBondContact O-N 3Å
15	K	92.6	Very high	83.1	Confident	126 Å²	126	130 Å²	130	55%	0.548	56%	0.559	S	S	.	*	H	α-helix	trans	-57.1	-49.1	173.6	-167.5	-168.2	172.3	-168	0	111.8	R11 R12 R17 R18 E19	R11-K15 WeakPolarHBondContact O-CB 3.31Å; R11-K15 PolarHBondContact O-N 3.5Å; R12-K15 PolarHBondContact O-N 2.79Å; K15-R17 VanDerWaalsContact C-N 3.33Å; K15-R17 PolarHBondContact O-N 2.93Å; K15-R18 PolarHBondContact O-N 3.42Å; K15-R18 VanDerWaalsContact O-N 3.16Å; K15-E19 WeakPolarHBondContact CE-OE1 3.46Å; K15-E19 WeakPolarHBondContact CE-OE2 3.46Å; K15-E19 HydrophobicContact CG-CG 4.33Å; K15-E19 WeakPolarHBondContact CG-OE2 3.3Å; K15-E19 IonicContact NZ-OE1 3.86Å; K15-E19 WeakPolarHBondContact O-CB 3.34Å; K15-E19 WeakPolarHBondContact O-CG 3.37Å; K15-E19 PolarHBondContact O-N 3Å
16	F	86.8	Confident	83.8	Confident	127 Å²	127	126.8 Å²	126.8	56%	0.557	55%	0.547	S	S	*	.	H	α-helix	trans	-62.8	-38.5	178.8	-76.2	-64	0	0	0	113	R12 R13 D14 R20	R12-F16 HydrophobicContact CG-CD2 4.14Å; R12-F16 HydrophobicContact CG-CE2 3.69Å; R12-F16 WeakPolarHBondContact O-CD2 3.4Å; R12-F16 PolarHBondContact O-N 3.14Å; R13-F16 PolarHBondContact O-N 2.7Å; D14-F16 PolarHBondContact O-N 3.21Å; F16-R20 WeakPolarHBondContact O-CB 3.41Å; F16-R20 PolarHBondContact O-N 3.47Å; F16-R20 VanDerWaalsContact O-N 3.11Å
17	R	85.8	Confident	84.1	Confident	154 Å²	154	130.5 Å²	130.5	58%	0.581	56%	0.555	S	S	*	*	H	α-helix	trans	-63.6	-44.6	174	-73.9	178.5	-179.3	163	-4.5	111.2	R13 D14 K15 R20 S21	R13-R17 WeakPolarHBondContact O-CG 3.36Å; R13-R17 PolarHBondContact O-N 3.44Å; R13-R17 VanDerWaalsContact O-N 3.12Å; D14-R17 PolarHBondContact O-N 2.95Å; K15-R17 VanDerWaalsContact C-N 3.33Å; K15-R17 PolarHBondContact O-N 2.93Å; R17-R20 PolarHBondContact O-N 2.92Å; R17-S21 PolarHBondContact O-N 3.34Å
18	R	87.6	Confident	84.4	Confident	182 Å²	182	131 Å²	131	69%	0.687	56%	0.558	S	S	*	*	H	α-helix	trans	-64.5	-49.8	179.7	-168	171.5	-162.4	161.3	5.1	111.6	D14 K15 R20 S21 D22	D14-R18 WeakPolarHBondContact O-CB 3.43Å; D14-R18 PolarHBondContact O-N 3Å; K15-R18 PolarHBondContact O-N 3.42Å; K15-R18 VanDerWaalsContact O-N 3.16Å; R18-R20 VanDerWaalsContact C-N 3.29Å; R18-R20 PolarHBondContact O-N 2.81Å; R18-S21 PolarHBondContact O-N 2.72Å; R18-S21 VanDerWaalsContact O-N 3.15Å; R18-D22 WeakPolarHBondContact O-CB 3.12Å; R18-D22 PolarHBondContact O-N 2.97Å
19	E	87.3	Confident	84.1	Confident	97 Å²	97	131.7 Å²	131.7	45%	0.453	56%	0.559	S	S	.	*	H	α-helix	trans	-58.1	-41	178	-74	178.9	121.1	0	0	111.7	K15 D22 Y23	K15-E19 WeakPolarHBondContact CE-OE1 3.46Å; K15-E19 WeakPolarHBondContact CE-OE2 3.46Å; K15-E19 HydrophobicContact CG-CG 4.33Å; K15-E19 WeakPolarHBondContact CG-OE2 3.3Å; K15-E19 IonicContact NZ-OE1 3.86Å; K15-E19 WeakPolarHBondContact O-CB 3.34Å; K15-E19 WeakPolarHBondContact O-CG 3.37Å; K15-E19 PolarHBondContact O-N 3Å; E19-D22 PolarHBondContact O-N 3.29Å; E19-Y23 WeakPolarHBondContact O-CB 3.27Å; E19-Y23 PolarHBondContact O-N 3.03Å
20	R	76.5	Confident	84	Confident	211 Å²	211	132 Å²	132	80%	0.796	56%	0.561	S	S	*	*	H	α-helix	trans	-65.4	-42.5	176.2	-165.1	178.6	-162.7	-138.6	3.3	112.5	F16 R17 R18 D24	F16-R20 WeakPolarHBondContact O-CB 3.41Å; F16-R20 PolarHBondContact O-N 3.47Å; F16-R20 VanDerWaalsContact O-N 3.11Å; R17-R20 PolarHBondContact O-N 2.92Å; R18-R20 VanDerWaalsContact C-N 3.29Å; R18-R20 PolarHBondContact O-N 2.81Å; R20-D24 PolarHBondContact O-N 3.39Å
21	S	84.4	Confident	83.8	Confident	50 Å²	50	131.4 Å²	131.4	35%	0.35	56%	0.564	S	S	.	*	H	α-helix	trans	-69.9	-34.7	177.5	-178.1	0	0	0	0	112.5	R17 R18 R25	R17-S21 PolarHBondContact O-N 3.34Å; R18-S21 PolarHBondContact O-N 2.72Å; R18-S21 VanDerWaalsContact O-N 3.15Å; S21-R25 WeakPolarHBondContact O-CB 3.24Å; S21-R25 PolarHBondContact O-N 3.22Å
22	D	83	Confident	83.2	Confident	93 Å²	93	130.6 Å²	130.6	50%	0.497	56%	0.561	S	S	.	*	H	α-helix	trans	-71.2	-40.1	180	-149.1	-75.9	0	0	0	110.9	R18 E19 S26	R18-D22 WeakPolarHBondContact O-CB 3.12Å; R18-D22 PolarHBondContact O-N 2.97Å; E19-D22 PolarHBondContact O-N 3.29Å; D22-S26 WeakPolarHBondContact O-CA 3.04Å; D22-S26 WeakPolarHBondContact O-CB 3.48Å; D22-S26 PolarHBondContact O-N 2.8Å; D22-S26 PolarHBondContact O-OG 3.04Å; D22-S26 PolarHBondContact OD1-OG 3.45Å
23	Y	85.9	Confident	82.8	Confident	172 Å²	172	132.3 Å²	132.3	68%	0.675	57%	0.568	S	S	*	*	H	α-helix	trans	-60.9	-46.1	173.4	-174.3	-99.4	0	0	0	112.3	E19 S26 R27	E19-Y23 WeakPolarHBondContact O-CB 3.27Å; E19-Y23 PolarHBondContact O-N 3.03Å; Y23-S26 PolarHBondContact O-N 3.47Å; Y23-R27 VanDerWaalsContact O-CB 3.29Å; Y23-R27 WeakPolarHBondContact O-CB 3.24Å; Y23-R27 PolarHBondContact O-N 2.88Å
24	D	83.3	Confident	82.1	Confident	107 Å²	107	131.8 Å²	131.8	57%	0.572	57%	0.566	S	S	*	*	H	α-helix	trans	-63.2	-48.8	179.4	-173.1	-108.4	0	0	0	112	R20 R27 E28	R20-D24 PolarHBondContact O-N 3.39Å; D24-R27 PolarHBondContact O-N 2.83Å; D24-E28 PolarHBondContact O-N 3.32Å
25	R	74.2	Confident	81.2	Confident	174 Å²	174	129.3 Å²	129.3	66%	0.657	56%	0.562	S	S	*	*	H	α-helix	trans	-65.8	-39.9	175.9	-79.2	-170.1	175.5	131.6	-1.9	113.4	S21 R27 E28 R29	S21-R25 WeakPolarHBondContact O-CB 3.24Å; S21-R25 PolarHBondContact O-N 3.22Å; R25-R27 VanDerWaalsContact C-N 3.32Å; R25-E28 PolarHBondContact O-N 2.92Å; R25-R29 VanDerWaalsContact O-CB 3.24Å; R25-R29 WeakPolarHBondContact O-CB 3.46Å; R25-R29 PolarHBondContact O-N 3.25Å
26	S	81.6	Confident	80.1	Confident	60 Å²	60	129 Å²	129	42%	0.42	57%	0.566	S	S	.	*	H	α-helix	trans	-66.4	-38.5	179.2	-72.1	0	0	0	0	110.7	D22 Y23 R29 D30	D22-S26 WeakPolarHBondContact O-CA 3.04Å; D22-S26 WeakPolarHBondContact O-CB 3.48Å; D22-S26 PolarHBondContact O-N 2.8Å; D22-S26 PolarHBondContact O-OG 3.04Å; D22-S26 PolarHBondContact OD1-OG 3.45Å; Y23-S26 PolarHBondContact O-N 3.47Å; S26-R29 PolarHBondContact O-N 2.81Å; S26-D30 WeakPolarHBondContact O-CB 3.29Å; S26-D30 PolarHBondContact O-N 3.45Å
27	R	80.8	Confident	79.1	Confident	157 Å²	157	127.8 Å²	127.8	59%	0.592	57%	0.565	S	S	*	*	H	α-helix	trans	-64.7	-46.8	174.2	-174.2	-178.8	-180	-179.9	1.8	112	Y23 D24 R25 R29 D30 E31	Y23-R27 VanDerWaalsContact O-CB 3.29Å; Y23-R27 WeakPolarHBondContact O-CB 3.24Å; Y23-R27 PolarHBondContact O-N 2.88Å; D24-R27 PolarHBondContact O-N 2.83Å; R25-R27 VanDerWaalsContact C-N 3.32Å; R27-R29 VanDerWaalsContact C-N 3.31Å; R27-R29 PolarHBondContact O-N 2.85Å; R27-D30 PolarHBondContact O-N 3.25Å; R27-E31 VanDerWaalsContact O-CB 3.24Å; R27-E31 WeakPolarHBondContact O-CB 3.36Å; R27-E31 PolarHBondContact O-N 2.81Å
28	E	83.7	Confident	78.3	Confident	104 Å²	104	128.1 Å²	128.1	49%	0.486	57%	0.567	S	S	.	*	H	α-helix	trans	-64.6	-38.4	178.4	-164.9	-160.5	91.7	0	0	111.6	D24 R25 R32	D24-E28 PolarHBondContact O-N 3.32Å; R25-E28 PolarHBondContact O-N 2.92Å; E28-R32 WeakPolarHBondContact O-CB 3.35Å; E28-R32 WeakPolarHBondContact O-CG 3.49Å; E28-R32 PolarHBondContact O-N 3.43Å; E28-R32 IonicContact OE1-CZ 3.39Å; E28-R32 IonicContact OE1-NE 3.21Å; E28-R32 PolarHBondContact OE1-NE 3.35Å; E28-R32 IonicContact OE1-NH2 2.71Å; E28-R32 PolarHBondContact OE1-NH2 3.29Å
29	R	78.1	Confident	77	Confident	165 Å²	165	123 Å²	123	62%	0.623	55%	0.553	S	S	*	*	H	α-helix	trans	-66.4	-42.8	175.5	-169.8	-178.3	-158.6	-139.9	4.7	112	R25 S26 R27 R33	R25-R29 VanDerWaalsContact O-CB 3.24Å; R25-R29 WeakPolarHBondContact O-CB 3.46Å; R25-R29 PolarHBondContact O-N 3.25Å; S26-R29 PolarHBondContact O-N 2.81Å; R27-R29 VanDerWaalsContact C-N 3.31Å; R27-R29 PolarHBondContact O-N 2.85Å; R29-R33 VanDerWaalsContact O-CB 3.27Å; R29-R33 WeakPolarHBondContact O-CB 3.21Å; R29-R33 PolarHBondContact O-N 3.16Å
30	D	81.3	Confident	75.8	Confident	93 Å²	93	122.7 Å²	122.7	50%	0.497	56%	0.555	S	S	.	*	H	α-helix	trans	-67.6	-40.5	176.7	-170	-103.5	0	0	0	111.1	S26 R27 R32 R33 R34	S26-D30 WeakPolarHBondContact O-CB 3.29Å; S26-D30 PolarHBondContact O-N 3.45Å; R27-D30 PolarHBondContact O-N 3.25Å; D30-R32 PolarHBondContact O-N 3.15Å; D30-R33 PolarHBondContact O-N 3.05Å; D30-R34 WeakPolarHBondContact O-CB 3.4Å; D30-R34 PolarHBondContact O-N 3.12Å
31	E	80.1	Confident	75.1	Confident	130 Å²	130	121 Å²	121	61%	0.607	55%	0.548	S	S	*	.	H	α-helix	trans	-63.3	-43.2	175.9	-172.4	173.4	119.1	0	0	111.5	R27 G35	R27-E31 VanDerWaalsContact O-CB 3.24Å; R27-E31 WeakPolarHBondContact O-CB 3.36Å; R27-E31 PolarHBondContact O-N 2.81Å; E31-G35 WeakPolarHBondContact O-CA 3.44Å; E31-G35 PolarHBondContact O-N 3.11Å
32	R	74.9	Confident	73.9	Confident	147 Å²	147	122.7 Å²	122.7	56%	0.555	55%	0.553	S	S	*	*	H	α-helix	trans	-63.5	-43.5	172.4	-75.6	-172.4	-85.1	109	-8.4	111.9	E28 D30 D36	E28-R32 WeakPolarHBondContact O-CB 3.35Å; E28-R32 WeakPolarHBondContact O-CG 3.49Å; E28-R32 PolarHBondContact O-N 3.43Å; E28-R32 IonicContact OE1-CZ 3.39Å; E28-R32 IonicContact OE1-NE 3.21Å; E28-R32 PolarHBondContact OE1-NE 3.35Å; E28-R32 IonicContact OE1-NH2 2.71Å; E28-R32 PolarHBondContact OE1-NH2 3.29Å; D30-R32 PolarHBondContact O-N 3.15Å; R32-D36 WeakPolarHBondContact O-CB 3.35Å; R32-D36 PolarHBondContact O-N 2.99Å
33	R	74.8	Confident	72.7	Confident	176 Å²	176	126 Å²	126	66%	0.664	56%	0.559	S	S	*	*	H	α-helix	trans	-68.8	-44.2	-179.2	-171.3	-177	-161.1	130	6.6	112.8	R29 D30 D36 D37	R29-R33 VanDerWaalsContact O-CB 3.27Å; R29-R33 WeakPolarHBondContact O-CB 3.21Å; R29-R33 PolarHBondContact O-N 3.16Å; D30-R33 PolarHBondContact O-N 3.05Å; R33-D36 WeakPolarHBondContact O-CB 3.09Å; R33-D36 PolarHBondContact O-N 2.72Å; R33-D37 PolarHBondContact O-N 3.47Å
34	R	72.4	Confident	71.5	Confident	151 Å²	151	121.5 Å²	121.5	57%	0.57	55%	0.549	S	S	*	.	H	α-helix	trans	-70.4	-39.9	178.2	-168.7	175.5	-169.7	-165.3	-0.9	110	D30 D36 D37 W38	D30-R34 WeakPolarHBondContact O-CB 3.4Å; D30-R34 PolarHBondContact O-N 3.12Å; R34-D36 VanDerWaalsContact C-N 3.27Å; R34-D36 PolarHBondContact O-N 2.95Å; R34-D37 PolarHBondContact O-N 2.84Å; R34-W38 PolarHBondContact O-N 3.33Å
35	G	70.9	Confident	70.4	Confident	40 Å²	40	120.1 Å²	120.1	41%	0.412	55%	0.548	S	S	.	.	H	α-helix	trans	-55.3	-43.6	170.1	0	0	0	0	0	111.7	E31 N39	E31-G35 WeakPolarHBondContact O-CA 3.44Å; E31-G35 PolarHBondContact O-N 3.11Å; G35-N39 VanDerWaalsContact O-CB 3.3Å; G35-N39 WeakPolarHBondContact O-CB 3.37Å; G35-N39 PolarHBondContact O-N 3.46Å
36	D	68.3	Low	69.7	Low	119 Å²	119	117.6 Å²	117.6	64%	0.636	55%	0.547	S	S	*	.	H	α-helix	trans	-65.6	-44.4	176.1	-135.5	-105.4	0	0	0	112.5	R32 R33 R34 N39 D40	R32-D36 WeakPolarHBondContact O-CB 3.35Å; R32-D36 PolarHBondContact O-N 2.99Å; R33-D36 WeakPolarHBondContact O-CB 3.09Å; R33-D36 PolarHBondContact O-N 2.72Å; R34-D36 VanDerWaalsContact C-N 3.27Å; R34-D36 PolarHBondContact O-N 2.95Å; D36-N39 CarbonylContact O-C 3.57Å; D36-N39 PolarHBondContact O-N 3.01Å; D36-D40 VanDerWaalsContact O-CB 3.31Å; D36-D40 WeakPolarHBondContact O-CB 3.36Å; D36-D40 PolarHBondContact O-N 2.94Å
37	D	67.2	Low	68.4	Low	101 Å²	101	119.3 Å²	119.3	54%	0.54	56%	0.558	S	S	.	*	H	α-helix	trans	-64	-41.2	178.3	-176.1	-101	0	0	0	112.8	R33 R34 R41	R33-D37 PolarHBondContact O-N 3.47Å; R34-D37 PolarHBondContact O-N 2.84Å; D37-R41 PolarHBondContact O-N 2.86Å
38	W	67	Low	67.1	Low	162 Å²	162	119.3 Å²	119.3	61%	0.614	56%	0.564	S	S	*	*	H	α-helix	trans	-68.5	-35.8	172.3	-78.8	96.2	0	0	0	112.1	R34 D42	R34-W38 PolarHBondContact O-N 3.33Å; W38-D42 WeakPolarHBondContact O-CB 3.4Å; W38-D42 PolarHBondContact O-N 3.27Å; W38-D42 VanDerWaalsContact O-N 3.14Å
39	N	61.3	Low	65.7	Low	73 Å²	73	120.4 Å²	120.4	39%	0.39	58%	0.58	S	S	.	*	H	α-helix	trans	-70.6	-36.6	175.9	-135.9	-97.8	0	0	0	111.9	G35 D36 D42 R43	G35-N39 VanDerWaalsContact O-CB 3.3Å; G35-N39 WeakPolarHBondContact O-CB 3.37Å; G35-N39 PolarHBondContact O-N 3.46Å; D36-N39 CarbonylContact O-C 3.57Å; D36-N39 PolarHBondContact O-N 3.01Å; N39-D42 PolarHBondContact O-N 3.4Å; N39-R43 WeakPolarHBondContact O-CB 3.33Å; N39-R43 VanDerWaalsContact O-CG 3.22Å; N39-R43 WeakPolarHBondContact O-CG 3.23Å; N39-R43 PolarHBondContact O-N 3.18Å; N39-R43 PolarHBondContact OD1-NE 3.41Å; N39-R43 PolarHBondContact OD1-NH2 3.21Å; N39-R43 VanDerWaalsContact OD1-NH2 3.09Å
40	D	62.9	Low	64.4	Low	92 Å²	92	119.3 Å²	119.3	49%	0.492	62%	0.62	S	S	.	*	H	α-helix	trans	-66	-44.7	177.2	-173	-100.4	0	0	0	110.2	D36 D42 R43 V44	D36-D40 VanDerWaalsContact O-CB 3.31Å; D36-D40 WeakPolarHBondContact O-CB 3.36Å; D36-D40 PolarHBondContact O-N 2.94Å; D40-D42 VanDerWaalsContact C-N 3.33Å; D40-D42 PolarHBondContact O-N 3.39Å; D40-R43 PolarHBondContact O-N 3.47Å; D40-V44 WeakPolarHBondContact O-CG1 3.21Å; D40-V44 WeakPolarHBondContact O-CG2 3.38Å; D40-V44 PolarHBondContact O-N 2.85Å
41	R	60.3	Low	63.5	Low	174 Å²	174	120.6 Å²	120.6	66%	0.657	63%	0.626	S	S	*	*	H	α-helix	trans	-61.5	-37.4	174.3	-115.6	-179.2	170.7	-171.4	-2.2	113.8	D37 V44 S45	D37-R41 PolarHBondContact O-N 2.86Å; R41-V44 WeakPolarHBondContact O-CG2 3.27Å; R41-S45 WeakPolarHBondContact O-CB 3.48Å; R41-S45 PolarHBondContact O-N 3.49Å; R41-S45 PolarHBondContact O-OG 3.4Å
42	D	59.8	Low	62.6	Low	87 Å²	87	120.1 Å²	120.1	47%	0.465	63%	0.627	S	S	.	*	H	α-helix	trans	-68.8	-42.9	175	-170.9	-106.8	0	0	0	110.8	W38 N39 D40 S45 L46	W38-D42 WeakPolarHBondContact O-CB 3.4Å; W38-D42 PolarHBondContact O-N 3.27Å; W38-D42 VanDerWaalsContact O-N 3.14Å; N39-D42 PolarHBondContact O-N 3.4Å; D40-D42 VanDerWaalsContact C-N 3.33Å; D40-D42 PolarHBondContact O-N 3.39Å; D42-S45 WeakPolarHBondContact CA-OG 3.46Å; D42-S45 PolarHBondContact O-N 2.95Å; D42-S45 PolarHBondContact O-OG 3.4Å; D42-L46 WeakPolarHBondContact O-CB 3.34Å; D42-L46 WeakPolarHBondContact O-CD1 3.45Å; D42-L46 PolarHBondContact O-N 3.48Å
43	R	58.9	Low	62	Low	161 Å²	161	118.6 Å²	118.6	61%	0.608	63%	0.631	S	S	*	*	H	α-helix	trans	-67.1	-42.4	177.1	-71.9	174.7	-169.6	-154.6	3.7	113.3	N39 D40 S45 L46 C47	N39-R43 WeakPolarHBondContact O-CB 3.33Å; N39-R43 VanDerWaalsContact O-CG 3.22Å; N39-R43 WeakPolarHBondContact O-CG 3.23Å; N39-R43 PolarHBondContact O-N 3.18Å; N39-R43 PolarHBondContact OD1-NE 3.41Å; N39-R43 PolarHBondContact OD1-NH2 3.21Å; N39-R43 VanDerWaalsContact OD1-NH2 3.09Å; D40-R43 PolarHBondContact O-N 3.47Å; R43-S45 VanDerWaalsContact C-N 3.27Å; R43-S45 PolarHBondContact O-N 2.85Å; R43-L46 PolarHBondContact O-N 3.2Å; R43-C47 WeakPolarHBondContact O-CB 3.1Å; R43-C47 PolarHBondContact O-N 3.31Å; R43-C47 PolarHBondContact O-SG 3.1Å; R43-C47 VanDerWaalsContact O-SG 3.34Å
44	V	59.9	Low	61.2	Low	78 Å²	78	115.2 Å²	115.2	47%	0.473	63%	0.629	S	S	.	*	H	α-helix	trans	-69.2	-26.1	177.4	-60.5	0	0	0	0	112.5	D40 R41	D40-V44 WeakPolarHBondContact O-CG1 3.21Å; D40-V44 WeakPolarHBondContact O-CG2 3.38Å; D40-V44 PolarHBondContact O-N 2.85Å; R41-V44 WeakPolarHBondContact O-CG2 3.27Å
45	S	59.8	Low	60.5	Low	79 Å²	79	113 Å²	113	55%	0.552	63%	0.633	S	S	*	*	H	α-helix	trans	-85.6	-29.1	174.8	55.7	0	0	0	0	113.6	R41 D42 R43	R41-S45 WeakPolarHBondContact O-CB 3.48Å; R41-S45 PolarHBondContact O-N 3.49Å; R41-S45 PolarHBondContact O-OG 3.4Å; D42-S45 WeakPolarHBondContact CA-OG 3.46Å; D42-S45 PolarHBondContact O-N 2.95Å; D42-S45 PolarHBondContact O-OG 3.4Å; R43-S45 VanDerWaalsContact C-N 3.27Å; R43-S45 PolarHBondContact O-N 2.85Å
46	L	58.9	Low	59.8	Low	121 Å²	121	117.9 Å²	117.9	63%	0.634	65%	0.648	S	S	*	*	H	α-helix	trans	-75.5	-22.4	170.8	-92.9	88.3	0	0	0	113.7	D42 R43	D42-L46 WeakPolarHBondContact O-CB 3.34Å; D42-L46 WeakPolarHBondContact O-CD1 3.45Å; D42-L46 PolarHBondContact O-N 3.48Å; R43-L46 PolarHBondContact O-N 3.2Å
47	C	54.4	Low	59.2	Low	96 Å²	96	117.8 Å²	117.8	65%	0.649	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.7	4.7	-178.4	-75.1	0	0	0	0	115.6	R43	R43-C47 WeakPolarHBondContact O-CB 3.1Å; R43-C47 PolarHBondContact O-N 3.31Å; R43-C47 PolarHBondContact O-SG 3.1Å; R43-C47 VanDerWaalsContact O-SG 3.34Å
48	H	55.2	Low	58.6	Low	157 Å²	157	119.1 Å²	119.1	73%	0.727	66%	0.657	S	S	*	*			trans	-130.1	79.2	173.1	-70.2	88.9	0	0	0	113.9
49	P	53.6	Low	57.9	Low	126 Å²	126	115.5 Å²	115.5	82%	0.818	66%	0.661	S	S	*	*			trans	-91.7	87.5	145.9	33.3	-24.4	0	0	0	108.2
50	G	49.9	Very low	57.6	Low	142 Å²	142	119.4 Å²	119.4	100%	1.464	69%	0.685	S	S	*	*			trans	-165.3	0	178.7	0	0	0	0	0	112.1

Retrieved 50 of 50 residues in 118.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).