A0A087X0H3_HUMAN Loading...

Testis specific 10 interacting protein

AlphaFold DB , UniProt , Accession A0A087X0H3, Species HUMAN (Homo sapiens, Human), Gene TSGA10IP, Length 49 aa.

						>A0A087X0H3_HUMAN|A0A087X0H3|TSGA10IP
DMLNTYQQLVRTPSVRPGQDVRLQAPGTRTGLLKLLSTVSQDKQVREAQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	D	63.9	Low	75.4	Confident	177 Å²	177	132.9 Å²	132.9	95%	0.947	65%	0.65	S	S	*	*				0	19.7	0	-66.2	-56.5	0	0	0	117.7	T5	D1-T5 PolarHBondContact O-OG1 3.16Å
2	M	73.6	Confident	75	Confident	137 Å²	137	129.6 Å²	129.6	68%	0.675	64%	0.644	S	S	*	*	H	α-helix	trans	-69.8	-34.5	173.6	-73.1	-89.6	-79	0	0	112.7	N4 T5 Y6	M2-N4 VanDerWaalsContact C-N 3.28Å; M2-N4 PolarHBondContact O-N 3.14Å; M2-T5 PolarHBondContact O-N 3.28Å; M2-Y6 HydrophobicContact CE-CE2 4.29Å; M2-Y6 VanDerWaalsContact O-CD2 3.31Å; M2-Y6 WeakPolarHBondContact O-CD2 3.27Å; M2-Y6 PolarHBondContact O-N 3.46Å; M2-Y6 VanDerWaalsContact O-N 3.13Å
3	L	78.4	Confident	74.5	Confident	131 Å²	131	127.3 Å²	127.3	69%	0.686	64%	0.644	S	S	*	*	H	α-helix	trans	-61.6	-33.1	-179.9	-107.6	165.4	0	0	0	113.4	Q7	L3-Q7 VanDerWaalsContact O-CG 3.31Å; L3-Q7 WeakPolarHBondContact O-CG 3.31Å; L3-Q7 PolarHBondContact O-N 3.23Å; L3-Q7 PolarHBondContact O-NE2 2.78Å; L3-Q7 VanDerWaalsContact O-NE2 3.14Å
4	N	75.8	Confident	74.2	Confident	85 Å²	85	126.2 Å²	126.2	46%	0.455	65%	0.654	S	S	.	*	H	α-helix	trans	-70.6	-40.8	178.2	-176.9	35.3	0	0	0	111.1	M2 Q7 Q8	M2-N4 VanDerWaalsContact C-N 3.28Å; M2-N4 PolarHBondContact O-N 3.14Å; N4-Q7 PolarHBondContact O-N 3.33Å; N4-Q8 PolarHBondContact ND2-NE2 3.01Å; N4-Q8 VanDerWaalsContact ND2-NE2 3.16Å; N4-Q8 WeakPolarHBondContact O-CG 3.4Å; N4-Q8 PolarHBondContact O-N 2.93Å; N4-Q8 PolarHBondContact O-NE2 3.39Å; N4-Q8 PolarHBondContact OD1-NE2 3.02Å
5	T	75.7	Confident	73.7	Confident	75 Å²	75	124.1 Å²	124.1	46%	0.46	65%	0.648	S	S	.	*	H	α-helix	trans	-62.9	-47.3	176.8	-50.4	0	0	0	0	111.1	D1 M2 Q7 Q8 L9	D1-T5 PolarHBondContact O-OG1 3.16Å; M2-T5 PolarHBondContact O-N 3.28Å; T5-Q7 VanDerWaalsContact C-N 3.34Å; T5-Q7 PolarHBondContact O-N 3.18Å; T5-Q8 PolarHBondContact O-N 3.13Å; T5-L9 HydrophobicContact CG2-CD1 3.75Å; T5-L9 WeakPolarHBondContact O-CD1 3.28Å; T5-L9 PolarHBondContact O-N 3.29Å
6	Y	81.2	Confident	73.3	Confident	155 Å²	155	127.3 Å²	127.3	61%	0.608	65%	0.649	S	S	*	*	H	α-helix	trans	-60.8	-41.8	177	-85.5	-79.2	0	0	0	112.7	M2 Q8 L9 V10	M2-Y6 HydrophobicContact CE-CE2 4.29Å; M2-Y6 VanDerWaalsContact O-CD2 3.31Å; M2-Y6 WeakPolarHBondContact O-CD2 3.27Å; M2-Y6 PolarHBondContact O-N 3.46Å; M2-Y6 VanDerWaalsContact O-N 3.13Å; Y6-Q8 VanDerWaalsContact C-N 3.32Å; Y6-Q8 PolarHBondContact O-N 3.13Å; Y6-L9 PolarHBondContact O-N 3.2Å; Y6-V10 WeakPolarHBondContact O-CG2 3.35Å; Y6-V10 PolarHBondContact O-N 3.02Å
7	Q	79.8	Confident	72.6	Confident	122 Å²	122	127.9 Å²	127.9	57%	0.57	66%	0.664	S	S	*	*	H	α-helix	trans	-64.2	-37.3	177.1	-76.3	177.9	81.3	0	0	112.3	L3 N4 T5 R11	L3-Q7 VanDerWaalsContact O-CG 3.31Å; L3-Q7 WeakPolarHBondContact O-CG 3.31Å; L3-Q7 PolarHBondContact O-N 3.23Å; L3-Q7 PolarHBondContact O-NE2 2.78Å; L3-Q7 VanDerWaalsContact O-NE2 3.14Å; N4-Q7 PolarHBondContact O-N 3.33Å; T5-Q7 VanDerWaalsContact C-N 3.34Å; T5-Q7 PolarHBondContact O-N 3.18Å; Q7-R11 VanDerWaalsContact O-CB 3.27Å; Q7-R11 WeakPolarHBondContact O-CB 3.04Å; Q7-R11 PolarHBondContact O-N 3.4Å; Q7-R11 VanDerWaalsContact O-N 3.13Å
8	Q	77.4	Confident	72.1	Confident	108 Å²	108	123.6 Å²	123.6	51%	0.505	66%	0.655	S	S	.	*	H	α-helix	trans	-63.9	-47.1	173.9	-74	175	63.7	0	0	111	N4 T5 Y6 V10 R11 T12	N4-Q8 PolarHBondContact ND2-NE2 3.01Å; N4-Q8 VanDerWaalsContact ND2-NE2 3.16Å; N4-Q8 WeakPolarHBondContact O-CG 3.4Å; N4-Q8 PolarHBondContact O-N 2.93Å; N4-Q8 PolarHBondContact O-NE2 3.39Å; N4-Q8 PolarHBondContact OD1-NE2 3.02Å; T5-Q8 PolarHBondContact O-N 3.13Å; Y6-Q8 VanDerWaalsContact C-N 3.32Å; Y6-Q8 PolarHBondContact O-N 3.13Å; Q8-V10 PolarHBondContact O-N 3.45Å; Q8-R11 PolarHBondContact O-N 3.39Å; Q8-R11 VanDerWaalsContact O-N 3.13Å; Q8-T12 PolarHBondContact O-N 3.17Å; Q8-T12 PolarHBondContact O-OG1 3.5Å
9	L	76.8	Confident	71.5	Confident	121 Å²	121	123 Å²	123	63%	0.634	65%	0.649	S	S	*	*	H	α-helix	trans	-62.8	-37.2	178.7	-85.2	92.7	0	0	0	113.8	T5 Y6 R11	T5-L9 HydrophobicContact CG2-CD1 3.75Å; T5-L9 WeakPolarHBondContact O-CD1 3.28Å; T5-L9 PolarHBondContact O-N 3.29Å; Y6-L9 PolarHBondContact O-N 3.2Å; L9-R11 VanDerWaalsContact C-N 3.29Å
10	V	73.9	Confident	70.8	Confident	127 Å²	127	124.3 Å²	124.3	77%	0.77	66%	0.656	S	S	*	*	H	α-helix	trans	-69.1	-30.9	176.6	172	0	0	0	0	111.6	Y6 Q8	Y6-V10 WeakPolarHBondContact O-CG2 3.35Å; Y6-V10 PolarHBondContact O-N 3.02Å; Q8-V10 PolarHBondContact O-N 3.45Å
11	R	73.4	Confident	70.1	Confident	224 Å²	224	122.2 Å²	122.2	85%	0.845	65%	0.648	S	S	*	*	H	α-helix	trans	-89.2	-20.7	-176.2	-151	174.9	-163.4	175.5	3.9	113.1	Q7 Q8 L9 P13	Q7-R11 VanDerWaalsContact O-CB 3.27Å; Q7-R11 WeakPolarHBondContact O-CB 3.04Å; Q7-R11 PolarHBondContact O-N 3.4Å; Q7-R11 VanDerWaalsContact O-N 3.13Å; Q8-R11 PolarHBondContact O-N 3.39Å; Q8-R11 VanDerWaalsContact O-N 3.13Å; L9-R11 VanDerWaalsContact C-N 3.29Å; R11-P13 VanDerWaalsContact O-CD 3.28Å; R11-P13 WeakPolarHBondContact O-CD 3.31Å
12	T	70.7	Confident	70	Confident	93 Å²	93	124.4 Å²	124.4	57%	0.571	64%	0.643	S	S	*	*	S	Bend	trans	-68.1	116.3	172.7	-42.9	0	0	0	0	108.2	Q8 S14	Q8-T12 PolarHBondContact O-N 3.17Å; Q8-T12 PolarHBondContact O-OG1 3.5Å; T12-S14 PolarHBondContact O-N 3.13Å
13	P	67.5	Low	69.4	Low	100 Å²	100	125.6 Å²	125.6	65%	0.649	65%	0.651	S	S	*	*			trans	-55.9	129.9	171.2	23	-31.3	0	0	0	107.9	R11 V15	R11-P13 VanDerWaalsContact O-CD 3.28Å; R11-P13 WeakPolarHBondContact O-CD 3.31Å; P13-V15 PolarHBondContact O-N 3.38Å
14	S	71	Confident	68.6	Low	112 Å²	112	125.2 Å²	125.2	78%	0.783	65%	0.646	S	S	*	*			trans	-67.4	80.6	173.9	-174.7	0	0	0	0	108	T12 R16	T12-S14 PolarHBondContact O-N 3.13Å; S14-R16 PolarHBondContact O-N 2.91Å; S14-R16 VanDerWaalsContact O-N 3.07Å
15	V	66.3	Low	68	Low	94 Å²	94	123.8 Å²	123.8	57%	0.57	65%	0.646	S	S	*	*			trans	-64.3	110.1	171.4	179.2	0	0	0	0	105.3	P13 Q19	P13-V15 PolarHBondContact O-N 3.38Å; V15-Q19 HydrophobicContact CG1-CB 4.48Å
16	R	68.2	Low	67.2	Low	175 Å²	175	125.8 Å²	125.8	66%	0.66	66%	0.661	S	S	*	*			trans	-62.1	133.3	174.6	-64.7	176.9	-176.3	-179.7	0.7	107.2	S14 G18 Q19	S14-R16 PolarHBondContact O-N 2.91Å; S14-R16 VanDerWaalsContact O-N 3.07Å; R16-G18 PolarHBondContact O-N 3.36Å; R16-Q19 HydrophobicContact CB-CB 4.49Å; R16-Q19 HydrophobicContact CB-CG 4.22Å; R16-Q19 VanDerWaalsContact CG-OE1 3.26Å; R16-Q19 PolarHBondContact O-N 3.22Å
17	P	60.5	Low	66.2	Low	138 Å²	138	121 Å²	121	90%	0.896	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-52.1	111.8	165.4	-21.7	31.9	0	0	0	108.1
18	G	63.4	Low	65.4	Low	50 Å²	50	119.1 Å²	119.1	52%	0.515	66%	0.655	S	S	.	*	T	Hydrogen-bonded Turn	trans	105.3	3.6	-174.3	0	0	0	0	0	116.8	R16 D20 V21	R16-G18 PolarHBondContact O-N 3.36Å; G18-D20 VanDerWaalsContact C-N 3.31Å; G18-V21 WeakPolarHBondContact O-CB 2.98Å; G18-V21 WeakPolarHBondContact O-CG2 3.21Å; G18-V21 PolarHBondContact O-N 3.07Å
19	Q	61	Low	64.8	Low	113 Å²	113	122.2 Å²	122.2	53%	0.528	66%	0.662	S	S	.	*	T	Hydrogen-bonded Turn	trans	-78.4	-16.5	167.5	-101	161.5	-27	0	0	113.5	V15 R16 V21	V15-Q19 HydrophobicContact CG1-CB 4.48Å; R16-Q19 HydrophobicContact CB-CB 4.49Å; R16-Q19 HydrophobicContact CB-CG 4.22Å; R16-Q19 VanDerWaalsContact CG-OE1 3.26Å; R16-Q19 PolarHBondContact O-N 3.22Å; Q19-V21 PolarHBondContact O-N 2.72Å
20	D	57.3	Low	64.6	Low	149 Å²	149	119.9 Å²	119.9	80%	0.797	65%	0.653	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.1	15.5	164.6	-107.3	-33.3	0	0	0	113.4	G18 R22	G18-D20 VanDerWaalsContact C-N 3.31Å; D20-R22 PolarHBondContact O-N 3.45Å
21	V	57.2	Low	64.7	Low	80 Å²	80	115.7 Å²	115.7	49%	0.485	64%	0.635	S	S	.	*	T	Hydrogen-bonded Turn	trans	-74.1	32.1	168.8	176.9	0	0	0	0	110.6	G18 Q19 L23	G18-V21 WeakPolarHBondContact O-CB 2.98Å; G18-V21 WeakPolarHBondContact O-CG2 3.21Å; G18-V21 PolarHBondContact O-N 3.07Å; Q19-V21 PolarHBondContact O-N 2.72Å; V21-L23 PolarHBondContact O-N 2.83Å
22	R	60.2	Low	65.1	Low	224 Å²	224	110 Å²	110	85%	0.845	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.3	-14.5	172.6	-163.4	170	-178	179.1	0.6	112.3	D20	D20-R22 PolarHBondContact O-N 3.45Å
23	L	61.7	Low	65.7	Low	162 Å²	162	110.7 Å²	110.7	85%	0.848	62%	0.621	S	S	*	*			trans	-139.7	30.1	-170.7	-66.6	172.7	0	0	0	115.2	V21 A25	V21-L23 PolarHBondContact O-N 2.83Å; L23-A25 PolarHBondContact O-N 2.97Å
24	Q	62.1	Low	66.3	Low	122 Å²	122	112.7 Å²	112.7	57%	0.57	62%	0.619	S	S	*	*			trans	-83.1	109.2	158.5	-74.8	-164.8	36.3	0	0	108.3
25	A	62.4	Low	66.8	Low	56 Å²	56	112.2 Å²	112.2	46%	0.463	61%	0.607	S	S	.	*			trans	-49.9	132.3	174.9	0	0	0	0	0	109.3	L23 G27 T28	L23-A25 PolarHBondContact O-N 2.97Å; A25-G27 PolarHBondContact O-N 2.88Å; A25-T28 PolarHBondContact O-N 2.91Å
26	P	59.9	Low	67.5	Low	117 Å²	117	113.2 Å²	113.2	76%	0.76	61%	0.609	S	S	*	*	H	α-helix	trans	-51.7	-18.4	179.5	-28.5	34.4	0	0	0	114.5	T30	P26-T30 WeakPolarHBondContact O-CB 3.5Å; P26-T30 PolarHBondContact O-OG1 3.18Å
27	G	60.3	Low	68	Low	54 Å²	54	108 Å²	108	56%	0.557	60%	0.599	S	S	*	*	H	α-helix	trans	-75.5	-34.6	176.1	0	0	0	0	0	115.4	A25 G31	A25-G27 PolarHBondContact O-N 2.88Å; G27-G31 PolarHBondContact O-N 3.22Å
28	T	62.2	Low	68.9	Low	83 Å²	83	104.4 Å²	104.4	51%	0.509	58%	0.575	S	S	.	*	H	α-helix	trans	-74.7	-42.8	-169.8	-43.7	0	0	0	0	111.9	A25 L32	A25-T28 PolarHBondContact O-N 2.91Å; T28-L32 WeakPolarHBondContact O-CG 3.45Å; T28-L32 PolarHBondContact O-N 2.8Å
29	R	64.2	Low	69.7	Low	172 Å²	172	106 Å²	106	65%	0.649	58%	0.575	S	S	*	*	H	α-helix	trans	-71.6	-41.1	179	-169.8	175.4	177.8	176.6	-1	111.7	G31 L33	R29-G31 VanDerWaalsContact C-N 3.34Å; R29-L33 HydrophobicContact CG-CD1 4.35Å; R29-L33 VanDerWaalsContact O-CG 3.3Å; R29-L33 WeakPolarHBondContact O-CG 3.3Å; R29-L33 PolarHBondContact O-N 2.95Å
30	T	72.3	Confident	70.1	Confident	73 Å²	73	103.9 Å²	103.9	45%	0.448	57%	0.572	S	S	.	*	H	α-helix	trans	-64.8	-38.5	176.3	-53	0	0	0	0	111.8	P26 K34	P26-T30 WeakPolarHBondContact O-CB 3.5Å; P26-T30 PolarHBondContact O-OG1 3.18Å; T30-K34 HydrophobicContact CG2-CD 4.49Å; T30-K34 WeakPolarHBondContact O-CG 3.34Å; T30-K34 PolarHBondContact O-N 2.99Å; T30-K34 VanDerWaalsContact O-N 3.09Å
31	G	77.1	Confident	70.5	Confident	38 Å²	38	102.1 Å²	102.1	39%	0.392	56%	0.559	S	S	.	*	H	α-helix	trans	-63.8	-45.8	177.9	0	0	0	0	0	113.1	G27 R29 K34 L35	G27-G31 PolarHBondContact O-N 3.22Å; R29-G31 VanDerWaalsContact C-N 3.34Å; G31-K34 PolarHBondContact O-N 3.28Å; G31-L35 PolarHBondContact O-N 3.36Å
32	L	82	Confident	70.8	Confident	104 Å²	104	103 Å²	103	55%	0.545	56%	0.561	S	S	.	*	H	α-helix	trans	-64.8	-42.3	177.7	-72.1	173.5	0	0	0	112.5	T28 K34 L35 L36	T28-L32 WeakPolarHBondContact O-CG 3.45Å; T28-L32 PolarHBondContact O-N 2.8Å; L32-K34 VanDerWaalsContact C-N 3.32Å; L32-K34 PolarHBondContact O-N 2.97Å; L32-L35 PolarHBondContact O-N 3.06Å; L32-L36 WeakPolarHBondContact O-CG 3.48Å; L32-L36 PolarHBondContact O-N 3.09Å
33	L	81.9	Confident	70.9	Confident	108 Å²	108	98.2 Å²	98.2	57%	0.565	55%	0.546	S	S	*	.	H	α-helix	trans	-63.3	-38.8	177.2	-68.4	173	0	0	0	112	R29 S37	R29-L33 HydrophobicContact CG-CD1 4.35Å; R29-L33 VanDerWaalsContact O-CG 3.3Å; R29-L33 WeakPolarHBondContact O-CG 3.3Å; R29-L33 PolarHBondContact O-N 2.95Å; L33-S37 WeakPolarHBondContact O-CB 3.24Å; L33-S37 PolarHBondContact O-N 3.44Å
34	K	81.3	Confident	70.8	Confident	143 Å²	143	96.4 Å²	96.4	62%	0.622	53%	0.533	S	S	*	.	H	α-helix	trans	-63.9	-45.6	173.4	-77.4	-179.5	178.4	-175.2	0	112.1	T30 G31 L32 L36 S37 T38	T30-K34 HydrophobicContact CG2-CD 4.49Å; T30-K34 WeakPolarHBondContact O-CG 3.34Å; T30-K34 PolarHBondContact O-N 2.99Å; T30-K34 VanDerWaalsContact O-N 3.09Å; G31-K34 PolarHBondContact O-N 3.28Å; L32-K34 VanDerWaalsContact C-N 3.32Å; L32-K34 PolarHBondContact O-N 2.97Å; K34-L36 VanDerWaalsContact C-N 3.35Å; K34-L36 PolarHBondContact O-N 3.43Å; K34-S37 WeakPolarHBondContact O-CB 3.42Å; K34-S37 PolarHBondContact O-N 2.98Å; K34-T38 WeakPolarHBondContact O-CG2 3.43Å; K34-T38 PolarHBondContact O-N 3.18Å; K34-T38 PolarHBondContact O-OG1 3.45Å
35	L	80.8	Confident	70.7	Confident	101 Å²	101	94.9 Å²	94.9	53%	0.529	53%	0.532	S	S	.	.	H	α-helix	trans	-60.6	-42.9	178.4	-179.6	63.8	0	0	0	112.1	G31 L32 S37 T38 V39	G31-L35 PolarHBondContact O-N 3.36Å; L32-L35 PolarHBondContact O-N 3.06Å; L35-S37 VanDerWaalsContact C-N 3.31Å; L35-S37 PolarHBondContact O-N 3.02Å; L35-T38 PolarHBondContact O-N 3.36Å; L35-T38 PolarHBondContact O-OG1 3.06Å; L35-V39 HydrophobicContact CD1-CG2 4.46Å; L35-V39 VanDerWaalsContact O-CG2 3.24Å; L35-V39 WeakPolarHBondContact O-CG2 3.5Å; L35-V39 PolarHBondContact O-N 2.91Å
36	L	82.3	Confident	70.5	Confident	116 Å²	116	101.7 Å²	101.7	61%	0.607	55%	0.546	S	S	*	.	H	α-helix	trans	-66.1	-36.1	176.8	-67.3	173.6	0	0	0	111.8	L32 K34 S40	L32-L36 WeakPolarHBondContact O-CG 3.48Å; L32-L36 PolarHBondContact O-N 3.09Å; K34-L36 VanDerWaalsContact C-N 3.35Å; K34-L36 PolarHBondContact O-N 3.43Å; L36-S40 WeakPolarHBondContact O-CB 3.39Å; L36-S40 PolarHBondContact O-N 2.85Å
37	S	78.8	Confident	70.5	Confident	64 Å²	64	102.4 Å²	102.4	45%	0.448	54%	0.539	S	S	.	.	H	α-helix	trans	-64.3	-42	174.5	-171.8	0	0	0	0	112.3	L33 K34 L35 S40 Q41	L33-S37 WeakPolarHBondContact O-CB 3.24Å; L33-S37 PolarHBondContact O-N 3.44Å; K34-S37 WeakPolarHBondContact O-CB 3.42Å; K34-S37 PolarHBondContact O-N 2.98Å; L35-S37 VanDerWaalsContact C-N 3.31Å; L35-S37 PolarHBondContact O-N 3.02Å; S37-S40 PolarHBondContact O-N 3.16Å; S37-Q41 WeakPolarHBondContact O-CG 3.4Å; S37-Q41 PolarHBondContact O-N 3.34Å; S37-Q41 VanDerWaalsContact O-N 3.14Å
38	T	78.3	Confident	70.2	Confident	63 Å²	63	104 Å²	104	39%	0.387	55%	0.547	S	S	.	.	H	α-helix	trans	-69.2	-41.5	178.7	54.5	0	0	0	0	111.5	K34 L35 S40 Q41 D42	K34-T38 WeakPolarHBondContact O-CG2 3.43Å; K34-T38 PolarHBondContact O-N 3.18Å; K34-T38 PolarHBondContact O-OG1 3.45Å; L35-T38 PolarHBondContact O-N 3.36Å; L35-T38 PolarHBondContact O-OG1 3.06Å; T38-S40 VanDerWaalsContact C-N 3.27Å; T38-S40 PolarHBondContact O-N 3.48Å; T38-Q41 PolarHBondContact O-N 3.37Å; T38-Q41 VanDerWaalsContact O-N 3.16Å; T38-D42 PolarHBondContact O-N 3.43Å
39	V	79.5	Confident	69.6	Low	85 Å²	85	110.5 Å²	110.5	52%	0.515	57%	0.572	S	S	.	*	H	α-helix	trans	-61.2	-37.3	175.9	172.2	0	0	0	0	111.4	L35 K43	L35-V39 HydrophobicContact CD1-CG2 4.46Å; L35-V39 VanDerWaalsContact O-CG2 3.24Å; L35-V39 WeakPolarHBondContact O-CG2 3.5Å; L35-V39 PolarHBondContact O-N 2.91Å; V39-K43 WeakPolarHBondContact O-CB 3.43Å; V39-K43 PolarHBondContact O-N 3.38Å
40	S	69.9	Low	69.9	Low	67 Å²	67	107.5 Å²	107.5	47%	0.469	57%	0.568	S	S	.	*	H	α-helix	trans	-68.5	-35.8	176.3	-176.1	0	0	0	0	113.1	L36 S37 T38 Q44	L36-S40 WeakPolarHBondContact O-CB 3.39Å; L36-S40 PolarHBondContact O-N 2.85Å; S37-S40 PolarHBondContact O-N 3.16Å; T38-S40 VanDerWaalsContact C-N 3.27Å; T38-S40 PolarHBondContact O-N 3.48Å; S40-Q44 PolarHBondContact O-N 3.14Å
41	Q	65.9	Low	69.8	Low	112 Å²	112	109.3 Å²	109.3	52%	0.523	57%	0.574	S	S	.	*	H	α-helix	trans	-73.4	-44.6	177.1	-73.3	174.9	-27.7	0	0	111.9	S37 T38 K43 Q44 V45	S37-Q41 WeakPolarHBondContact O-CG 3.4Å; S37-Q41 PolarHBondContact O-N 3.34Å; S37-Q41 VanDerWaalsContact O-N 3.14Å; T38-Q41 PolarHBondContact O-N 3.37Å; T38-Q41 VanDerWaalsContact O-N 3.16Å; Q41-K43 PolarHBondContact O-N 3.43Å; Q41-Q44 PolarHBondContact O-N 3.21Å; Q41-V45 WeakPolarHBondContact O-CG2 3.42Å; Q41-V45 PolarHBondContact O-N 3.28Å
42	D	62.9	Low	69.4	Low	98 Å²	98	113.2 Å²	113.2	52%	0.524	58%	0.584	S	S	.	*	H	α-helix	trans	-62.2	-32.5	179	-74.3	-10	0	0	0	112.4	T38 R46	T38-D42 PolarHBondContact O-N 3.43Å; D42-R46 WeakPolarHBondContact O-CG 3.49Å; D42-R46 PolarHBondContact O-N 3.01Å
43	K	63.4	Low	68.6	Low	124 Å²	124	113.8 Å²	113.8	54%	0.539	59%	0.587	S	S	.	*	H	α-helix	trans	-67.5	-43.3	172.8	-176.9	179.8	173.3	-62.6	0	111.9	V39 Q41 R46 E47	V39-K43 WeakPolarHBondContact O-CB 3.43Å; V39-K43 PolarHBondContact O-N 3.38Å; Q41-K43 PolarHBondContact O-N 3.43Å; K43-R46 PolarHBondContact O-N 3.42Å; K43-E47 WeakPolarHBondContact CE-OE1 3.47Å; K43-E47 IonicContact NZ-OE1 2.66Å; K43-E47 PolarHBondContact NZ-OE1 2.66Å; K43-E47 IonicContact NZ-OE2 3.69Å; K43-E47 PolarHBondContact O-N 3.46Å
44	Q	59.4	Low	67.8	Low	125 Å²	125	114.1 Å²	114.1	58%	0.584	59%	0.588	S	S	*	*	H	α-helix	trans	-68.1	-36.6	179.2	-78.3	-174.7	87	0	0	112.9	S40 Q41 R46 E47 A48	S40-Q44 PolarHBondContact O-N 3.14Å; Q41-Q44 PolarHBondContact O-N 3.21Å; Q44-R46 VanDerWaalsContact C-N 3.3Å; Q44-R46 PolarHBondContact O-N 3.27Å; Q44-E47 PolarHBondContact O-N 3.43Å; Q44-A48 PolarHBondContact O-N 3.07Å
45	V	60	Low	66.9	Low	89 Å²	89	112.2 Å²	112.2	54%	0.539	59%	0.586	S	S	.	*	H	α-helix	trans	-66.6	-33.1	179	175.4	0	0	0	0	111.8	Q41 A48	Q41-V45 WeakPolarHBondContact O-CG2 3.42Å; Q41-V45 PolarHBondContact O-N 3.28Å; V45-A48 PolarHBondContact O-N 3.49Å
46	R	59	Low	65.9	Low	200 Å²	200	113 Å²	113	76%	0.755	59%	0.59	S	S	*	*	H	α-helix	trans	-76.5	-18.8	176.8	-70.1	-178.7	-165.7	-125.1	4	114.2	D42 K43 Q44	D42-R46 WeakPolarHBondContact O-CG 3.49Å; D42-R46 PolarHBondContact O-N 3.01Å; K43-R46 PolarHBondContact O-N 3.42Å; Q44-R46 VanDerWaalsContact C-N 3.3Å; Q44-R46 PolarHBondContact O-N 3.27Å
47	E	58.4	Low	64.7	Low	131 Å²	131	112.8 Å²	112.8	61%	0.612	59%	0.588	S	S	*	*	H	α-helix	trans	-89	-10.3	175.8	-70.6	174.3	-170.6	0	0	112.5	K43 Q44	K43-E47 WeakPolarHBondContact CE-OE1 3.47Å; K43-E47 IonicContact NZ-OE1 2.66Å; K43-E47 PolarHBondContact NZ-OE1 2.66Å; K43-E47 IonicContact NZ-OE2 3.69Å; K43-E47 PolarHBondContact O-N 3.46Å; Q44-E47 PolarHBondContact O-N 3.43Å
48	A	55.3	Low	63.5	Low	88 Å²	88	116.8 Å²	116.8	73%	0.727	60%	0.6	S	S	*	*			trans	-103.7	10.5	179.4	0	0	0	0	0	114	Q44 V45	Q44-A48 PolarHBondContact O-N 3.07Å; V45-A48 PolarHBondContact O-N 3.49Å
49	Q	49.7	Very low	62.1	Low	220 Å²	220	121.7 Å²	121.7	100%	1.028	62%	0.62	S	S	*	*			trans	-112.2	0	171.4	-72.3	-175.6	-10.1	0	0	109.9

Retrieved 49 of 49 residues in 76.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).