A0A087X0V6_HUMAN Loading...

NOP2/Sun RNA methyltransferase 4

AlphaFold DB , UniProt , Accession A0A087X0V6, Species HUMAN (Homo sapiens, Human), Gene NSUN4, Length 54 aa.

						>A0A087X0V6_HUMAN|A0A087X0V6|NSUN4
MAALTLRGVRELLKRVDLATVPRRHRYKKKWPVLSLLGCHRAQIPCCSTGFAEF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.4	Low	65.4	Low	213 Å²	213	114.5 Å²	114.5	100%	1.049	61%	0.609	S	S	*	*				0	-49.2	0	-67.6	178.4	-153.6	0	0	112.6	A3 L4 T5	M1-A3 PolarHBondContact O-N 2.99Å; M1-A3 VanDerWaalsContact C-N 3.34Å; M1-L4 PolarHBondContact O-N 3.19Å; M1-T5 PolarHBondContact O-OG1 3.49Å
2	A	59	Low	65.9	Low	70 Å²	70	114.2 Å²	114.2	58%	0.579	61%	0.606	S	S	*	*	H	α-helix	trans	-61.6	-31.9	-179	0	0	0	0	0	115.6	L4 T5 L6	A2-L4 PolarHBondContact O-N 3.22Å; A2-L4 VanDerWaalsContact C-N 3.32Å; A2-T5 PolarHBondContact O-N 3.37Å; A2-L6 WeakPolarHBondContact O-CG 3.1Å; A2-L6 PolarHBondContact O-N 2.73Å; A2-L6 VanDerWaalsContact O-N 3.07Å
3	A	59.2	Low	66.2	Low	68 Å²	68	114.8 Å²	114.8	56%	0.562	61%	0.609	S	S	*	*	H	α-helix	trans	-67.1	-29	-178.2	0	0	0	0	0	114.2	M1 R7	M1-A3 PolarHBondContact O-N 2.99Å; M1-A3 VanDerWaalsContact C-N 3.34Å; A3-R7 WeakPolarHBondContact O-CG 3.48Å; A3-R7 PolarHBondContact O-N 3.41Å
4	L	61.5	Low	66.4	Low	131 Å²	131	113.2 Å²	113.2	69%	0.686	59%	0.594	S	S	*	*	H	α-helix	trans	-76	-39.9	177.4	-65.3	173.9	0	0	0	110.8	M1 A2 L6 R7 G8	M1-L4 PolarHBondContact O-N 3.19Å; A2-L4 PolarHBondContact O-N 3.22Å; A2-L4 VanDerWaalsContact C-N 3.32Å; L4-L6 PolarHBondContact O-N 3.48Å; L4-R7 PolarHBondContact O-N 3.25Å; L4-G8 PolarHBondContact O-N 3.06Å
5	T	65.2	Low	66.4	Low	90 Å²	90	117.1 Å²	117.1	55%	0.552	60%	0.597	S	S	*	*	H	α-helix	trans	-61.5	-43.6	174.7	-44.5	0	0	0	0	111.2	M1 A2 R7 G8 V9	M1-T5 PolarHBondContact O-OG1 3.49Å; A2-T5 PolarHBondContact O-N 3.37Å; T5-R7 VanDerWaalsContact C-N 3.35Å; T5-R7 PolarHBondContact O-N 3.17Å; T5-G8 PolarHBondContact O-N 2.7Å; T5-V9 HydrophobicContact CG2-CG2 4.38Å; T5-V9 WeakPolarHBondContact O-CB 3.12Å; T5-V9 WeakPolarHBondContact O-CG2 3.08Å; T5-V9 PolarHBondContact O-N 2.67Å
6	L	64.6	Low	66.2	Low	122 Å²	122	115.1 Å²	115.1	64%	0.639	59%	0.593	S	S	*	*	H	α-helix	trans	-65.1	-35.9	177.1	-68.3	174.6	0	0	0	112.7	A2 L4 R10	A2-L6 WeakPolarHBondContact O-CG 3.1Å; A2-L6 PolarHBondContact O-N 2.73Å; A2-L6 VanDerWaalsContact O-N 3.07Å; L4-L6 PolarHBondContact O-N 3.48Å; L6-R10 WeakPolarHBondContact O-CB 3.14Å; L6-R10 PolarHBondContact O-N 3.48Å
7	R	68.6	Low	65.9	Low	189 Å²	189	113.6 Å²	113.6	71%	0.713	59%	0.586	S	S	*	*	H	α-helix	trans	-66.2	-44.9	173.5	-78.7	179.4	168.2	-160.3	-2.6	111.7	A3 L4 T5 R10 E11	A3-R7 WeakPolarHBondContact O-CG 3.48Å; A3-R7 PolarHBondContact O-N 3.41Å; L4-R7 PolarHBondContact O-N 3.25Å; T5-R7 VanDerWaalsContact C-N 3.35Å; T5-R7 PolarHBondContact O-N 3.17Å; R7-R10 PolarHBondContact O-N 2.93Å; R7-E11 PolarHBondContact O-N 3.4Å; R7-E11 WeakPolarHBondContact O-CG 3.17Å
8	G	72.6	Confident	65.4	Low	36 Å²	36	114.3 Å²	114.3	37%	0.371	59%	0.59	S	S	.	*	H	α-helix	trans	-62.6	-46.1	176.6	0	0	0	0	0	112.4	L4 T5 R10 E11 L12	L4-G8 PolarHBondContact O-N 3.06Å; T5-G8 PolarHBondContact O-N 2.7Å; G8-R10 VanDerWaalsContact C-N 3.35Å; G8-R10 PolarHBondContact O-N 3.39Å; G8-E11 PolarHBondContact O-N 2.76Å; G8-L12 WeakPolarHBondContact O-CB 3.06Å; G8-L12 WeakPolarHBondContact O-CG 2.99Å; G8-L12 PolarHBondContact O-N 2.88Å
9	V	72.3	Confident	65	Low	78 Å²	78	111.8 Å²	111.8	47%	0.473	59%	0.588	S	S	.	*	H	α-helix	trans	-63.7	-39.5	176.8	173.3	0	0	0	0	111.1	T5 L12 L13	T5-V9 HydrophobicContact CG2-CG2 4.38Å; T5-V9 WeakPolarHBondContact O-CB 3.12Å; T5-V9 WeakPolarHBondContact O-CG2 3.08Å; T5-V9 PolarHBondContact O-N 2.67Å; V9-L12 PolarHBondContact O-N 2.86Å; V9-L13 PolarHBondContact O-N 2.79Å; V9-L13 WeakPolarHBondContact O-CB 3.25Å; V9-L13 VanDerWaalsContact O-CB 3.29Å
10	R	71.3	Confident	64.5	Low	173 Å²	173	110.4 Å²	110.4	65%	0.653	58%	0.584	S	S	*	*	H	α-helix	trans	-66.9	-38.3	177.7	-168.5	176.7	-171.5	-155.9	3.1	112.5	L6 R7 G8 L13 K14	L6-R10 WeakPolarHBondContact O-CB 3.14Å; L6-R10 PolarHBondContact O-N 3.48Å; R7-R10 PolarHBondContact O-N 2.93Å; G8-R10 VanDerWaalsContact C-N 3.35Å; G8-R10 PolarHBondContact O-N 3.39Å; R10-L13 PolarHBondContact O-N 3.49Å; R10-K14 WeakPolarHBondContact O-CG 3.29Å; R10-K14 PolarHBondContact O-N 3.02Å
11	E	73.2	Confident	63.9	Low	90 Å²	90	108.4 Å²	108.4	42%	0.421	58%	0.576	S	S	.	*	H	α-helix	trans	-69.6	-40.1	174.8	-73.3	-58.9	119.9	0	0	112	R7 G8 K14 R15	R7-E11 PolarHBondContact O-N 3.4Å; R7-E11 WeakPolarHBondContact O-CG 3.17Å; G8-E11 PolarHBondContact O-N 2.76Å; E11-K14 PolarHBondContact O-N 3.33Å; E11-K14 IonicContact OE1-NZ 2.77Å; E11-K14 PolarHBondContact OE1-NZ 2.93Å; E11-R15 WeakPolarHBondContact O-CG 3.19Å; E11-R15 PolarHBondContact O-N 3.46Å
12	L	72.3	Confident	64	Low	110 Å²	110	102.2 Å²	102.2	58%	0.576	55%	0.552	S	S	*	*	H	α-helix	trans	-61.2	-44.6	171.6	-78.2	161.9	0	0	0	111.5	G8 V9 K14 R15 V16	G8-L12 WeakPolarHBondContact O-CB 3.06Å; G8-L12 WeakPolarHBondContact O-CG 2.99Å; G8-L12 PolarHBondContact O-N 2.88Å; V9-L12 PolarHBondContact O-N 2.86Å; L12-K14 PolarHBondContact O-N 3.36Å; L12-R15 PolarHBondContact O-N 3.21Å; L12-V16 PolarHBondContact O-N 2.98Å; L12-V16 WeakPolarHBondContact O-CG2 3.36Å
13	L	68.9	Low	63.6	Low	122 Å²	122	109.8 Å²	109.8	64%	0.639	57%	0.565	S	S	*	*	H	α-helix	trans	-64.8	-40.5	178.8	-153.8	92.9	0	0	0	111.3	V9 R10 V16 D17	V9-L13 PolarHBondContact O-N 2.79Å; V9-L13 WeakPolarHBondContact O-CB 3.25Å; V9-L13 VanDerWaalsContact O-CB 3.29Å; R10-L13 PolarHBondContact O-N 3.49Å; L13-V16 PolarHBondContact O-N 2.82Å; L13-D17 WeakPolarHBondContact O-CB 3.38Å; L13-D17 PolarHBondContact O-N 2.89Å
14	K	69	Low	63.3	Low	93 Å²	93	117.6 Å²	117.6	40%	0.404	58%	0.58	S	S	.	*	H	α-helix	trans	-62.5	-40.7	173	-76.9	176	-171.8	169.2	0	112	R10 E11 L12 D17 L18	R10-K14 WeakPolarHBondContact O-CG 3.29Å; R10-K14 PolarHBondContact O-N 3.02Å; E11-K14 PolarHBondContact O-N 3.33Å; E11-K14 IonicContact OE1-NZ 2.77Å; E11-K14 PolarHBondContact OE1-NZ 2.93Å; L12-K14 PolarHBondContact O-N 3.36Å; K14-D17 PolarHBondContact O-N 2.81Å; K14-L18 VanDerWaalsContact O-CB 3.29Å; K14-L18 WeakPolarHBondContact O-CB 3.08Å; K14-L18 WeakPolarHBondContact O-CD1 3.21Å; K14-L18 PolarHBondContact O-N 3.22Å
15	R	66.5	Low	62.8	Low	171 Å²	171	119.2 Å²	119.2	65%	0.645	58%	0.584	S	S	*	*	H	α-helix	trans	-66.5	-41.7	176.8	-72	178.2	-177	-156.6	0.6	111.7	E11 L12 A19	E11-R15 WeakPolarHBondContact O-CG 3.19Å; E11-R15 PolarHBondContact O-N 3.46Å; L12-R15 PolarHBondContact O-N 3.21Å; R15-A19 WeakPolarHBondContact O-CB 3.33Å; R15-A19 PolarHBondContact O-N 3.07Å
16	V	63.5	Low	62.3	Low	86 Å²	86	126 Å²	126	52%	0.521	60%	0.599	S	S	.	*	H	α-helix	trans	-68	-40.4	175.9	172.7	0	0	0	0	110.9	L12 L13 A19 T20	L12-V16 PolarHBondContact O-N 2.98Å; L12-V16 WeakPolarHBondContact O-CG2 3.36Å; L13-V16 PolarHBondContact O-N 2.82Å; V16-A19 CarbonylContact O-C 3.49Å; V16-A19 PolarHBondContact O-N 3.4Å; V16-T20 WeakPolarHBondContact O-CB 3.41Å; V16-T20 PolarHBondContact O-N 3.49Å; V16-T20 PolarHBondContact O-OG1 3.3Å
17	D	60.6	Low	61.6	Low	90 Å²	90	131.1 Å²	131.1	48%	0.481	61%	0.612	S	S	.	*	H	α-helix	trans	-63	-50.9	173.7	-173.6	-103.8	0	0	0	110.1	L13 K14 A19 T20 V21	L13-D17 WeakPolarHBondContact O-CB 3.38Å; L13-D17 PolarHBondContact O-N 2.89Å; K14-D17 PolarHBondContact O-N 2.81Å; D17-A19 PolarHBondContact O-N 2.77Å; D17-A19 VanDerWaalsContact O-N 3.17Å; D17-T20 CarbonylContact O-C 3.59Å; D17-T20 PolarHBondContact O-N 3.49Å; D17-V21 PolarHBondContact O-N 2.92Å; D17-V21 WeakPolarHBondContact O-CG2 3.4Å; D17-V21 WeakPolarHBondContact O-CA 3.46Å; D17-V21 WeakPolarHBondContact O-CB 3.29Å
18	L	57.1	Low	60.6	Low	126 Å²	126	131.8 Å²	131.8	66%	0.66	62%	0.62	S	S	*	*	H	α-helix	trans	-63.5	-20.4	174	-93	74.3	0	0	0	114.3	K14 P22	K14-L18 VanDerWaalsContact O-CB 3.29Å; K14-L18 WeakPolarHBondContact O-CB 3.08Å; K14-L18 WeakPolarHBondContact O-CD1 3.21Å; K14-L18 PolarHBondContact O-N 3.22Å; L18-P22 WeakPolarHBondContact O-CD 3.22Å; L18-P22 WeakPolarHBondContact O-CG 3.26Å
19	A	57.9	Low	59.4	Low	66 Å²	66	138 Å²	138	55%	0.545	64%	0.637	S	S	.	*	H	α-helix	trans	-92.4	-20.1	173.6	0	0	0	0	0	113.3	R15 V16 D17 P22	R15-A19 WeakPolarHBondContact O-CB 3.33Å; R15-A19 PolarHBondContact O-N 3.07Å; V16-A19 CarbonylContact O-C 3.49Å; V16-A19 PolarHBondContact O-N 3.4Å; D17-A19 PolarHBondContact O-N 2.77Å; D17-A19 VanDerWaalsContact O-N 3.17Å; A19-P22 WeakPolarHBondContact O-CD 3.47Å; A19-P22 VanDerWaalsContact O-CG 3.25Å; A19-P22 WeakPolarHBondContact O-CG 3.38Å
20	T	55.2	Low	58.4	Low	83 Å²	83	144.3 Å²	144.3	51%	0.509	66%	0.658	S	S	.	*	H	α-helix	trans	-92.1	-37.4	176.2	-59.1	0	0	0	0	111.5	V16 D17 P22 R23	V16-T20 WeakPolarHBondContact O-CB 3.41Å; V16-T20 PolarHBondContact O-N 3.49Å; V16-T20 PolarHBondContact O-OG1 3.3Å; D17-T20 CarbonylContact O-C 3.59Å; D17-T20 PolarHBondContact O-N 3.49Å; T20-P22 VanDerWaalsContact N-CD 3.32Å; T20-R23 PolarHBondContact O-N 3.24Å
21	V	52.1	Low	56.8	Low	70 Å²	70	145.7 Å²	145.7	42%	0.424	66%	0.663	S	S	.	*	H	α-helix	trans	-68.2	-28	173.4	174.8	0	0	0	0	115.2	D17 R23 R24 H25	D17-V21 PolarHBondContact O-N 2.92Å; D17-V21 WeakPolarHBondContact O-CG2 3.4Å; D17-V21 WeakPolarHBondContact O-CA 3.46Å; D17-V21 WeakPolarHBondContact O-CB 3.29Å; V21-R23 PolarHBondContact O-N 2.86Å; V21-R24 PolarHBondContact O-N 3.38Å; V21-H25 PolarHBondContact O-N 3.44Å
22	P	52.4	Low	55.7	Low	82 Å²	82	146.2 Å²	146.2	53%	0.532	67%	0.674	S	S	.	*	H	α-helix	trans	-74.5	-12.4	177.3	34.9	-25.7	0	0	0	110.6	L18 A19 T20	L18-P22 WeakPolarHBondContact O-CD 3.22Å; L18-P22 WeakPolarHBondContact O-CG 3.26Å; A19-P22 WeakPolarHBondContact O-CD 3.47Å; A19-P22 VanDerWaalsContact O-CG 3.25Å; A19-P22 WeakPolarHBondContact O-CG 3.38Å; T20-P22 VanDerWaalsContact N-CD 3.32Å
23	R	52.4	Low	54.5	Low	229 Å²	229	147.7 Å²	147.7	86%	0.864	69%	0.688	S	S	*	*	H	α-helix	trans	-90.7	-26.1	-179.2	-146.4	-179.3	-167.8	175	4.3	113.3	T20 V21	T20-R23 PolarHBondContact O-N 3.24Å; V21-R23 PolarHBondContact O-N 2.86Å
24	R	51.6	Low	53.3	Low	232 Å²	232	148.7 Å²	148.7	88%	0.875	69%	0.693	S	S	*	*	H	α-helix	trans	-100.9	-10.2	179.2	-75.8	-173.8	174.9	179.2	-0.6	114.4	V21	V21-R24 PolarHBondContact O-N 3.38Å
25	H	51.9	Low	52	Low	166 Å²	166	149.6 Å²	149.6	77%	0.769	71%	0.711	S	S	*	*	S	Bend	trans	-118.2	49.3	-178.6	-151.7	87.5	0	0	0	114.1	V21	V21-H25 PolarHBondContact O-N 3.44Å
26	R	53.5	Low	51	Low	231 Å²	231	149.8 Å²	149.8	87%	0.872	72%	0.724	S	S	*	*	S	Bend	trans	-143.5	35.1	163.5	-140.5	178.8	-172.2	-178.3	2	115.1
27	Y	50.1	Low	49.8	Very low	231 Å²	231	153 Å²	153	91%	0.906	74%	0.737	S	S	*	*	S	Bend	trans	-125.6	48.4	168	-130.3	-85.1	0	0	0	112.7
28	K	48.6	Very low	48.8	Very low	203 Å²	203	151 Å²	151	88%	0.883	74%	0.738	S	S	*	*			trans	-162.7	58.5	158.7	-137.8	-172.9	-173.6	-162.7	0	114
29	K	46.1	Very low	48.2	Very low	165 Å²	165	150.7 Å²	150.7	72%	0.717	75%	0.745	S	S	*	*			trans	-136.3	107.5	148.7	-83.4	-162.5	177.4	-176.2	0	108.5	W31	K29-W31 HydrophobicContact CD-CZ2 4.34Å; K29-W31 PolarHBondContact O-N 3.36Å
30	K	51.5	Low	47.3	Very low	212 Å²	212	155.4 Å²	155.4	92%	0.922	76%	0.756	S	S	*	*			trans	-45	106.6	151.9	-98.9	174.9	167.8	-174.2	0	106.9
31	W	38.3	Very low	46.6	Very low	201 Å²	201	162.8 Å²	162.8	76%	0.761	77%	0.774	S	S	*	*			trans	-114.3	109.8	157.5	-75.7	93.6	0	0	0	106.2	K29	K29-W31 HydrophobicContact CD-CZ2 4.34Å; K29-W31 PolarHBondContact O-N 3.36Å
32	P	49.2	Very low	46	Very low	101 Å²	101	162.7 Å²	162.7	66%	0.656	78%	0.781	S	S	*	*			trans	-70.4	133.2	175	30.6	-29.9	0	0	0	108.2	L34	P32-L34 PolarHBondContact O-N 3.26Å
33	V	47.8	Very low	45.5	Very low	141 Å²	141	167.6 Å²	167.6	86%	0.855	80%	0.797	S	S	*	*	S	Bend	trans	44.9	60.8	145.5	-148.1	0	0	0	0	116.2
34	L	44.2	Very low	45.1	Very low	144 Å²	144	163.5 Å²	163.5	75%	0.754	79%	0.79	S	S	*	*			trans	-149.8	45.7	161.6	-148.1	79	0	0	0	112.4	P32	P32-L34 PolarHBondContact O-N 3.26Å
35	S	41.8	Very low	44.5	Very low	111 Å²	111	155.9 Å²	155.9	78%	0.776	77%	0.771	S	S	*	*	S	Bend	trans	-104.9	11.7	175	-65.6	0	0	0	0	114.1
36	L	44.3	Very low	44.2	Very low	176 Å²	176	154.9 Å²	154.9	92%	0.921	78%	0.781	S	S	*	*	S	Bend	trans	-115.4	-6.9	178.6	-94.4	144.2	0	0	0	115
37	L	39.8	Very low	43.4	Very low	152 Å²	152	149.2 Å²	149.2	80%	0.796	78%	0.776	S	S	*	*	S	Bend	trans	-118.9	2.7	179.4	-158	60.9	0	0	0	114.1
38	G	39.2	Very low	43.1	Very low	49 Å²	49	142.3 Å²	142.3	51%	0.505	76%	0.761	S	S	.	*	S	Bend	trans	-103.4	-8.6	-179	0	0	0	0	0	115.4	H40	G38-H40 VanDerWaalsContact C-N 3.32Å; G38-H40 PolarHBondContact O-N 2.97Å
39	C	44.2	Very low	42.9	Very low	120 Å²	120	139 Å²	139	81%	0.811	76%	0.758	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84	-3.3	-177.5	-69.9	0	0	0	0	114
40	H	39.7	Very low	42.5	Very low	165 Å²	165	134 Å²	134	76%	0.764	75%	0.754	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110.4	-1.2	-178.3	-152.6	-81.3	0	0	0	113.9	G38	G38-H40 VanDerWaalsContact C-N 3.32Å; G38-H40 PolarHBondContact O-N 2.97Å
41	R	39.4	Very low	41.8	Very low	237 Å²	237	132.8 Å²	132.8	89%	0.894	75%	0.749	S	S	*	*	S	Bend	trans	-131.6	26	-176.7	-149.2	175.7	-176.3	-174.9	0.6	113.7
42	A	40.3	Very low	41.8	Very low	69 Å²	69	126.9 Å²	126.9	57%	0.57	74%	0.743	S	S	*	*			trans	-134	56.7	160.2	0	0	0	0	0	107.9	I44	A42-I44 PolarHBondContact O-N 3.5Å
43	Q	41.2	Very low	41.5	Very low	185 Å²	185	131 Å²	131	86%	0.864	75%	0.753	S	S	*	*			trans	-68.2	65.7	155	-157.4	173.9	93.9	0	0	106.5
44	I	43.7	Very low	41	Very low	142 Å²	142	137.6 Å²	137.6	73%	0.728	77%	0.771	S	S	*	*			trans	-126.8	120.9	171.1	-62.6	176.1	0	0	0	104.5	A42	A42-I44 PolarHBondContact O-N 3.5Å
45	P	39.7	Very low	40.8	Very low	73 Å²	73	137.3 Å²	137.3	47%	0.474	77%	0.772	S	S	.	*			trans	-82	145.6	-135.2	32.2	-36.5	0	0	0	111.6	C47 S48	P45-C47 HydrophobicContact CB-CB 3.97Å; P45-C47 PolarHBondContact O-N 3.39Å; P45-S48 VanDerWaalsContact CG-OG 3.26Å; P45-S48 WeakPolarHBondContact CG-OG 3.46Å
46	C	45.3	Very low	40.8	Very low	145 Å²	145	138.7 Å²	138.7	98%	0.98	77%	0.772	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.8	20.7	153.8	-59.9	0	0	0	0	113
47	C	37.6	Very low	40.6	Very low	111 Å²	111	136.6 Å²	136.6	75%	0.75	76%	0.763	S	S	*	*	T	Hydrogen-bonded Turn	trans	-140.2	16.2	-169.7	-56.2	0	0	0	0	115	P45	P45-C47 HydrophobicContact CB-CB 3.97Å; P45-C47 PolarHBondContact O-N 3.39Å
48	S	42.3	Very low	40.6	Very low	87 Å²	87	135.7 Å²	135.7	61%	0.608	76%	0.761	S	S	*	*			trans	-138.6	77.8	178.2	-57	0	0	0	0	113.7	P45	P45-S48 VanDerWaalsContact CG-OG 3.26Å; P45-S48 WeakPolarHBondContact CG-OG 3.46Å
49	T	45.7	Very low	40.7	Very low	132 Å²	132	141.1 Å²	141.1	81%	0.81	78%	0.777	S	S	*	*				-156.9	94.5	127.6	-60.2	0	0	0	0	106	F51	T49-F51 PolarHBondContact O-N 3.29Å
50	G	38	Very low	40.5	Very low	61 Å²	61	142.5 Å²	142.5	63%	0.629	78%	0.775	S	S	*	*			trans	-56.1	119.1	163	0	0	0	0	0	109.8
51	F	36.7	Very low	40.6	Very low	187 Å²	187	140.9 Å²	140.9	82%	0.82	78%	0.776	S	S	*	*				-94.8	85.8	125.1	-100.9	-98.9	0	0	0	102.8	T49	T49-F51 PolarHBondContact O-N 3.29Å
52	A	38.7	Very low	40.6	Very low	76 Å²	76	133.5 Å²	133.5	63%	0.628	77%	0.767	S	S	*	*				45.4	84.8	52.8	0	0	0	0	0	110.5
53	E	42	Very low	40.7	Very low	187 Å²	187	138.9 Å²	138.9	87%	0.874	78%	0.783	S	S	*	*			trans	33.2	94.9	154.7	-53.7	-151.6	101.2	0	0	116.9
54	F	37.1	Very low	40.6	Very low	281 Å²	281	134.7 Å²	134.7	100%	1.232	78%	0.776	S	S	*	*			trans	-162.7	0	140.8	-106.7	-73.3	0	0	0	110.5

Retrieved 54 of 54 residues in 37.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).