A0A087X0Z2_HUMAN Loading...

X-prolyl aminopeptidase 3

AlphaFold DB , UniProt , Accession A0A087X0Z2, Species HUMAN (Homo sapiens, Human), Gene XPNPEP3, Length 55 aa.

						>A0A087X0Z2_HUMAN|A0A087X0Z2|XPNPEP3
MPWLLSAPKLVPAVANVRGLSGSYFVTQAGVQWRDPITLQPMSSRLKQSFYQLPE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.8	Low	55.9	Low	212 Å²	212	150 Å²	150	100%	1.044	81%	0.814	S	S	*	*				0	135.1	0	-67.4	-177.6	104.7	0	0	108.9
2	P	52	Low	55.4	Low	129 Å²	129	146.8 Å²	146.8	84%	0.838	81%	0.806	S	S	*	*			trans	-131.4	77.5	152.9	34.7	-17.1	0	0	0	109.7	L4	P2-L4 VanDerWaalsContact C-N 3.35Å
3	W	52.1	Low	55.7	Low	218 Å²	218	142.5 Å²	142.5	83%	0.826	80%	0.802	S	S	*	*			trans	-96.7	25.8	172.1	-79	101.9	0	0	0	112.3
4	L	58.2	Low	55.2	Low	154 Å²	154	141.9 Å²	141.9	81%	0.806	80%	0.802	S	S	*	*			trans	-131.6	132.7	-177.5	-71	169.6	0	0	0	108	P2	P2-L4 VanDerWaalsContact C-N 3.35Å
5	L	57.5	Low	55.1	Low	174 Å²	174	137.9 Å²	137.9	91%	0.911	80%	0.795	S	S	*	*	S	Bend	trans	105.1	62.6	172.5	-50.3	171.7	0	0	0	115
6	S	58.6	Low	54.7	Low	119 Å²	119	136.1 Å²	136.1	83%	0.832	78%	0.781	S	S	*	*				-164.1	72.8	117	-146	0	0	0	0	110.1
7	A	58.6	Low	54.6	Low	89 Å²	89	135.4 Å²	135.4	74%	0.736	78%	0.78	S	S	*	*			trans	-73.6	127.6	158.9	0	0	0	0	0	106.5	K9	A7-K9 PolarHBondContact O-N 3.39Å; A7-K9 VanDerWaalsContact O-N 3.08Å
8	P	57.1	Low	54.4	Low	107 Å²	107	139.4 Å²	139.4	70%	0.695	78%	0.78	S	S	*	*			trans	-56.1	123.8	169.9	21.8	-28.8	0	0	0	107.1	L10	P8-L10 VanDerWaalsContact C-N 3.31Å; P8-L10 PolarHBondContact O-N 3.41Å
9	K	59.2	Low	54.1	Low	188 Å²	188	135.1 Å²	135.1	82%	0.817	77%	0.77	S	S	*	*			trans	-57.7	96.6	179.9	-173.9	175.1	172.9	77.4	0	107.4	A7 V11	A7-K9 PolarHBondContact O-N 3.39Å; A7-K9 VanDerWaalsContact O-N 3.08Å; K9-V11 HydrophobicContact CG-CG2 4.21Å; K9-V11 PolarHBondContact O-N 3.47Å
10	L	54.2	Low	53.9	Low	158 Å²	158	136.9 Å²	136.9	83%	0.827	78%	0.776	S	S	*	*			trans	-68.4	82.1	170.6	-68.4	176.1	0	0	0	106.4	P8 P12	P8-L10 VanDerWaalsContact C-N 3.31Å; P8-L10 PolarHBondContact O-N 3.41Å; L10-P12 VanDerWaalsContact O-CD 3.27Å; L10-P12 WeakPolarHBondContact O-CD 3Å
11	V	55.6	Low	53.9	Low	102 Å²	102	136.5 Å²	136.5	62%	0.618	78%	0.782	S	S	*	*			trans	-58.8	118.9	163.1	-179	0	0	0	0	104.5	K9 A13	K9-V11 HydrophobicContact CG-CG2 4.21Å; K9-V11 PolarHBondContact O-N 3.47Å; V11-A13 PolarHBondContact O-N 3.26Å; V11-A13 VanDerWaalsContact C-N 3.33Å
12	P	50.5	Low	54.1	Low	112 Å²	112	129.6 Å²	129.6	73%	0.727	77%	0.765	S	S	*	*			trans	-61.3	107.5	170.7	-13.7	28	0	0	0	104.8	L10 V14	L10-P12 VanDerWaalsContact O-CD 3.27Å; L10-P12 WeakPolarHBondContact O-CD 3Å; P12-V14 VanDerWaalsContact C-N 3.27Å; P12-V14 PolarHBondContact O-N 3.2Å
13	A	58.4	Low	54.1	Low	90 Å²	90	127.4 Å²	127.4	74%	0.744	75%	0.753	S	S	*	*			trans	-56.4	104.5	168.4	0	0	0	0	0	104.5	V11 A15	V11-A13 PolarHBondContact O-N 3.26Å; V11-A13 VanDerWaalsContact C-N 3.33Å; A13-A15 PolarHBondContact O-N 2.89Å
14	V	49.8	Very low	54.1	Low	134 Å²	134	128 Å²	128	81%	0.812	76%	0.757	S	S	*	*			trans	-48.1	107.9	176.9	152.3	0	0	0	0	105.8	P12 N16	P12-V14 VanDerWaalsContact C-N 3.27Å; P12-V14 PolarHBondContact O-N 3.2Å; V14-N16 PolarHBondContact O-N 3.29Å
15	A	52.5	Low	54	Low	83 Å²	83	128.3 Å²	128.3	69%	0.686	75%	0.752	S	S	*	*			trans	-67.9	93	176.4	0	0	0	0	0	105.5	A13 V17	A13-A15 PolarHBondContact O-N 2.89Å; A15-V17 HydrophobicContact CB-CG2 3.94Å; A15-V17 PolarHBondContact O-N 3.33Å
16	N	49.3	Very low	53.9	Low	108 Å²	108	126.2 Å²	126.2	58%	0.578	75%	0.746	S	S	*	*			trans	-71.4	72.3	168.1	-178.8	45.3	0	0	0	107.3	V14 R18	V14-N16 PolarHBondContact O-N 3.29Å; N16-R18 PolarHBondContact OD1-NH2 3.36Å; N16-R18 VanDerWaalsContact OD1-NE 3.1Å; N16-R18 PolarHBondContact O-N 2.88Å; N16-R18 PolarHBondContact OD1-NE 3.41Å
17	V	53	Low	53.9	Low	125 Å²	125	126.6 Å²	126.6	76%	0.758	74%	0.743	S	S	*	*			trans	-82.5	74.6	172	-172.8	0	0	0	0	106.7	A15	A15-V17 HydrophobicContact CB-CG2 3.94Å; A15-V17 PolarHBondContact O-N 3.33Å
18	R	50.4	Low	54.1	Low	207 Å²	207	130.1 Å²	130.1	78%	0.781	75%	0.745	S	S	*	*			trans	-89.9	101.8	165	-118	179.7	-70.6	-141.6	-1.2	107.5	N16	N16-R18 PolarHBondContact OD1-NH2 3.36Å; N16-R18 VanDerWaalsContact OD1-NE 3.1Å; N16-R18 PolarHBondContact O-N 2.88Å; N16-R18 PolarHBondContact OD1-NE 3.41Å
19	G	48.3	Very low	54.2	Low	57 Å²	57	130.2 Å²	130.2	59%	0.588	75%	0.754	S	S	*	*	S	Bend	trans	87.5	112.9	145.4	0	0	0	0	0	117.3
20	L	50.8	Low	54	Low	171 Å²	171	125.1 Å²	125.1	90%	0.895	76%	0.755	S	S	*	*			trans	85.8	110	135	-54.1	172.3	0	0	0	118.2
21	S	54.7	Low	54.1	Low	130 Å²	130	121.6 Å²	121.6	91%	0.909	74%	0.74	S	S	*	*			trans	61.3	107.3	137.3	-158.5	0	0	0	0	117.5
22	G	55.4	Low	54.4	Low	66 Å²	66	125.6 Å²	125.6	68%	0.68	75%	0.752	S	S	*	*	S	Bend	trans	130.2	93.4	161.8	0	0	0	0	0	112.4
23	S	52.6	Low	54.8	Low	83 Å²	83	130.1 Å²	130.1	58%	0.58	75%	0.754	S	S	*	*			trans	43.9	109	158.1	56.2	0	0	0	0	117.8	F25	S23-F25 WeakPolarHBondContact O-CD2 2.99Å; S23-F25 PolarHBondContact O-N 3.26Å; S23-F25 WeakPolarHBondContact OG-CD2 3.5Å; S23-F25 WeakPolarHBondContact OG-CE2 3.48Å
24	Y	52.1	Low	55	Low	231 Å²	231	134.9 Å²	134.9	91%	0.906	75%	0.753	S	S	*	*			trans	-62.6	94.5	168	-57.6	-82.3	0	0	0	111	V26	Y24-V26 PolarHBondContact O-N 3.44Å
25	F	55.3	Low	55.6	Low	160 Å²	160	133.9 Å²	133.9	70%	0.702	74%	0.743	S	S	*	*			trans	-87.2	96.1	167.9	-73.6	-76.1	0	0	0	109.6	S23 T27	S23-F25 WeakPolarHBondContact O-CD2 2.99Å; S23-F25 PolarHBondContact O-N 3.26Å; S23-F25 WeakPolarHBondContact OG-CD2 3.5Å; S23-F25 WeakPolarHBondContact OG-CE2 3.48Å; F25-T27 PolarHBondContact O-N 3.35Å
26	V	56.2	Low	55.9	Low	131 Å²	131	134.6 Å²	134.6	79%	0.794	74%	0.741	S	S	*	*			trans	-69.3	110.5	169.5	177.7	0	0	0	0	108.2	Y24 Q28	Y24-V26 PolarHBondContact O-N 3.44Å; V26-Q28 PolarHBondContact O-N 2.83Å
27	T	58.6	Low	56.2	Low	126 Å²	126	137.2 Å²	137.2	77%	0.773	75%	0.753	S	S	*	*			trans	-90.3	94.8	174.9	6.1	0	0	0	0	109	F25	F25-T27 PolarHBondContact O-N 3.35Å
28	Q	61.3	Low	56.3	Low	164 Å²	164	135.3 Å²	135.3	77%	0.766	74%	0.742	S	S	*	*			trans	-72.8	122.9	164.1	-169.2	171.4	-6.7	0	0	107.8	V26 G30 V31	V26-Q28 PolarHBondContact O-N 2.83Å; Q28-G30 PolarHBondContact O-N 2.72Å; Q28-V31 PolarHBondContact O-N 3Å
29	A	60.7	Low	56.7	Low	109 Å²	109	130.6 Å²	130.6	90%	0.901	73%	0.732	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.1	108.9	-174.7	0	0	0	0	0	111.4
30	G	53.5	Low	57.3	Low	80 Å²	80	135.6 Å²	135.6	83%	0.825	74%	0.74	S	S	*	*	T	Hydrogen-bonded Turn	trans	131.7	-14.5	171.6	0	0	0	0	0	116.1	Q28	Q28-G30 PolarHBondContact O-N 2.72Å
31	V	57.9	Low	57.6	Low	84 Å²	84	133.3 Å²	133.3	51%	0.509	74%	0.735	S	S	.	*			trans	-107.2	99.9	178.8	-172.4	0	0	0	0	110	Q28 W33	Q28-V31 PolarHBondContact O-N 3Å; V31-W33 HydrophobicContact CG1-CD2 4.21Å; V31-W33 HydrophobicContact CG1-CG 4.33Å; V31-W33 HydrophobicContact CG1-CZ2 4.11Å; V31-W33 PolarHBondContact O-N 3.5Å
32	Q	60.8	Low	57.5	Low	186 Å²	186	134.3 Å²	134.3	87%	0.869	73%	0.727	S	S	*	*			trans	-77	96.3	170.3	-165.1	-178.5	90.6	0	0	108	R34	Q32-R34 PolarHBondContact O-N 2.83Å
33	W	59.7	Low	57.4	Low	208 Å²	208	134.5 Å²	134.5	79%	0.788	72%	0.718	S	S	*	*			trans	-70.5	114.1	169.7	-67.8	93.3	0	0	0	107.6	V31	V31-W33 HydrophobicContact CG1-CD2 4.21Å; V31-W33 HydrophobicContact CG1-CG 4.33Å; V31-W33 HydrophobicContact CG1-CZ2 4.11Å; V31-W33 PolarHBondContact O-N 3.5Å
34	R	62.8	Low	57.5	Low	190 Å²	190	135 Å²	135	72%	0.717	72%	0.721	S	S	*	*			trans	-57.1	141.9	172.6	-64.7	-159	-162.7	-166.5	7.1	108.7	Q32	Q32-R34 PolarHBondContact O-N 2.83Å
35	D	61.2	Low	57.5	Low	112 Å²	112	133.5 Å²	133.5	60%	0.599	71%	0.714	S	S	*	*			trans	-42.8	131.2	-177.2	-66.1	-60.1	0	0	0	111.2	I37 T38 L39	D35-I37 PolarHBondContact O-N 3.24Å; D35-T38 PolarHBondContact O-OG1 3.16Å; D35-T38 WeakPolarHBondContact O-CA 3.27Å; D35-T38 HydrophobicContact CB-CG2 4.14Å; D35-T38 PolarHBondContact O-N 3.08Å; D35-L39 PolarHBondContact O-N 3.17Å
36	P	58.8	Low	57.6	Low	99 Å²	99	129.2 Å²	129.2	64%	0.643	70%	0.698	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.9	-22.6	178.9	-24.8	32	0	0	0	113.6
37	I	57.1	Low	57.3	Low	162 Å²	162	129.1 Å²	129.1	83%	0.831	69%	0.687	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.8	-28.8	174.9	-68.6	170.5	0	0	0	112	D35	D35-I37 PolarHBondContact O-N 3.24Å
38	T	54.3	Low	57.2	Low	86 Å²	86	129 Å²	129	53%	0.528	68%	0.678	S	S	.	*	T	Hydrogen-bonded Turn	trans	-83.5	-20.9	176.4	62.8	0	0	0	0	112.8	D35 Q40	D35-T38 PolarHBondContact O-OG1 3.16Å; D35-T38 WeakPolarHBondContact O-CA 3.27Å; D35-T38 HydrophobicContact CB-CG2 4.14Å; D35-T38 PolarHBondContact O-N 3.08Å; T38-Q40 PolarHBondContact O-N 3.41Å; T38-Q40 VanDerWaalsContact O-N 3.11Å
39	L	58	Low	57	Low	107 Å²	107	124.3 Å²	124.3	56%	0.56	66%	0.663	S	S	*	*	S	Bend	trans	-82.9	77.8	164.6	-63.8	176.5	0	0	0	107.7	D35	D35-L39 PolarHBondContact O-N 3.17Å
40	Q	60.8	Low	56.9	Low	163 Å²	163	126.8 Å²	126.8	76%	0.762	65%	0.654	S	S	*	*			trans	-39	133.3	161.7	-68.4	-176.9	-44.7	0	0	107.8	T38 M42	T38-Q40 PolarHBondContact O-N 3.41Å; T38-Q40 VanDerWaalsContact O-N 3.11Å; Q40-M42 PolarHBondContact O-N 2.81Å
41	P	58.3	Low	57	Low	123 Å²	123	131 Å²	131	80%	0.799	65%	0.646	S	S	*	*			trans	-50.2	114.1	178.5	20.4	-30.9	0	0	0	105.9	S43	P41-S43 WeakPolarHBondContact O-CA 3.04Å; P41-S43 PolarHBondContact O-N 2.98Å
42	M	52.2	Low	56.9	Low	151 Å²	151	134.6 Å²	134.6	74%	0.744	66%	0.657	S	S	*	*			trans	-42.7	113.9	-174.6	-101.3	-177.5	178.4	0	0	106.1	Q40 S44 L46	Q40-M42 PolarHBondContact O-N 2.81Å; M42-S44 PolarHBondContact O-N 2.69Å; M42-S44 VanDerWaalsContact O-N 3.16Å; M42-L46 HydrophobicContact CB-CD1 4.14Å; M42-L46 HydrophobicContact SD-CD1 4.07Å; M42-L46 HydrophobicContact CG-CD1 3.77Å; M42-L46 HydrophobicContact CE-CD1 4.47Å
43	S	53.6	Low	56.6	Low	70 Å²	70	133 Å²	133	49%	0.49	65%	0.654	S	S	.	*			trans	-45.2	130.6	-171.2	64.5	0	0	0	0	107.7	P41 R45 L46	P41-S43 WeakPolarHBondContact O-CA 3.04Å; P41-S43 PolarHBondContact O-N 2.98Å; S43-R45 PolarHBondContact O-N 3.31Å; S43-L46 PolarHBondContact O-N 2.8Å
44	S	55.4	Low	56.2	Low	92 Å²	92	128.6 Å²	128.6	64%	0.643	65%	0.652	S	S	*	*	H	α-helix	trans	-41	-26.7	-174.8	176.9	0	0	0	0	114.2	M42 L46 K47 Q48	M42-S44 PolarHBondContact O-N 2.69Å; M42-S44 VanDerWaalsContact O-N 3.16Å; S44-L46 VanDerWaalsContact C-N 3.34Å; S44-L46 PolarHBondContact O-N 3.11Å; S44-K47 PolarHBondContact O-N 2.79Å; S44-Q48 PolarHBondContact O-N 3.25Å
45	R	52	Low	55.7	Low	200 Å²	200	132.5 Å²	132.5	76%	0.755	68%	0.679	S	S	*	*	H	α-helix	trans	-56.8	-35.6	174.3	-48.4	-162	92.3	-165.3	6.1	114.7	S43 Q48 S49	S43-R45 PolarHBondContact O-N 3.31Å; R45-Q48 PolarHBondContact O-N 3.37Å; R45-S49 PolarHBondContact O-N 2.84Å
46	L	55.8	Low	55.4	Low	71 Å²	71	133.5 Å²	133.5	37%	0.372	68%	0.683	S	S	.	*	H	α-helix	trans	-70.5	-35.7	179.2	-76.2	171.3	0	0	0	111.8	M42 S43 S44 Q48 S49 F50	M42-L46 HydrophobicContact CB-CD1 4.14Å; M42-L46 HydrophobicContact SD-CD1 4.07Å; M42-L46 HydrophobicContact CG-CD1 3.77Å; M42-L46 HydrophobicContact CE-CD1 4.47Å; S43-L46 PolarHBondContact O-N 2.8Å; S44-L46 VanDerWaalsContact C-N 3.34Å; S44-L46 PolarHBondContact O-N 3.11Å; L46-Q48 VanDerWaalsContact C-N 3.29Å; L46-Q48 PolarHBondContact O-N 2.77Å; L46-S49 PolarHBondContact O-N 2.81Å; L46-S49 PolarHBondContact O-OG 2.81Å; L46-F50 PolarHBondContact O-N 2.91Å; L46-F50 WeakPolarHBondContact O-CD2 3.42Å
47	K	51.2	Low	55.2	Low	128 Å²	128	135.3 Å²	135.3	56%	0.557	69%	0.685	S	S	*	*	H	α-helix	trans	-61.4	-39.7	174.1	-102.2	-89.7	-179.5	169	0	110.9	S44 F50 Y51	S44-K47 PolarHBondContact O-N 2.79Å; K47-F50 PolarHBondContact O-N 2.84Å; K47-Y51 HydrophobicContact CD-CE2 3.56Å; K47-Y51 PolarHBondContact NZ-OH 2.96Å; K47-Y51 WeakPolarHBondContact O-CD2 3.5Å
48	Q	56.3	Low	55.1	Low	123 Å²	123	133.8 Å²	133.8	58%	0.575	68%	0.677	S	S	*	*	H	α-helix	trans	-66.2	-38.3	178.2	-69.2	-178.5	-78.4	0	0	112.8	S44 R45 L46 F50 Y51 Q52	S44-Q48 PolarHBondContact O-N 3.25Å; R45-Q48 PolarHBondContact O-N 3.37Å; L46-Q48 VanDerWaalsContact C-N 3.29Å; L46-Q48 PolarHBondContact O-N 2.77Å; Q48-F50 VanDerWaalsContact C-N 3.33Å; Q48-F50 PolarHBondContact O-N 2.82Å; Q48-Y51 PolarHBondContact O-N 3Å; Q48-Q52 PolarHBondContact O-N 3.1Å
49	S	57	Low	55.1	Low	67 Å²	67	136.6 Å²	136.6	47%	0.469	69%	0.685	S	S	.	*	H	α-helix	trans	-68.2	-28.8	179.7	57.9	0	0	0	0	113.7	R45 L46	R45-S49 PolarHBondContact O-N 2.84Å; L46-S49 PolarHBondContact O-N 2.81Å; L46-S49 PolarHBondContact O-OG 2.81Å
50	F	57.7	Low	55	Low	160 Å²	160	138.5 Å²	138.5	70%	0.702	69%	0.693	S	S	*	*	H	α-helix	trans	-76.8	-20.5	175.8	-70.9	-70.1	0	0	0	113.6	L46 K47 Q48	L46-F50 PolarHBondContact O-N 2.91Å; L46-F50 WeakPolarHBondContact O-CD2 3.42Å; K47-F50 PolarHBondContact O-N 2.84Å; Q48-F50 VanDerWaalsContact C-N 3.33Å; Q48-F50 PolarHBondContact O-N 2.82Å
51	Y	56.5	Low	54.6	Low	169 Å²	169	136.9 Å²	136.9	66%	0.663	69%	0.689	S	S	*	*	H	α-helix	trans	-93.1	-7.5	174	-65.6	-64.6	0	0	0	113.3	K47 Q48	K47-Y51 HydrophobicContact CD-CE2 3.56Å; K47-Y51 PolarHBondContact NZ-OH 2.96Å; K47-Y51 WeakPolarHBondContact O-CD2 3.5Å; Q48-Y51 PolarHBondContact O-N 3Å
52	Q	55.7	Low	54.3	Low	159 Å²	159	137.9 Å²	137.9	74%	0.743	68%	0.681	S	S	*	*			trans	-104.2	63.2	171.6	-64.2	-156.4	-62.2	0	0	110	Q48	Q48-Q52 PolarHBondContact O-N 3.1Å
53	L	54.2	Low	54.5	Low	154 Å²	154	136.8 Å²	136.8	81%	0.806	68%	0.676	S	S	*	*			trans	-79.4	122.7	155	-162.7	78.7	0	0	0	106.4
54	P	50.8	Low	54.5	Low	115 Å²	115	142.4 Å²	142.4	75%	0.747	69%	0.691	S	S	*	*			trans	-69.8	147.2	170.3	30.3	-31	0	0	0	109.7
55	E	51.9	Low	54.5	Low	271 Å²	271	147 Å²	147	100%	1.266	70%	0.696	S	S	*	*			trans	-25.5	0	-175.1	-153.4	178.3	147	0	0	117.9

Retrieved 55 of 55 residues in 88.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).