A0A087X0Z8_HUMAN Loading...

Mitogen-activated protein kinase kinase 5

AlphaFold DB , UniProt , Accession A0A087X0Z8, Species HUMAN (Homo sapiens, Human), Gene MAP2K5, Length 49 aa.

						>A0A087X0Z8_HUMAN|A0A087X0Z8|MAP2K5
QYGIHSDVWSLGISFMEPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQW
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	Q	57.3	Low	73	Confident	235 Å²	235	127.5 Å²	127.5	100%	1.098	64%	0.644	S	S	*	*				0	93.8	0	-82.1	167.3	-87.9	107.9
2	Y	59.9	Low	73.7	Confident	217 Å²	217	119.6 Å²	119.6	85%	0.851	62%	0.619	S	S	*	*			trans	-132.6	10.2	-178.8	-72.4	-78.5	0	113.2	S6	Y2-S6 VanDerWaalsContact O-CB 3.26Å; Y2-S6 WeakPolarHBondContact O-CB 3.37Å
3	G	64.3	Low	74.1	Confident	42 Å²	42	116.2 Å²	116.2	43%	0.433	60%	0.601	S	S	.	*	S	Bend	trans	-81.3	-73.5	-178.6	0	0	0	112	H5 S6 D7	G3-H5 VanDerWaalsContact C-N 3.35Å; G3-H5 PolarHBondContact O-N 2.72Å; G3-S6 WeakPolarHBondContact O-CB 3.46Å; G3-S6 PolarHBondContact O-N 3.41Å; G3-D7 VanDerWaalsContact O-CG 3.26Å; G3-D7 PolarHBondContact O-N 3.27Å; G3-D7 VanDerWaalsContact O-N 3.08Å; G3-D7 VanDerWaalsContact O-OD2 3.1Å
4	I	68.3	Low	74.6	Confident	142 Å²	142	113.7 Å²	113.7	73%	0.728	60%	0.599	S	S	*	*	H	α-helix	trans	-61.7	-38.2	-167.7	-55.6	168	0	113.2	D7 V8	I4-D7 PolarHBondContact O-N 3.24Å; I4-V8 WeakPolarHBondContact O-CG2 3.29Å; I4-V8 PolarHBondContact O-N 3.43Å; I4-V8 VanDerWaalsContact O-N 3.13Å
5	H	70.2	Confident	74.8	Confident	154 Å²	154	116.8 Å²	116.8	71%	0.713	61%	0.606	S	S	*	*	H	α-helix	trans	-71.4	-32.8	-180	-171.3	-96.5	0	112.5	G3 W9	G3-H5 VanDerWaalsContact C-N 3.35Å; G3-H5 PolarHBondContact O-N 2.72Å; H5-W9 PolarHBondContact O-N 3.24Å
6	S	76.4	Confident	75	Confident	62 Å²	62	115.8 Å²	115.8	43%	0.434	60%	0.599	S	S	.	*	H	α-helix	trans	-72.1	-37.3	176.2	-170.2	0	0	111.3	Y2 G3 W9 S10	Y2-S6 VanDerWaalsContact O-CB 3.26Å; Y2-S6 WeakPolarHBondContact O-CB 3.37Å; G3-S6 WeakPolarHBondContact O-CB 3.46Å; G3-S6 PolarHBondContact O-N 3.41Å; S6-W9 PolarHBondContact O-N 2.87Å; S6-S10 WeakPolarHBondContact O-CB 3.33Å; S6-S10 PolarHBondContact O-N 3.35Å; S6-S10 PolarHBondContact O-OG 3.41Å
7	D	79.8	Confident	75.3	Confident	96 Å²	96	114.9 Å²	114.9	51%	0.513	59%	0.591	S	S	.	*	H	α-helix	trans	-67.4	-44.3	178.9	-59.9	-33.2	0	111.3	G3 I4 W9 S10 L11	G3-D7 VanDerWaalsContact O-CG 3.26Å; G3-D7 PolarHBondContact O-N 3.27Å; G3-D7 VanDerWaalsContact O-N 3.08Å; G3-D7 VanDerWaalsContact O-OD2 3.1Å; I4-D7 PolarHBondContact O-N 3.24Å; D7-W9 VanDerWaalsContact C-N 3.33Å; D7-W9 PolarHBondContact O-N 2.84Å; D7-S10 PolarHBondContact O-N 2.84Å; D7-L11 VanDerWaalsContact O-CG 3.27Å; D7-L11 WeakPolarHBondContact O-CG 3.43Å; D7-L11 PolarHBondContact O-N 3.18Å
8	V	84.3	Confident	75.5	Confident	95 Å²	95	112.3 Å²	112.3	58%	0.576	58%	0.583	S	S	*	*	H	α-helix	trans	-63	-40.1	176.6	172.8	0	0	111.7	I4 L11 G12	I4-V8 WeakPolarHBondContact O-CG2 3.29Å; I4-V8 PolarHBondContact O-N 3.43Å; I4-V8 VanDerWaalsContact O-N 3.13Å; V8-L11 PolarHBondContact O-N 2.99Å; V8-G12 PolarHBondContact O-N 2.99Å
9	W	77.4	Confident	75.8	Confident	175 Å²	175	111.2 Å²	111.2	66%	0.663	58%	0.577	S	S	*	*	H	α-helix	trans	-61.2	-47.2	173.8	-177.9	-84.6	0	111.5	H5 S6 D7 L11 G12 I13	H5-W9 PolarHBondContact O-N 3.24Å; S6-W9 PolarHBondContact O-N 2.87Å; D7-W9 VanDerWaalsContact C-N 3.33Å; D7-W9 PolarHBondContact O-N 2.84Å; W9-L11 VanDerWaalsContact C-N 3.32Å; W9-L11 PolarHBondContact O-N 3.49Å; W9-G12 PolarHBondContact O-N 3.24Å; W9-I13 WeakPolarHBondContact O-CG1 3.49Å; W9-I13 PolarHBondContact O-N 3.44Å
10	S	81.8	Confident	75.9	Confident	63 Å²	63	110.4 Å²	110.4	44%	0.441	57%	0.57	S	S	.	*	H	α-helix	trans	-63.2	-38.3	-179.8	-55.7	0	0	112	S6 D7 S14	S6-S10 WeakPolarHBondContact O-CB 3.33Å; S6-S10 PolarHBondContact O-N 3.35Å; S6-S10 PolarHBondContact O-OG 3.41Å; D7-S10 PolarHBondContact O-N 2.84Å; S10-S14 VanDerWaalsContact O-CB 3.31Å; S10-S14 WeakPolarHBondContact O-CB 2.96Å; S10-S14 PolarHBondContact O-N 3.11Å
11	L	83.8	Confident	76.2	Confident	121 Å²	121	110.2 Å²	110.2	63%	0.634	57%	0.57	S	S	*	*	H	α-helix	trans	-66.5	-39.5	174.2	-69.9	172.9	0	112.2	D7 V8 W9 S14 F15	D7-L11 VanDerWaalsContact O-CG 3.27Å; D7-L11 WeakPolarHBondContact O-CG 3.43Å; D7-L11 PolarHBondContact O-N 3.18Å; V8-L11 PolarHBondContact O-N 2.99Å; W9-L11 VanDerWaalsContact C-N 3.32Å; W9-L11 PolarHBondContact O-N 3.49Å; L11-S14 PolarHBondContact O-N 3.26Å; L11-F15 WeakPolarHBondContact O-CB 3.43Å; L11-F15 PolarHBondContact O-N 2.95Å
12	G	80.5	Confident	77.4	Confident	33 Å²	33	103.7 Å²	103.7	34%	0.34	54%	0.542	S	S	.	.	H	α-helix	trans	-60.6	-46.5	175.4	0	0	0	112.3	V8 W9 F15 M16	V8-G12 PolarHBondContact O-N 2.99Å; W9-G12 PolarHBondContact O-N 3.24Å; G12-F15 PolarHBondContact O-N 3.43Å; G12-M16 VanDerWaalsContact O-CG 3.31Å; G12-M16 WeakPolarHBondContact O-CG 3.37Å; G12-M16 PolarHBondContact O-N 3.12Å; G12-M16 VanDerWaalsContact O-N 3.13Å
13	I	79.8	Confident	78.4	Confident	75 Å²	75	99.1 Å²	99.1	39%	0.385	53%	0.529	S	S	.	.	H	α-helix	trans	-64.6	-45.9	176.1	-61.3	-58.1	0	111.2	W9 F15 M16 E17	W9-I13 WeakPolarHBondContact O-CG1 3.49Å; W9-I13 PolarHBondContact O-N 3.44Å; I13-F15 PolarHBondContact O-N 3.11Å; I13-M16 PolarHBondContact O-N 3.37Å; I13-E17 HydrophobicContact CG2-CG 4.15Å; I13-E17 WeakPolarHBondContact O-CG 3.5Å; I13-E17 PolarHBondContact O-N 3.47Å
14	S	80.1	Confident	79.2	Confident	82 Å²	82	100.1 Å²	100.1	57%	0.573	53%	0.528	S	S	*	.	H	α-helix	trans	-58.3	-31.4	178	-172.5	0	0	113	S10 L11 P18	S10-S14 VanDerWaalsContact O-CB 3.31Å; S10-S14 WeakPolarHBondContact O-CB 2.96Å; S10-S14 PolarHBondContact O-N 3.11Å; L11-S14 PolarHBondContact O-N 3.26Å; S14-P18 WeakPolarHBondContact O-CD 3.47Å
15	F	78.2	Confident	79.8	Confident	160 Å²	160	99.6 Å²	99.6	70%	0.702	53%	0.525	S	S	*	.	H	α-helix	trans	-79.5	-28.6	175.3	-160.6	-97.6	0	113.3	L11 G12 I13 L19	L11-F15 WeakPolarHBondContact O-CB 3.43Å; L11-F15 PolarHBondContact O-N 2.95Å; G12-F15 PolarHBondContact O-N 3.43Å; I13-F15 PolarHBondContact O-N 3.11Å; F15-L19 HydrophobicContact CD1-CD1 4.47Å; F15-L19 HydrophobicContact CE1-CD1 4.47Å
16	M	77.6	Confident	80.4	Confident	101 Å²	101	97.8 Å²	97.8	50%	0.498	53%	0.525	S	S	.	.	H	α-helix	trans	-83.2	-32	179.7	-70.2	179.1	75.3	113.2	G12 I13 L19 Q20	G12-M16 VanDerWaalsContact O-CG 3.31Å; G12-M16 WeakPolarHBondContact O-CG 3.37Å; G12-M16 PolarHBondContact O-N 3.12Å; G12-M16 VanDerWaalsContact O-N 3.13Å; I13-M16 PolarHBondContact O-N 3.37Å; M16-L19 WeakPolarHBondContact O-CB 3.34Å; M16-L19 PolarHBondContact O-N 2.81Å; M16-Q20 WeakPolarHBondContact O-CG 3.34Å; M16-Q20 PolarHBondContact O-N 2.93Å
17	E	79.9	Confident	80.5	Confident	101 Å²	101	101 Å²	101	47%	0.472	54%	0.537	S	S	.	.	H	α-helix	trans	-51.7	-50.7	178.8	-82.5	-75.8	142.4	113.2	I13 L19 Q20 L21	I13-E17 HydrophobicContact CG2-CG 4.15Å; I13-E17 WeakPolarHBondContact O-CG 3.5Å; I13-E17 PolarHBondContact O-N 3.47Å; E17-L19 VanDerWaalsContact C-N 3.29Å; E17-L19 PolarHBondContact O-N 3.12Å; E17-Q20 PolarHBondContact O-N 2.9Å; E17-L21 WeakPolarHBondContact O-CG 3.41Å; E17-L21 PolarHBondContact O-N 2.97Å
18	P	79.3	Confident	80.6	Confident	68 Å²	68	103 Å²	103	44%	0.442	54%	0.544	S	S	.	.	H	α-helix	trans	-62.2	-35.4	176.6	-21.6	31.8	0	113.1	S14 L21 L22	S14-P18 WeakPolarHBondContact O-CD 3.47Å; P18-L21 PolarHBondContact O-N 3.31Å; P18-L22 WeakPolarHBondContact O-CB 3.4Å; P18-L22 VanDerWaalsContact O-CG 3.23Å; P18-L22 WeakPolarHBondContact O-CG 3.15Å; P18-L22 PolarHBondContact O-N 3.31Å
19	L	80.4	Confident	80.2	Confident	90 Å²	90	105.6 Å²	105.6	47%	0.471	55%	0.554	S	S	.	*	H	α-helix	trans	-69.6	-39.6	179.5	-69.5	170.4	0	111.1	F15 M16 E17 L22 Q23	F15-L19 HydrophobicContact CD1-CD1 4.47Å; F15-L19 HydrophobicContact CE1-CD1 4.47Å; M16-L19 WeakPolarHBondContact O-CB 3.34Å; M16-L19 PolarHBondContact O-N 2.81Å; E17-L19 VanDerWaalsContact C-N 3.29Å; E17-L19 PolarHBondContact O-N 3.12Å; L19-L22 PolarHBondContact O-N 3.35Å; L19-Q23 WeakPolarHBondContact O-CG 3.32Å; L19-Q23 PolarHBondContact O-N 3.28Å
20	Q	79.4	Confident	80.3	Confident	95 Å²	95	100.1 Å²	100.1	44%	0.444	54%	0.543	S	S	.	.	H	α-helix	trans	-64.7	-41.7	175.5	-70	-179.7	3	111.5	M16 E17 L22 Q23 C24	M16-Q20 WeakPolarHBondContact O-CG 3.34Å; M16-Q20 PolarHBondContact O-N 2.93Å; E17-Q20 PolarHBondContact O-N 2.9Å; Q20-L22 VanDerWaalsContact C-N 3.34Å; Q20-L22 PolarHBondContact O-N 3.28Å; Q20-Q23 PolarHBondContact O-N 3.3Å; Q20-C24 PolarHBondContact O-N 3.49Å; Q20-C24 PolarHBondContact O-SG 2.98Å
21	L	81.9	Confident	80.1	Confident	107 Å²	107	102.3 Å²	102.3	56%	0.56	56%	0.555	S	S	*	*	H	α-helix	trans	-62.3	-40.8	173.9	-68.4	174.3	0	112.2	E17 P18 Q23 C24 I25	E17-L21 WeakPolarHBondContact O-CG 3.41Å; E17-L21 PolarHBondContact O-N 2.97Å; P18-L21 PolarHBondContact O-N 3.31Å; L21-Q23 VanDerWaalsContact C-N 3.34Å; L21-C24 PolarHBondContact O-N 3.07Å; L21-I25 VanDerWaalsContact O-CG1 3.32Å; L21-I25 WeakPolarHBondContact O-CG1 3.47Å; L21-I25 PolarHBondContact O-N 2.9Å
22	L	82	Confident	80	Confident	99 Å²	99	102.5 Å²	102.5	52%	0.518	56%	0.562	S	S	.	*	H	α-helix	trans	-64.5	-38.5	175	-73.3	168.3	0	112.1	P18 L19 Q20 I25 V26	P18-L22 WeakPolarHBondContact O-CB 3.4Å; P18-L22 VanDerWaalsContact O-CG 3.23Å; P18-L22 WeakPolarHBondContact O-CG 3.15Å; P18-L22 PolarHBondContact O-N 3.31Å; L19-L22 PolarHBondContact O-N 3.35Å; Q20-L22 VanDerWaalsContact C-N 3.34Å; Q20-L22 PolarHBondContact O-N 3.28Å; L22-I25 PolarHBondContact O-N 3.13Å; L22-V26 WeakPolarHBondContact O-CG2 3.11Å; L22-V26 PolarHBondContact O-N 3.34Å; L22-V26 VanDerWaalsContact O-N 3.12Å
23	Q	80.2	Confident	80	Confident	121 Å²	121	102.6 Å²	102.6	57%	0.565	55%	0.554	S	S	*	*	H	α-helix	trans	-63.8	-42.2	173.5	-71.3	-172.7	-67.5	111.3	L19 Q20 L21 I25 V26 D27	L19-Q23 WeakPolarHBondContact O-CG 3.32Å; L19-Q23 PolarHBondContact O-N 3.28Å; Q20-Q23 PolarHBondContact O-N 3.3Å; L21-Q23 VanDerWaalsContact C-N 3.34Å; Q23-I25 VanDerWaalsContact C-N 3.35Å; Q23-I25 PolarHBondContact O-N 2.93Å; Q23-V26 PolarHBondContact O-N 3.47Å; Q23-D27 WeakPolarHBondContact O-CB 3.44Å; Q23-D27 PolarHBondContact O-N 2.99Å
24	C	81.6	Confident	80	Confident	63 Å²	63	102.1 Å²	102.1	43%	0.426	56%	0.556	S	S	.	*	H	α-helix	trans	-59.4	-44	172.9	-63.3	0	0	111.8	Q20 L21 V26 D27 E28	Q20-C24 PolarHBondContact O-N 3.49Å; Q20-C24 PolarHBondContact O-SG 2.98Å; L21-C24 PolarHBondContact O-N 3.07Å; C24-V26 PolarHBondContact O-N 3.22Å; C24-D27 PolarHBondContact O-N 3.19Å; C24-E28 WeakPolarHBondContact O-CA 3.31Å; C24-E28 WeakPolarHBondContact O-CB 3.44Å; C24-E28 PolarHBondContact O-N 3.32Å
25	I	81.9	Confident	79.8	Confident	130 Å²	130	105.2 Å²	105.2	67%	0.667	57%	0.571	S	S	*	*	H	α-helix	trans	-61.8	-31.3	178.5	-67.7	163.8	0	112.4	L21 L22 Q23	L21-I25 VanDerWaalsContact O-CG1 3.32Å; L21-I25 WeakPolarHBondContact O-CG1 3.47Å; L21-I25 PolarHBondContact O-N 2.9Å; L22-I25 PolarHBondContact O-N 3.13Å; Q23-I25 VanDerWaalsContact C-N 3.35Å; Q23-I25 PolarHBondContact O-N 2.93Å
26	V	82.4	Confident	79.9	Confident	116 Å²	116	101.2 Å²	101.2	70%	0.703	58%	0.575	S	S	*	*	H	α-helix	trans	-86.9	-39.6	-178.1	173.2	0	0	112.4	L22 Q23 C24	L22-V26 WeakPolarHBondContact O-CG2 3.11Å; L22-V26 PolarHBondContact O-N 3.34Å; L22-V26 VanDerWaalsContact O-N 3.12Å; Q23-V26 PolarHBondContact O-N 3.47Å; C24-V26 PolarHBondContact O-N 3.22Å
27	D	78.3	Confident	80.3	Confident	130 Å²	130	103.6 Å²	103.6	70%	0.695	59%	0.585	S	S	*	*	H	α-helix	trans	-101	-20.2	-171.1	-69.8	-47.5	0	113.9	Q23 C24	Q23-D27 WeakPolarHBondContact O-CB 3.44Å; Q23-D27 PolarHBondContact O-N 2.99Å; C24-D27 PolarHBondContact O-N 3.19Å
28	E	81.4	Confident	80.5	Confident	138 Å²	138	102.8 Å²	102.8	65%	0.645	58%	0.58	S	S	*	*	S	Bend	trans	-81.4	141.5	179.1	-161.6	-167.7	165.9	111.5	C24	C24-E28 WeakPolarHBondContact O-CA 3.31Å; C24-E28 WeakPolarHBondContact O-CB 3.44Å; C24-E28 PolarHBondContact O-N 3.32Å
29	D	75.9	Confident	80.9	Confident	149 Å²	149	103 Å²	103	80%	0.797	58%	0.583	S	S	*	*	P	Polyproline II helix	trans	-54.8	144.8	167.9	-79.6	-66.1	0	110.9
30	S	78.8	Confident	81.1	Confident	61 Å²	61	106.9 Å²	106.9	43%	0.427	60%	0.599	S	S	.	*	P	Polyproline II helix	trans	-56.9	136.2	177.8	-90.6	0	0	111.7	V32 W49	S30-V32 PolarHBondContact O-N 3.06Å; S30-W49 PolarHBondContact OG-NE1 3.13Å
31	P	79	Confident	81.5	Confident	108 Å²	108	107 Å²	107	70%	0.701	61%	0.608	S	S	*	*	P	Polyproline II helix	trans	-61.7	127	-178.6	24.9	-33.5	0	110
32	V	80.3	Confident	81.6	Confident	126 Å²	126	105.9 Å²	105.9	76%	0.764	60%	0.599	S	S	*	*	P	Polyproline II helix	trans	-89	133.7	179.6	-176.4	0	0	109.4	S30	S30-V32 PolarHBondContact O-N 3.06Å
33	L	81.3	Confident	81.7	Confident	35 Å²	35	103.4 Å²	103.4	18%	0.183	59%	0.588	C	S	.	*	P	Polyproline II helix	trans	-68	140.9	175.2	-72	168.5	0	111	V35 F38 F42 V43 I46	L33-V35 PolarHBondContact O-N 3.24Å; L33-F38 HydrophobicContact CB-CD2 4.25Å; L33-F38 HydrophobicContact CD2-CD2 4.18Å; L33-F38 HydrophobicContact CD2-CE2 4.06Å; L33-F38 HydrophobicContact CD2-CZ 4.44Å; L33-F42 HydrophobicContact CD1-CD1 3.86Å; L33-F42 HydrophobicContact CD1-CE1 3.76Å; L33-F42 HydrophobicContact CD2-CE1 4.33Å; L33-V43 HydrophobicContact CB-CG2 4.36Å; L33-V43 HydrophobicContact CD1-CB 4.35Å; L33-V43 HydrophobicContact CD1-CG2 4.01Å; L33-I46 HydrophobicContact CD1-CB 3.95Å; L33-I46 HydrophobicContact CD1-CG1 4.07Å; L33-I46 HydrophobicContact CD1-CG2 4.17Å
34	P	80.2	Confident	81.9	Confident	65 Å²	65	103 Å²	103	42%	0.422	59%	0.585	S	S	.	*	P	Polyproline II helix	trans	-60.7	126.6	176.6	23.7	-31.2	0	110.7	G36 E37 F38	P34-G36 PolarHBondContact O-N 2.97Å; P34-E37 HydrophobicContact CB-CG 4.47Å; P34-E37 HydrophobicContact CG-CB 4.36Å; P34-E37 HydrophobicContact CG-CG 4.44Å; P34-E37 VanDerWaalsContact CG-OE2 3.29Å; P34-E37 WeakPolarHBondContact CG-OE2 3.44Å; P34-F38 HydrophobicContact CG-CD2 4.17Å; P34-F38 HydrophobicContact CG-CE2 3.78Å
35	V	76.7	Confident	82	Confident	146 Å²	146	107.2 Å²	107.2	89%	0.885	60%	0.597	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.3	128.2	-174.8	-179.5	0	0	109.9	L33	L33-V35 PolarHBondContact O-N 3.24Å
36	G	79.5	Confident	82	Confident	77 Å²	77	104.6 Å²	104.6	79%	0.794	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	92.8	-7.7	175.8	0	0	0	115.4	P34	P34-G36 PolarHBondContact O-N 2.97Å
37	E	85.9	Confident	81.9	Confident	150 Å²	150	102.6 Å²	102.6	70%	0.701	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.3	-25.1	172.7	-66.2	-165.4	157.2	112.9	P34	P34-E37 HydrophobicContact CB-CG 4.47Å; P34-E37 HydrophobicContact CG-CB 4.36Å; P34-E37 HydrophobicContact CG-CG 4.44Å; P34-E37 VanDerWaalsContact CG-OE2 3.29Å; P34-E37 WeakPolarHBondContact CG-OE2 3.44Å
38	F	85	Confident	81.6	Confident	85 Å²	85	102.3 Å²	102.3	37%	0.373	57%	0.566	S	S	.	*	S	Bend	trans	-119.1	150.7	-175.5	-64.8	-83.5	0	111.9	L33 P34 F42 V43	L33-F38 HydrophobicContact CB-CD2 4.25Å; L33-F38 HydrophobicContact CD2-CD2 4.18Å; L33-F38 HydrophobicContact CD2-CE2 4.06Å; L33-F38 HydrophobicContact CD2-CZ 4.44Å; P34-F38 HydrophobicContact CG-CD2 4.17Å; P34-F38 HydrophobicContact CG-CE2 3.78Å; F38-F42 HydrophobicContact CB-CD1 3.81Å; F38-F42 HydrophobicContact CB-CE1 4.45Å; F38-F42 AromaticContact CD1-CD1 3.42Å; F38-F42 HydrophobicContact CD1-CD1 3.42Å; F38-F42 VanDerWaalsContact CD1-CD1 3.42Å; F38-F42 AromaticContact CD1-CE1 3.33Å; F38-F42 HydrophobicContact CD1-CE1 3.33Å; F38-F42 HydrophobicContact CD1-CG 4.44Å; F38-F42 HydrophobicContact CD1-CZ 4.32Å; F38-F42 HydrophobicContact CE1-CD1 4.26Å; F38-F42 AromaticContact CE1-CE1 3.69Å; F38-F42 HydrophobicContact CE1-CE1 3.69Å; F38-F42 HydrophobicContact CE1-CZ 4.4Å; F38-F42 AromaticContact CG-CD1 3.83Å; F38-F42 HydrophobicContact CG-CD1 3.83Å; F38-F42 AromaticContact CG-CE1 3.97Å; F38-F42 HydrophobicContact CG-CE1 3.97Å; F38-V43 HydrophobicContact CB-CG2 3.77Å
39	S	87.6	Confident	80.6	Confident	73 Å²	73	108.4 Å²	108.4	51%	0.51	58%	0.583	S	S	.	*			trans	-69	145.2	176.6	67.6	0	0	110.9	P41 F42 V43	S39-P41 VanDerWaalsContact C-CD 3.4Å; S39-P41 VanDerWaalsContact C-N 3.29Å; S39-F42 WeakPolarHBondContact O-CB 3.23Å; S39-F42 PolarHBondContact O-N 3.47Å; S39-F42 WeakPolarHBondContact OG-CB 3.49Å; S39-V43 PolarHBondContact O-N 2.75Å
40	E	83.9	Confident	80.8	Confident	171 Å²	171	106.4 Å²	106.4	80%	0.799	57%	0.573	S	S	*	*	H	α-helix	trans	-52.1	-40.4	178.3	-65.8	-179.4	165.2	113.4	F42 V43 H44	E40-F42 VanDerWaalsContact C-N 3.33Å; E40-F42 PolarHBondContact O-N 3.22Å; E40-V43 PolarHBondContact O-N 3.05Å; E40-H44 WeakPolarHBondContact O-CB 3.42Å; E40-H44 PolarHBondContact O-N 3.17Å
41	P	86.9	Confident	81	Confident	98 Å²	98	108.8 Å²	108.8	64%	0.636	58%	0.58	S	S	*	*	H	α-helix	trans	-64.1	-35	176.3	-23	34.9	0	113.7	S39 F45	S39-P41 VanDerWaalsContact C-CD 3.4Å; S39-P41 VanDerWaalsContact C-N 3.29Å; P41-F45 WeakPolarHBondContact O-CB 3.31Å; P41-F45 PolarHBondContact O-N 3.41Å
42	F	84.2	Confident	81.1	Confident	83 Å²	83	108.8 Å²	108.8	36%	0.364	57%	0.574	S	S	.	*	H	α-helix	trans	-72.3	-41.3	177.2	179.3	-97.9	0	111.1	L33 F38 S39 E40 H44 F45 I46	L33-F42 HydrophobicContact CD1-CD1 3.86Å; L33-F42 HydrophobicContact CD1-CE1 3.76Å; L33-F42 HydrophobicContact CD2-CE1 4.33Å; F38-F42 HydrophobicContact CB-CD1 3.81Å; F38-F42 HydrophobicContact CB-CE1 4.45Å; F38-F42 AromaticContact CD1-CD1 3.42Å; F38-F42 HydrophobicContact CD1-CD1 3.42Å; F38-F42 VanDerWaalsContact CD1-CD1 3.42Å; F38-F42 AromaticContact CD1-CE1 3.33Å; F38-F42 HydrophobicContact CD1-CE1 3.33Å; F38-F42 HydrophobicContact CD1-CG 4.44Å; F38-F42 HydrophobicContact CD1-CZ 4.32Å; F38-F42 HydrophobicContact CE1-CD1 4.26Å; F38-F42 AromaticContact CE1-CE1 3.69Å; F38-F42 HydrophobicContact CE1-CE1 3.69Å; F38-F42 HydrophobicContact CE1-CZ 4.4Å; F38-F42 AromaticContact CG-CD1 3.83Å; F38-F42 HydrophobicContact CG-CD1 3.83Å; F38-F42 AromaticContact CG-CE1 3.97Å; F38-F42 HydrophobicContact CG-CE1 3.97Å; S39-F42 WeakPolarHBondContact O-CB 3.23Å; S39-F42 PolarHBondContact O-N 3.47Å; S39-F42 WeakPolarHBondContact OG-CB 3.49Å; E40-F42 VanDerWaalsContact C-N 3.33Å; E40-F42 PolarHBondContact O-N 3.22Å; F42-H44 VanDerWaalsContact C-N 3.31Å; F42-H44 PolarHBondContact O-N 3.45Å; F42-F45 PolarHBondContact O-N 3.44Å; F42-I46 HydrophobicContact CD1-CG1 4.47Å; F42-I46 HydrophobicContact CE1-CG1 4.12Å; F42-I46 HydrophobicContact CE2-CD1 4.43Å; F42-I46 HydrophobicContact CE2-CG1 4.28Å; F42-I46 HydrophobicContact CZ-CD1 4.33Å; F42-I46 HydrophobicContact CZ-CG1 4.03Å; F42-I46 WeakPolarHBondContact O-CG1 3.49Å; F42-I46 PolarHBondContact O-N 2.96Å; F42-I46 VanDerWaalsContact O-N 3.11Å
43	V	85.4	Confident	81.1	Confident	47 Å²	47	107.8 Å²	107.8	29%	0.285	56%	0.563	S	S	.	*	H	α-helix	trans	-61.8	-42.9	174.2	178.4	0	0	110.9	L33 F38 S39 E40 I46 T47	L33-V43 HydrophobicContact CB-CG2 4.36Å; L33-V43 HydrophobicContact CD1-CB 4.35Å; L33-V43 HydrophobicContact CD1-CG2 4.01Å; F38-V43 HydrophobicContact CB-CG2 3.77Å; S39-V43 PolarHBondContact O-N 2.75Å; E40-V43 PolarHBondContact O-N 3.05Å; V43-I46 PolarHBondContact O-N 3.41Å; V43-T47 HydrophobicContact CG1-CG2 4.44Å; V43-T47 WeakPolarHBondContact O-CB 3.49Å; V43-T47 WeakPolarHBondContact O-CG2 3.33Å; V43-T47 PolarHBondContact O-N 3Å; V43-T47 VanDerWaalsContact O-N 3.11Å; V43-T47 PolarHBondContact O-OG1 3.21Å
44	H	83.3	Confident	81.1	Confident	112 Å²	112	112.4 Å²	112.4	52%	0.519	59%	0.586	S	S	.	*	H	α-helix	trans	-61.9	-44.7	175.2	-163	105	0	111.3	E40 F42 I46 T47 Q48	E40-H44 WeakPolarHBondContact O-CB 3.42Å; E40-H44 PolarHBondContact O-N 3.17Å; F42-H44 VanDerWaalsContact C-N 3.31Å; F42-H44 PolarHBondContact O-N 3.45Å; H44-I46 VanDerWaalsContact C-N 3.35Å; H44-I46 PolarHBondContact O-N 2.89Å; H44-T47 PolarHBondContact O-N 3.03Å; H44-T47 PolarHBondContact O-OG1 3.08Å; H44-Q48 VanDerWaalsContact CD2-CG 3.43Å; H44-Q48 WeakPolarHBondContact CD2-CG 3.26Å; H44-Q48 WeakPolarHBondContact O-CG 3.27Å; H44-Q48 PolarHBondContact O-N 3.47Å; H44-Q48 VanDerWaalsContact O-N 3.12Å
45	F	84.4	Confident	81.2	Confident	151 Å²	151	115.5 Å²	115.5	66%	0.662	60%	0.597	S	S	*	*	H	α-helix	trans	-59.2	-41	178.4	174.8	-103	0	113.5	P41 F42	P41-F45 WeakPolarHBondContact O-CB 3.31Å; P41-F45 PolarHBondContact O-N 3.41Å; F42-F45 PolarHBondContact O-N 3.44Å
46	I	81.7	Confident	81.5	Confident	75 Å²	75	113.4 Å²	113.4	39%	0.385	58%	0.577	S	S	.	*	H	α-helix	trans	-78.9	-26.1	-177.7	-61.3	-65	0	112.7	L33 F42 V43 H44	L33-I46 HydrophobicContact CD1-CB 3.95Å; L33-I46 HydrophobicContact CD1-CG1 4.07Å; L33-I46 HydrophobicContact CD1-CG2 4.17Å; F42-I46 HydrophobicContact CD1-CG1 4.47Å; F42-I46 HydrophobicContact CE1-CG1 4.12Å; F42-I46 HydrophobicContact CE2-CD1 4.43Å; F42-I46 HydrophobicContact CE2-CG1 4.28Å; F42-I46 HydrophobicContact CZ-CD1 4.33Å; F42-I46 HydrophobicContact CZ-CG1 4.03Å; F42-I46 WeakPolarHBondContact O-CG1 3.49Å; F42-I46 PolarHBondContact O-N 2.96Å; F42-I46 VanDerWaalsContact O-N 3.11Å; V43-I46 PolarHBondContact O-N 3.41Å; H44-I46 VanDerWaalsContact C-N 3.35Å; H44-I46 PolarHBondContact O-N 2.89Å
47	T	81	Confident	81.6	Confident	74 Å²	74	116.2 Å²	116.2	45%	0.454	56%	0.56	S	S	.	*	H	α-helix	trans	-89	-14.7	-179.4	50.4	0	0	113.6	V43 H44 W49	V43-T47 HydrophobicContact CG1-CG2 4.44Å; V43-T47 WeakPolarHBondContact O-CB 3.49Å; V43-T47 WeakPolarHBondContact O-CG2 3.33Å; V43-T47 PolarHBondContact O-N 3Å; V43-T47 VanDerWaalsContact O-N 3.11Å; V43-T47 PolarHBondContact O-OG1 3.21Å; H44-T47 PolarHBondContact O-N 3.03Å; H44-T47 PolarHBondContact O-OG1 3.08Å; T47-W49 PolarHBondContact O-N 3.07Å
48	Q	71.9	Confident	81.3	Confident	124 Å²	124	113.3 Å²	113.3	58%	0.579	55%	0.548	S	S	*	.			trans	-88.4	87.5	168.7	-60.6	-71.3	-73.5	108.5	H44	H44-Q48 VanDerWaalsContact CD2-CG 3.43Å; H44-Q48 WeakPolarHBondContact CD2-CG 3.26Å; H44-Q48 WeakPolarHBondContact O-CG 3.27Å; H44-Q48 PolarHBondContact O-N 3.47Å; H44-Q48 VanDerWaalsContact O-N 3.12Å
49	W	60.1	Low	80.9	Confident	267 Å²	267	115.9 Å²	115.9	100%	1.011	56%	0.564	S	S	*	*			trans	-59	0	168.2	-80.3	96.8	0	112.3	S30 T47	S30-W49 PolarHBondContact OG-NE1 3.13Å; T47-W49 PolarHBondContact O-N 3.07Å

Retrieved 49 of 49 residues in 29.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).