A0A087X174_HUMAN Loading...

Interferon alpha inducible protein 27

AlphaFold DB , UniProt , Accession A0A087X174, Species HUMAN (Homo sapiens, Human), Gene IFI27, Length 112 aa.

						>A0A087X174_HUMAN|A0A087X174|IFI27
MEASALTSSAVTSVAKVVRVASGSAVVLPLVVAMAAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.8	Very low	35.1	Very low	225 Å²	225	101.8 Å²	101.8	100%	1.108	62%	0.624	S	S	*	*				0	-12.7	0	-112.1	82.3	162.1	0	0	114.3
2	E	33.2	Very low	35	Very low	157 Å²	157	100.8 Å²	100.8	73%	0.734	62%	0.617	S	S	*	*			trans	-80.4	-28.4	-171.4	-70.8	-77.5	86.6	0	0	115.8	S4 A5 L6	E2-S4 VanDerWaalsContact C-N 3.25Å; E2-S4 PolarHBondContact O-N 3.38Å; E2-A5 PolarHBondContact O-N 3.39Å; E2-L6 WeakPolarHBondContact O-CD1 3.36Å
3	A	30.3	Very low	35.4	Very low	79 Å²	79	99 Å²	99	65%	0.653	61%	0.612	S	S	*	*	H	α-helix	trans	-67.7	-22.1	-174.8	0	0	0	0	0	114.3
4	S	32.3	Very low	35.8	Very low	86 Å²	86	98.5 Å²	98.5	60%	0.601	61%	0.608	S	S	*	*	H	α-helix	trans	-78.8	-21.9	-176.8	-54	0	0	0	0	113.2	E2 T7 S8	E2-S4 VanDerWaalsContact C-N 3.25Å; E2-S4 PolarHBondContact O-N 3.38Å; S4-T7 WeakPolarHBondContact O-CG2 3.5Å; S4-S8 WeakPolarHBondContact O-CB 3.4Å; S4-S8 PolarHBondContact O-N 2.96Å
5	A	34.9	Very low	35.9	Very low	57 Å²	57	95.3 Å²	95.3	47%	0.471	60%	0.595	S	S	.	*	H	α-helix	trans	-80.6	-34.5	178.6	0	0	0	0	0	112.5	E2 S8 S9	E2-A5 PolarHBondContact O-N 3.39Å; A5-S8 PolarHBondContact O-N 3.2Å; A5-S9 PolarHBondContact O-N 3.08Å; A5-S9 VanDerWaalsContact O-N 3.08Å; A5-S9 PolarHBondContact O-OG 3.4Å
6	L	35.6	Very low	35.6	Very low	128 Å²	128	99.1 Å²	99.1	67%	0.67	60%	0.6	S	S	*	*	H	α-helix	trans	-69.2	-38.6	176.3	-75.1	117.7	0	0	0	112.1	E2 A10	E2-L6 WeakPolarHBondContact O-CD1 3.36Å; L6-A10 WeakPolarHBondContact O-CB 3.34Å; L6-A10 PolarHBondContact O-N 3.48Å
7	T	37.8	Very low	35.9	Very low	89 Å²	89	99.3 Å²	99.3	55%	0.546	60%	0.601	S	S	.	*	H	α-helix	trans	-69.4	-35.7	176.6	-158.7	0	0	0	0	111.9	S4 V11	S4-T7 WeakPolarHBondContact O-CG2 3.5Å; T7-V11 VanDerWaalsContact O-CB 3.31Å; T7-V11 WeakPolarHBondContact O-CB 3.3Å; T7-V11 VanDerWaalsContact O-CG2 3.22Å; T7-V11 WeakPolarHBondContact O-CG2 3.49Å; T7-V11 PolarHBondContact O-N 3.22Å
8	S	33.3	Very low	36.1	Very low	71 Å²	71	98.9 Å²	98.9	50%	0.497	60%	0.599	S	S	.	*	H	α-helix	trans	-70.7	-37.5	178.3	-159.6	0	0	0	0	112.8	S4 A5 T12	S4-S8 WeakPolarHBondContact O-CB 3.4Å; S4-S8 PolarHBondContact O-N 2.96Å; A5-S8 PolarHBondContact O-N 3.2Å; S8-T12 WeakPolarHBondContact O-CB 3.4Å; S8-T12 PolarHBondContact O-N 3.1Å; S8-T12 PolarHBondContact O-OG1 3.05Å
9	S	33.3	Very low	36.2	Very low	80 Å²	80	105.1 Å²	105.1	56%	0.559	61%	0.61	S	S	*	*	H	α-helix	trans	-71.9	-37.5	175.2	-65.1	0	0	0	0	112.6	A5 T12 S13	A5-S9 PolarHBondContact O-N 3.08Å; A5-S9 VanDerWaalsContact O-N 3.08Å; A5-S9 PolarHBondContact O-OG 3.4Å; S9-T12 PolarHBondContact O-N 3.26Å; S9-S13 PolarHBondContact O-N 2.8Å
10	A	39.8	Very low	36.3	Very low	56 Å²	56	105.2 Å²	105.2	46%	0.463	61%	0.612	S	S	.	*	H	α-helix	trans	-67.8	-42.1	174.7	0	0	0	0	0	112	L6 T12 S13 V14	L6-A10 WeakPolarHBondContact O-CB 3.34Å; L6-A10 PolarHBondContact O-N 3.48Å; A10-T12 VanDerWaalsContact C-N 3.33Å; A10-T12 PolarHBondContact O-N 3.12Å; A10-S13 PolarHBondContact O-N 2.96Å; A10-V14 WeakPolarHBondContact O-CB 3.46Å; A10-V14 VanDerWaalsContact O-CG2 3.29Å; A10-V14 WeakPolarHBondContact O-CG2 3.32Å; A10-V14 PolarHBondContact O-N 3.05Å
11	V	37.6	Very low	36.6	Very low	92 Å²	92	101.5 Å²	101.5	56%	0.558	59%	0.594	S	S	*	*	H	α-helix	trans	-63.5	-38.2	175.9	163	0	0	0	0	111.6	T7 V14 A15	T7-V11 VanDerWaalsContact O-CB 3.31Å; T7-V11 WeakPolarHBondContact O-CB 3.3Å; T7-V11 VanDerWaalsContact O-CG2 3.22Å; T7-V11 WeakPolarHBondContact O-CG2 3.49Å; T7-V11 PolarHBondContact O-N 3.22Å; V11-V14 PolarHBondContact O-N 3.04Å; V11-A15 VanDerWaalsContact O-CB 3.28Å; V11-A15 WeakPolarHBondContact O-CB 3.43Å; V11-A15 PolarHBondContact O-N 3.24Å
12	T	34.6	Very low	36.9	Very low	89 Å²	89	96 Å²	96	55%	0.546	58%	0.578	S	S	.	*	H	α-helix	trans	-70.4	-39.1	178.1	-57.9	0	0	0	0	112	S8 S9 A10 A15 K16	S8-T12 WeakPolarHBondContact O-CB 3.4Å; S8-T12 PolarHBondContact O-N 3.1Å; S8-T12 PolarHBondContact O-OG1 3.05Å; S9-T12 PolarHBondContact O-N 3.26Å; A10-T12 VanDerWaalsContact C-N 3.33Å; A10-T12 PolarHBondContact O-N 3.12Å; T12-A15 PolarHBondContact O-N 3.39Å; T12-K16 WeakPolarHBondContact O-CB 3.44Å; T12-K16 PolarHBondContact O-N 3.37Å
13	S	39.4	Very low	37.5	Very low	78 Å²	78	90.8 Å²	90.8	55%	0.545	57%	0.566	S	S	.	*	H	α-helix	trans	-66.6	-40.8	173	-83.8	0	0	0	0	112.7	S9 A10 K16 V17	S9-S13 PolarHBondContact O-N 2.8Å; A10-S13 PolarHBondContact O-N 2.96Å; S13-K16 PolarHBondContact O-N 3.44Å; S13-V17 WeakPolarHBondContact O-CB 3.22Å; S13-V17 WeakPolarHBondContact O-CG2 3.23Å; S13-V17 PolarHBondContact O-N 3.48Å
14	V	42	Very low	38.2	Very low	92 Å²	92	92.2 Å²	92.2	56%	0.558	57%	0.571	S	S	*	*	H	α-helix	trans	-64.8	-41	174.6	168.3	0	0	0	0	111	A10 V11 K16 V17 V18	A10-V14 WeakPolarHBondContact O-CB 3.46Å; A10-V14 VanDerWaalsContact O-CG2 3.29Å; A10-V14 WeakPolarHBondContact O-CG2 3.32Å; A10-V14 PolarHBondContact O-N 3.05Å; V11-V14 PolarHBondContact O-N 3.04Å; V14-K16 VanDerWaalsContact C-N 3.35Å; V14-K16 PolarHBondContact O-N 3.46Å; V14-V17 PolarHBondContact O-N 2.95Å; V14-V18 HydrophobicContact CG1-CG2 4.43Å; V14-V18 WeakPolarHBondContact O-CB 3.31Å; V14-V18 VanDerWaalsContact O-CG2 3.29Å; V14-V18 WeakPolarHBondContact O-CG2 3.31Å; V14-V18 PolarHBondContact O-N 2.91Å
15	A	37.3	Very low	38.7	Very low	50 Å²	50	92.1 Å²	92.1	41%	0.413	58%	0.576	S	S	.	*	H	α-helix	trans	-65	-37.7	175.7	0	0	0	0	0	112.2	V11 T12 R19	V11-A15 VanDerWaalsContact O-CB 3.28Å; V11-A15 WeakPolarHBondContact O-CB 3.43Å; V11-A15 PolarHBondContact O-N 3.24Å; T12-A15 PolarHBondContact O-N 3.39Å; A15-R19 VanDerWaalsContact O-CB 3.32Å; A15-R19 WeakPolarHBondContact O-CB 3.18Å; A15-R19 WeakPolarHBondContact O-CG 3.29Å; A15-R19 PolarHBondContact O-N 3.31Å
16	K	30.9	Very low	39	Very low	157 Å²	157	93 Å²	93	68%	0.683	58%	0.575	S	S	*	*	H	α-helix	trans	-70.2	-38.7	176	-156	175.9	-175.2	90	0	111.7	T12 S13 V14 R19 V20	T12-K16 WeakPolarHBondContact O-CB 3.44Å; T12-K16 PolarHBondContact O-N 3.37Å; S13-K16 PolarHBondContact O-N 3.44Å; V14-K16 VanDerWaalsContact C-N 3.35Å; V14-K16 PolarHBondContact O-N 3.46Å; K16-R19 PolarHBondContact O-N 2.89Å; K16-V20 VanDerWaalsContact O-CG2 3.29Å; K16-V20 WeakPolarHBondContact O-CG2 3.28Å; K16-V20 PolarHBondContact O-N 3.37Å
17	V	40.4	Very low	39.3	Very low	102 Å²	102	89.2 Å²	89.2	62%	0.618	56%	0.557	S	S	*	*	H	α-helix	trans	-63.3	-43.7	172.8	162.9	0	0	0	0	111.6	S13 V14 V20 A21	S13-V17 WeakPolarHBondContact O-CB 3.22Å; S13-V17 WeakPolarHBondContact O-CG2 3.23Å; S13-V17 PolarHBondContact O-N 3.48Å; V14-V17 PolarHBondContact O-N 2.95Å; V17-V20 PolarHBondContact O-N 2.83Å; V17-A21 WeakPolarHBondContact O-CB 3.45Å; V17-A21 PolarHBondContact O-N 2.89Å
18	V	38.6	Very low	39.6	Very low	93 Å²	93	91.2 Å²	91.2	56%	0.564	56%	0.564	S	S	*	*	H	α-helix	trans	-67.7	-37.2	177	166.1	0	0	0	0	111.8	V14 A21 S22	V14-V18 HydrophobicContact CG1-CG2 4.43Å; V14-V18 WeakPolarHBondContact O-CB 3.31Å; V14-V18 VanDerWaalsContact O-CG2 3.29Å; V14-V18 WeakPolarHBondContact O-CG2 3.31Å; V14-V18 PolarHBondContact O-N 2.91Å; V18-A21 PolarHBondContact O-N 2.85Å; V18-S22 PolarHBondContact O-N 3.36Å
19	R	38.5	Very low	40.1	Very low	215 Å²	215	91.3 Å²	91.3	81%	0.811	56%	0.563	S	S	*	*	H	α-helix	trans	-67.9	-33.2	174.2	-75.7	-75.3	-163.9	154.7	4.2	112.6	A15 K16	A15-R19 VanDerWaalsContact O-CB 3.32Å; A15-R19 WeakPolarHBondContact O-CB 3.18Å; A15-R19 WeakPolarHBondContact O-CG 3.29Å; A15-R19 PolarHBondContact O-N 3.31Å; K16-R19 PolarHBondContact O-N 2.89Å
20	V	39.4	Very low	40.6	Very low	107 Å²	107	92.7 Å²	92.7	65%	0.648	56%	0.563	S	S	*	*	H	α-helix	trans	-70.8	-33.3	171.6	169	0	0	0	0	111.3	K16 V17 S22 G23	K16-V20 VanDerWaalsContact O-CG2 3.29Å; K16-V20 WeakPolarHBondContact O-CG2 3.28Å; K16-V20 PolarHBondContact O-N 3.37Å; V17-V20 PolarHBondContact O-N 2.83Å; V20-S22 VanDerWaalsContact C-N 3.26Å; V20-S22 PolarHBondContact O-N 3.43Å; V20-G23 PolarHBondContact O-N 2.89Å
21	A	41.6	Very low	40.9	Very low	28 Å²	28	93.6 Å²	93.6	23%	0.231	56%	0.563	C	S	.	*	H	α-helix	trans	-72.4	-13.2	179.7	0	0	0	0	0	114.8	V17 V18 G23 V26	V17-A21 WeakPolarHBondContact O-CB 3.45Å; V17-A21 PolarHBondContact O-N 2.89Å; V18-A21 PolarHBondContact O-N 2.85Å; A21-G23 PolarHBondContact O-N 2.78Å; A21-V26 HydrophobicContact CB-CG2 4.26Å
22	S	43.9	Very low	41.3	Very low	111 Å²	111	93.9 Å²	93.9	78%	0.776	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.9	-8.7	175.4	-167.7	0	0	0	0	113.2	V18 V20	V18-S22 PolarHBondContact O-N 3.36Å; V20-S22 VanDerWaalsContact C-N 3.26Å; V20-S22 PolarHBondContact O-N 3.43Å
23	G	46.6	Very low	41.6	Very low	46 Å²	46	92 Å²	92	47%	0.474	56%	0.558	S	S	.	*	S	Bend	trans	-122.7	108.1	174.8	0	0	0	0	0	111.1	V20 A21	V20-G23 PolarHBondContact O-N 2.89Å; A21-G23 PolarHBondContact O-N 2.78Å
24	S	43.8	Very low	41.9	Very low	109 Å²	109	93.9 Å²	93.9	76%	0.762	56%	0.56	S	S	*	*	S	Bend	trans	75.1	121.4	158.5	-55.9	0	0	0	0	118.8	V26	S24-V26 VanDerWaalsContact C-N 3.31Å; S24-V26 PolarHBondContact O-N 2.93Å
25	A	43.7	Very low	42.3	Very low	84 Å²	84	92 Å²	92	69%	0.694	55%	0.554	S	S	*	*	S	Bend	trans	64.7	-13	152.3	0	0	0	0	0	120.8	P29	A25-P29 VanDerWaalsContact O-CD 3.23Å; A25-P29 WeakPolarHBondContact O-CD 3.28Å
26	V	40.5	Very low	42.4	Very low	76 Å²	76	91.8 Å²	91.8	46%	0.461	55%	0.553	S	S	.	*	S	Bend	trans	-93.9	-12.9	-177.9	-78	0	0	0	0	115.5	A21 S24 P29 L30	A21-V26 HydrophobicContact CB-CG2 4.26Å; S24-V26 VanDerWaalsContact C-N 3.31Å; S24-V26 PolarHBondContact O-N 2.93Å; V26-P29 WeakPolarHBondContact O-CD 3.32Å; V26-P29 WeakPolarHBondContact O-CG 3.31Å; V26-L30 VanDerWaalsContact O-CB 3.3Å; V26-L30 WeakPolarHBondContact O-CB 3.14Å; V26-L30 PolarHBondContact O-N 3.16Å
27	V	42.8	Very low	43	Very low	49 Å²	49	89 Å²	89	30%	0.297	55%	0.549	S	S	.	.	H	α-helix	trans	-70.6	-38.3	-178.2	-68.1	0	0	0	0	113.1	V31 F95	V27-V31 WeakPolarHBondContact O-CB 3.23Å; V27-V31 VanDerWaalsContact O-CG2 3.31Å; V27-V31 WeakPolarHBondContact O-CG2 3.28Å; V27-V31 PolarHBondContact O-N 3.39Å; V27-F95 HydrophobicContact CB-CE2 4.03Å; V27-F95 HydrophobicContact CB-CZ 3.92Å; V27-F95 HydrophobicContact CG1-CE2 3.65Å; V27-F95 HydrophobicContact CG1-CZ 4.09Å
28	L	44.2	Very low	43.2	Very low	130 Å²	130	87.5 Å²	87.5	68%	0.681	54%	0.54	S	S	*	.	H	α-helix	trans	-65	-51.3	176.9	-69.1	161.6	0	0	0	112.3	L30 V31 V32	L28-L30 VanDerWaalsContact C-N 3.28Å; L28-L30 PolarHBondContact O-N 2.95Å; L28-V31 PolarHBondContact O-N 2.87Å; L28-V32 WeakPolarHBondContact O-CB 3.29Å; L28-V32 WeakPolarHBondContact O-CG2 3.32Å; L28-V32 PolarHBondContact O-N 2.95Å
29	P	43.2	Very low	43.7	Very low	74 Å²	74	89.9 Å²	89.9	48%	0.481	55%	0.547	S	S	.	.	H	α-helix	trans	-66.8	-29	178.2	24.3	-33.4	0	0	0	112.8	A25 V26 A33	A25-P29 VanDerWaalsContact O-CD 3.23Å; A25-P29 WeakPolarHBondContact O-CD 3.28Å; V26-P29 WeakPolarHBondContact O-CD 3.32Å; V26-P29 WeakPolarHBondContact O-CG 3.31Å; P29-A33 VanDerWaalsContact O-CB 3.28Å; P29-A33 WeakPolarHBondContact O-CB 3.29Å; P29-A33 PolarHBondContact O-N 3.47Å
30	L	44.9	Very low	44	Very low	108 Å²	108	84.3 Å²	84.3	57%	0.565	54%	0.537	S	S	*	.	H	α-helix	trans	-72.5	-41.1	176.2	-175.5	60.3	0	0	0	112.4	V26 L28 A33 M34	V26-L30 VanDerWaalsContact O-CB 3.3Å; V26-L30 WeakPolarHBondContact O-CB 3.14Å; V26-L30 PolarHBondContact O-N 3.16Å; L28-L30 VanDerWaalsContact C-N 3.28Å; L28-L30 PolarHBondContact O-N 2.95Å; L30-A33 PolarHBondContact O-N 3.5Å; L30-M34 WeakPolarHBondContact O-CB 3.38Å; L30-M34 PolarHBondContact O-N 3.43Å
31	V	44.7	Very low	44.2	Very low	75 Å²	75	83.8 Å²	83.8	46%	0.455	53%	0.53	S	S	.	.	H	α-helix	trans	-64.8	-41.5	172.8	165.7	0	0	0	0	111	V27 L28 M34 A35 F95	V27-V31 WeakPolarHBondContact O-CB 3.23Å; V27-V31 VanDerWaalsContact O-CG2 3.31Å; V27-V31 WeakPolarHBondContact O-CG2 3.28Å; V27-V31 PolarHBondContact O-N 3.39Å; L28-V31 PolarHBondContact O-N 2.87Å; V31-M34 PolarHBondContact O-N 3.16Å; V31-A35 WeakPolarHBondContact O-CB 3.17Å; V31-A35 PolarHBondContact O-N 2.87Å; V31-F95 HydrophobicContact CG2-CE1 4.17Å
32	V	46.1	Very low	44.3	Very low	98 Å²	98	85.6 Å²	85.6	59%	0.594	54%	0.541	S	S	*	.	H	α-helix	trans	-64.5	-41.1	176	170.3	0	0	0	0	111.3	L28 M34 A35 A36	L28-V32 WeakPolarHBondContact O-CB 3.29Å; L28-V32 WeakPolarHBondContact O-CG2 3.32Å; L28-V32 PolarHBondContact O-N 2.95Å; V32-M34 VanDerWaalsContact C-N 3.35Å; V32-M34 PolarHBondContact O-N 3.31Å; V32-A35 PolarHBondContact O-N 3.46Å; V32-A36 WeakPolarHBondContact O-CB 3.39Å; V32-A36 PolarHBondContact O-N 3.37Å
33	A	42.2	Very low	44.3	Very low	50 Å²	50	84.7 Å²	84.7	41%	0.413	54%	0.54	S	S	.	.	H	α-helix	trans	-63.3	-40.2	173.6	0	0	0	0	0	111.9	P29 L30 A35 A36 V37	P29-A33 VanDerWaalsContact O-CB 3.28Å; P29-A33 WeakPolarHBondContact O-CB 3.29Å; P29-A33 PolarHBondContact O-N 3.47Å; L30-A33 PolarHBondContact O-N 3.5Å; A33-A35 VanDerWaalsContact C-N 3.28Å; A33-A35 PolarHBondContact O-N 2.88Å; A33-A36 PolarHBondContact O-N 2.96Å; A33-V37 VanDerWaalsContact O-CG2 3.31Å; A33-V37 WeakPolarHBondContact O-CG2 3.34Å; A33-V37 PolarHBondContact O-N 2.92Å
34	M	45.7	Very low	44	Very low	117 Å²	117	89.9 Å²	89.9	58%	0.576	55%	0.554	S	S	*	*	H	α-helix	trans	-69.8	-23.1	176.6	-153.3	100.1	75.8	0	0	113.3	L30 V31 V32 P38	L30-M34 WeakPolarHBondContact O-CB 3.38Å; L30-M34 PolarHBondContact O-N 3.43Å; V31-M34 PolarHBondContact O-N 3.16Å; V32-M34 VanDerWaalsContact C-N 3.35Å; V32-M34 PolarHBondContact O-N 3.31Å; M34-P38 WeakPolarHBondContact O-CD 3.3Å; M34-P38 VanDerWaalsContact O-CG 3.22Å; M34-P38 WeakPolarHBondContact O-CG 3.46Å
35	A	48.6	Very low	44.1	Very low	53 Å²	53	87.1 Å²	87.1	44%	0.438	54%	0.543	S	S	.	.	H	α-helix	trans	-85	-30.5	172	0	0	0	0	0	112.2	V31 V32 A33 P38 M39	V31-A35 WeakPolarHBondContact O-CB 3.17Å; V31-A35 PolarHBondContact O-N 2.87Å; V32-A35 PolarHBondContact O-N 3.46Å; A33-A35 VanDerWaalsContact C-N 3.28Å; A33-A35 PolarHBondContact O-N 2.88Å; A35-P38 WeakPolarHBondContact O-CD 3.18Å; A35-M39 WeakPolarHBondContact O-CG 3.48Å; A35-M39 PolarHBondContact O-N 3.5Å
36	A	40.8	Very low	44.1	Very low	46 Å²	46	89.9 Å²	89.9	38%	0.38	54%	0.539	S	S	.	.	H	α-helix	trans	-72.5	-36.2	176.9	0	0	0	0	0	112.5	V32 A33 M39 V40	V32-A36 WeakPolarHBondContact O-CB 3.39Å; V32-A36 PolarHBondContact O-N 3.37Å; A33-A36 PolarHBondContact O-N 2.96Å; A36-M39 PolarHBondContact O-N 3.31Å; A36-M39 VanDerWaalsContact O-N 3.16Å; A36-V40 VanDerWaalsContact O-CG2 3.32Å; A36-V40 WeakPolarHBondContact O-CG2 3.35Å; A36-V40 PolarHBondContact O-N 3.4Å
37	V	43.5	Very low	44.2	Very low	99 Å²	99	90.8 Å²	90.8	60%	0.6	55%	0.545	S	S	*	.	H	α-helix	trans	-59.6	-47.9	178.6	169.6	0	0	0	0	112.4	A33 M39 L41	A33-V37 VanDerWaalsContact O-CG2 3.31Å; A33-V37 WeakPolarHBondContact O-CG2 3.34Å; A33-V37 PolarHBondContact O-N 2.92Å; V37-M39 VanDerWaalsContact C-N 3.34Å; V37-M39 PolarHBondContact O-N 3.36Å; V37-L41 WeakPolarHBondContact O-CB 3.23Å; V37-L41 PolarHBondContact O-N 2.87Å
38	P	45.1	Very low	44.1	Very low	69 Å²	69	93.8 Å²	93.8	45%	0.448	58%	0.575	S	S	.	*	H	α-helix	trans	-62.7	-35.4	171.7	-22.6	30.8	0	0	0	113.5	M34 A35 L41 S42	M34-P38 WeakPolarHBondContact O-CD 3.3Å; M34-P38 VanDerWaalsContact O-CG 3.22Å; M34-P38 WeakPolarHBondContact O-CG 3.46Å; A35-P38 WeakPolarHBondContact O-CD 3.18Å; P38-L41 PolarHBondContact O-N 3.48Å; P38-S42 WeakPolarHBondContact O-CA 3.22Å; P38-S42 WeakPolarHBondContact O-CB 3.41Å; P38-S42 PolarHBondContact O-N 3.37Å
39	M	47.4	Very low	43.8	Very low	144 Å²	144	92 Å²	92	71%	0.709	58%	0.58	S	S	*	*	H	α-helix	trans	-71.3	-40.7	-179.8	-67.9	-107.4	-117.8	0	0	112	A35 A36 V37 L41 S42 A43	A35-M39 WeakPolarHBondContact O-CG 3.48Å; A35-M39 PolarHBondContact O-N 3.5Å; A36-M39 PolarHBondContact O-N 3.31Å; A36-M39 VanDerWaalsContact O-N 3.16Å; V37-M39 VanDerWaalsContact C-N 3.34Å; V37-M39 PolarHBondContact O-N 3.36Å; M39-L41 VanDerWaalsContact C-N 3.35Å; M39-S42 PolarHBondContact O-N 3.31Å; M39-A43 VanDerWaalsContact O-CB 3.29Å; M39-A43 WeakPolarHBondContact O-CB 3.4Å; M39-A43 PolarHBondContact O-N 2.95Å
40	V	46.2	Very low	43.5	Very low	97 Å²	97	90.6 Å²	90.6	59%	0.588	58%	0.578	S	S	*	*	H	α-helix	trans	-69.4	-36	174.2	175.8	0	0	0	0	110.6	A36 M44	A36-V40 VanDerWaalsContact O-CG2 3.32Å; A36-V40 WeakPolarHBondContact O-CG2 3.35Å; A36-V40 PolarHBondContact O-N 3.4Å; V40-M44 VanDerWaalsContact O-CB 3.23Å; V40-M44 WeakPolarHBondContact O-CB 3.49Å; V40-M44 VanDerWaalsContact O-CG 3.3Å; V40-M44 WeakPolarHBondContact O-CG 3.44Å; V40-M44 PolarHBondContact O-N 3.26Å
41	L	43.6	Very low	43.7	Very low	97 Å²	97	91.8 Å²	91.8	51%	0.508	58%	0.584	S	S	.	*	H	α-helix	trans	-72	-32.6	175.1	-172	60.8	0	0	0	113	V37 P38 M39 M44 G45 F46	V37-L41 WeakPolarHBondContact O-CB 3.23Å; V37-L41 PolarHBondContact O-N 2.87Å; P38-L41 PolarHBondContact O-N 3.48Å; M39-L41 VanDerWaalsContact C-N 3.35Å; L41-M44 CarbonylContact O-C 3.37Å; L41-M44 PolarHBondContact O-N 2.81Å; L41-G45 PolarHBondContact O-N 2.91Å; L41-F46 PolarHBondContact O-N 2.98Å
42	S	42.5	Very low	43.3	Very low	65 Å²	65	92.2 Å²	92.2	46%	0.455	60%	0.595	S	S	.	*	H	α-helix	trans	-77.1	-36.2	176.3	-163.7	0	0	0	0	111.4	P38 M39 M44 G45	P38-S42 WeakPolarHBondContact O-CA 3.22Å; P38-S42 WeakPolarHBondContact O-CB 3.41Å; P38-S42 PolarHBondContact O-N 3.37Å; M39-S42 PolarHBondContact O-N 3.31Å; S42-M44 VanDerWaalsContact C-N 3.29Å; S42-M44 PolarHBondContact O-N 2.81Å; S42-G45 PolarHBondContact O-N 3.35Å; S42-G45 VanDerWaalsContact O-N 3.16Å
43	A	44.4	Very low	43.2	Very low	92 Å²	92	92.7 Å²	92.7	76%	0.76	60%	0.603	S	S	*	*	H	α-helix	trans	-66.5	-30.6	167.2	0	0	0	0	0	112.4	M39 G45	M39-A43 VanDerWaalsContact O-CB 3.29Å; M39-A43 WeakPolarHBondContact O-CB 3.4Å; M39-A43 PolarHBondContact O-N 2.95Å; A43-G45 PolarHBondContact O-N 3.43Å
44	M	40.9	Very low	43.5	Very low	155 Å²	155	95.7 Å²	95.7	76%	0.764	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.3	19.2	170	-81.5	-88.9	-70.8	0	0	113.8	V40 L41 S42	V40-M44 VanDerWaalsContact O-CB 3.23Å; V40-M44 WeakPolarHBondContact O-CB 3.49Å; V40-M44 VanDerWaalsContact O-CG 3.3Å; V40-M44 WeakPolarHBondContact O-CG 3.44Å; V40-M44 PolarHBondContact O-N 3.26Å; L41-M44 CarbonylContact O-C 3.37Å; L41-M44 PolarHBondContact O-N 2.81Å; S42-M44 VanDerWaalsContact C-N 3.29Å; S42-M44 PolarHBondContact O-N 2.81Å
45	G	44.7	Very low	43.8	Very low	52 Å²	52	93.6 Å²	93.6	54%	0.536	62%	0.618	S	S	.	*	T	Hydrogen-bonded Turn	trans	91.6	18.7	161.3	0	0	0	0	0	117	L41 S42 A43	L41-G45 PolarHBondContact O-N 2.91Å; S42-G45 PolarHBondContact O-N 3.35Å; S42-G45 VanDerWaalsContact O-N 3.16Å; A43-G45 PolarHBondContact O-N 3.43Å
46	F	43.8	Very low	43.5	Very low	141 Å²	141	98.1 Å²	98.1	62%	0.618	63%	0.633	S	S	*	*			trans	-100	76.7	168.1	-105.3	-89.7	0	0	0	110.9	L41 I51	L41-F46 PolarHBondContact O-N 2.98Å; F46-I51 HydrophobicContact CD1-CD1 4.47Å; F46-I51 HydrophobicContact CD2-CD1 4.45Å; F46-I51 HydrophobicContact CE1-CD1 4.01Å; F46-I51 HydrophobicContact CE2-CD1 3.99Å; F46-I51 HydrophobicContact CZ-CD1 3.76Å
47	T	43.4	Very low	43.4	Very low	96 Å²	96	99.8 Å²	99.8	59%	0.589	65%	0.647	S	S	*	*			trans	-97.1	144.7	171.6	-175.7	0	0	0	0	111.3	A49 G50	T47-A49 PolarHBondContact O-N 2.91Å; T47-G50 PolarHBondContact O-N 3.2Å
48	A	40	Very low	43.2	Very low	112 Å²	112	98.1 Å²	98.1	93%	0.926	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66	4.7	-166.2	0	0	0	0	0	116.4
49	A	37.4	Very low	42.9	Very low	93 Å²	93	102.7 Å²	102.7	77%	0.769	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.4	5.1	178.7	0	0	0	0	0	113.8	T47	T47-A49 PolarHBondContact O-N 2.91Å
50	G	38.1	Very low	42.6	Very low	44 Å²	44	103 Å²	103	45%	0.454	66%	0.658	S	S	.	*			trans	108.2	153.3	179.7	0	0	0	0	0	111.3	T47 A52	T47-G50 PolarHBondContact O-N 3.2Å; G50-A52 PolarHBondContact O-N 2.8Å
51	I	48.5	Very low	42.3	Very low	132 Å²	132	105.1 Å²	105.1	68%	0.677	66%	0.663	S	S	*	*			trans	-59.9	74.6	157.5	-59.8	-68.1	0	0	0	106.6	F46 S53	F46-I51 HydrophobicContact CD1-CD1 4.47Å; F46-I51 HydrophobicContact CD2-CD1 4.45Å; F46-I51 HydrophobicContact CE1-CD1 4.01Å; F46-I51 HydrophobicContact CE2-CD1 3.99Å; F46-I51 HydrophobicContact CZ-CD1 3.76Å; I51-S53 VanDerWaalsContact C-N 3.29Å; I51-S53 PolarHBondContact O-N 3.37Å
52	A	36.8	Very low	42	Very low	85 Å²	85	104.6 Å²	104.6	70%	0.702	67%	0.667	S	S	*	*			trans	-84.2	86.2	177.1	0	0	0	0	0	106.5	G50	G50-A52 PolarHBondContact O-N 2.8Å
53	S	44.6	Very low	41.8	Very low	107 Å²	107	105 Å²	105	75%	0.748	67%	0.674	S	S	*	*	S	Bend	trans	52.9	103.9	146.7	-159.6	0	0	0	0	117.2	I51	I51-S53 VanDerWaalsContact C-N 3.29Å; I51-S53 PolarHBondContact O-N 3.37Å
54	S	48.5	Very low	41.5	Very low	113 Å²	113	104.4 Å²	104.4	79%	0.79	67%	0.669	S	S	*	*			trans	74.9	125.3	161.5	-140.7	0	0	0	0	114.1
55	S	50.3	Low	41.6	Very low	74 Å²	74	100.3 Å²	100.3	52%	0.517	66%	0.661	S	S	.	*	S	Bend	cis	-178.2	118.8	22.3	-173.9	0	0	0	0	109
56	I	42.3	Very low	41.6	Very low	148 Å²	148	104.9 Å²	104.9	76%	0.759	67%	0.671	S	S	*	*	S	Bend	trans	-166.1	-24.1	140.1	-104.9	169.2	0	0	0	108.6
57	A	39.6	Very low	41.6	Very low	80 Å²	80	102 Å²	102	66%	0.661	67%	0.673	S	S	*	*	S	Bend	trans	-69	-29.3	166.9	0	0	0	0	0	113.3	K59 M60 M61	A57-K59 VanDerWaalsContact C-N 3.34Å; A57-K59 PolarHBondContact O-N 2.94Å; A57-M60 PolarHBondContact O-N 3.38Å; A57-M61 WeakPolarHBondContact O-CB 3.35Å; A57-M61 PolarHBondContact O-N 3.25Å
58	A	38	Very low	41.5	Very low	64 Å²	64	104.9 Å²	104.9	53%	0.529	69%	0.685	S	S	.	*	T	Hydrogen-bonded Turn	trans	-66.5	-29.2	179.2	0	0	0	0	0	113.8
59	K	39.7	Very low	41.8	Very low	165 Å²	165	103 Å²	103	72%	0.717	68%	0.676	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.9	-9.6	179.2	-72.3	-177.9	74.3	-95	0	114.3	A57	A57-K59 VanDerWaalsContact C-N 3.34Å; A57-K59 PolarHBondContact O-N 2.94Å
60	M	41.5	Very low	42.3	Very low	151 Å²	151	102.8 Å²	102.8	74%	0.744	68%	0.683	S	S	*	*	T	Hydrogen-bonded Turn	trans	-109.6	-14.2	174.2	-79.2	-91.8	110.1	0	0	112.8	A57 S62	A57-M60 PolarHBondContact O-N 3.38Å; M60-S62 VanDerWaalsContact C-N 3.29Å
61	M	40.1	Very low	42.6	Very low	142 Å²	142	104.1 Å²	104.1	70%	0.7	70%	0.697	S	S	*	*	H	α-helix	trans	-85.9	0.4	164.4	-162.5	171.4	179.6	0	0	112.7	A57 A63	A57-M61 WeakPolarHBondContact O-CB 3.35Å; A57-M61 PolarHBondContact O-N 3.25Å; M61-A63 VanDerWaalsContact C-N 3.3Å
62	S	36.6	Very low	42.7	Very low	85 Å²	85	104.1 Å²	104.1	59%	0.594	70%	0.703	S	S	*	*	H	α-helix	trans	-81.9	-2.5	169.6	-169.2	0	0	0	0	113.8	M60	M60-S62 VanDerWaalsContact C-N 3.29Å
63	A	37.5	Very low	42.9	Very low	73 Å²	73	103.9 Å²	103.9	60%	0.603	70%	0.701	S	S	*	*	H	α-helix	trans	-116.9	-24.6	180	0	0	0	0	0	114.1	M61	M61-A63 VanDerWaalsContact C-N 3.3Å
64	A	38.2	Very low	42.9	Very low	80 Å²	80	105.3 Å²	105.3	66%	0.661	71%	0.711	S	S	*	*	H	α-helix	trans	-94.3	-13.4	-176.7	0	0	0	0	0	114.3
65	A	43.6	Very low	43	Very low	70 Å²	70	103.4 Å²	103.4	58%	0.579	71%	0.709	S	S	*	*	S	Bend	trans	-83.7	-12	179.5	0	0	0	0	0	114.7
66	I	45.7	Very low	42.8	Very low	148 Å²	148	102.2 Å²	102.2	76%	0.759	70%	0.701	S	S	*	*	S	Bend	trans	-98.4	-18.6	-171.7	-58.2	-180	0	0	0	113.2
67	A	42.2	Very low	42.9	Very low	79 Å²	79	101.1 Å²	101.1	65%	0.653	70%	0.696	S	S	*	*	S	Bend	trans	-105.2	-15.1	-170.9	0	0	0	0	0	117.1
68	N	43.1	Very low	43.1	Very low	157 Å²	157	102 Å²	102	84%	0.84	69%	0.693	S	S	*	*	S	Bend	trans	-142.4	69.4	178.7	-83.7	-64.7	0	0	0	111.9
69	G	45	Very low	43.3	Very low	72 Å²	72	101.9 Å²	101.9	74%	0.742	69%	0.692	S	S	*	*			trans	-45.4	137.3	-172.5	0	0	0	0	0	116.2
70	G	49	Very low	43.7	Very low	89 Å²	89	97.9 Å²	97.9	92%	0.918	68%	0.681	S	S	*	*	S	Bend	trans	62.1	83.7	147.7	0	0	0	0	0	116.6
71	G	44.8	Very low	44.1	Very low	72 Å²	72	96.1 Å²	96.1	74%	0.742	68%	0.675	S	S	*	*			trans	148.6	121.2	160	0	0	0	0	0	113.5	A73	G71-A73 PolarHBondContact O-N 2.95Å; G71-A73 VanDerWaalsContact O-N 3.12Å
72	V	48.7	Very low	44.6	Very low	133 Å²	133	96.3 Å²	96.3	81%	0.806	67%	0.674	S	S	*	*			trans	-50	115.1	172.2	178.3	0	0	0	0	109.9	S74	V72-S74 PolarHBondContact O-N 3.49Å
73	A	40.9	Very low	45.1	Very low	79 Å²	79	95.5 Å²	95.5	65%	0.653	67%	0.668	S	S	*	*			trans	-63.3	121.8	175.6	0	0	0	0	0	110.4	G71 G75 S76	G71-A73 PolarHBondContact O-N 2.95Å; G71-A73 VanDerWaalsContact O-N 3.12Å; A73-G75 PolarHBondContact O-N 2.92Å; A73-G75 VanDerWaalsContact O-N 3.1Å; A73-S76 PolarHBondContact O-N 2.99Å
74	S	45.1	Very low	45.6	Very low	137 Å²	137	97.1 Å²	97.1	96%	0.958	67%	0.666	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.8	108.6	169.4	-171.1	0	0	0	0	109.3	V72	V72-S74 PolarHBondContact O-N 3.49Å
75	G	50.9	Low	46.4	Very low	74 Å²	74	95.2 Å²	95.2	76%	0.763	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	130.4	2.7	-168	0	0	0	0	0	114.9	A73	A73-G75 PolarHBondContact O-N 2.92Å; A73-G75 VanDerWaalsContact O-N 3.1Å
76	S	45.4	Very low	46.6	Very low	49 Å²	49	95 Å²	95	34%	0.343	65%	0.653	S	S	.	*			trans	-57	142.6	-174.9	-177.7	0	0	0	0	116	A73 V78 A79	A73-S76 PolarHBondContact O-N 2.99Å; S76-V78 PolarHBondContact O-N 3.42Å; S76-A79 PolarHBondContact O-N 3.24Å
77	L	45.2	Very low	46.9	Very low	125 Å²	125	92.3 Å²	92.3	65%	0.654	64%	0.643	S	S	*	*	H	α-helix	trans	-21.4	-32.1	161	178	58.9	0	0	0	116.9	T80 L81	L77-T80 PolarHBondContact O-N 3.26Å; L77-L81 HydrophobicContact CD1-CD1 4.32Å; L77-L81 WeakPolarHBondContact O-CB 3.22Å; L77-L81 PolarHBondContact O-N 3.44Å
78	V	43.2	Very low	47.5	Very low	98 Å²	98	90.2 Å²	90.2	59%	0.594	63%	0.629	S	S	*	*	H	α-helix	trans	-62.8	-40.7	175.8	179.9	0	0	0	0	112.4	S76 L81 Q82	S76-V78 PolarHBondContact O-N 3.42Å; V78-L81 PolarHBondContact O-N 2.88Å; V78-Q82 VanDerWaalsContact O-CB 3.28Å; V78-Q82 WeakPolarHBondContact O-CB 3.43Å; V78-Q82 PolarHBondContact O-N 2.87Å
79	A	43.5	Very low	47.9	Very low	62 Å²	62	88.1 Å²	88.1	51%	0.512	62%	0.618	S	S	.	*	H	α-helix	trans	-69.3	-34.5	178.7	0	0	0	0	0	112.2	S76 S83	S76-A79 PolarHBondContact O-N 3.24Å; A79-S83 VanDerWaalsContact O-CB 3.23Å; A79-S83 WeakPolarHBondContact O-CB 3.48Å; A79-S83 PolarHBondContact O-N 3.04Å
80	T	48.4	Very low	48.3	Very low	80 Å²	80	87.5 Å²	87.5	49%	0.491	60%	0.602	S	S	.	*	H	α-helix	trans	-71.2	-39.9	173.5	-44.7	0	0	0	0	111.2	L77 S83 L84	L77-T80 PolarHBondContact O-N 3.26Å; T80-S83 PolarHBondContact O-N 3.44Å; T80-L84 HydrophobicContact CG2-CD1 4.06Å; T80-L84 HydrophobicContact CG2-CG 4.41Å; T80-L84 VanDerWaalsContact O-CB 3.31Å; T80-L84 WeakPolarHBondContact O-CB 2.84Å; T80-L84 WeakPolarHBondContact O-CG 3.15Å; T80-L84 PolarHBondContact O-N 3.41Å
81	L	48.3	Very low	48.8	Very low	115 Å²	115	85.1 Å²	85.1	60%	0.602	58%	0.577	S	S	*	*	H	α-helix	trans	-67.6	-34.9	174.5	-124.1	67.6	0	0	0	112.5	L77 V78 G85	L77-L81 HydrophobicContact CD1-CD1 4.32Å; L77-L81 WeakPolarHBondContact O-CB 3.22Å; L77-L81 PolarHBondContact O-N 3.44Å; V78-L81 PolarHBondContact O-N 2.88Å; L81-G85 WeakPolarHBondContact O-CA 3.29Å; L81-G85 PolarHBondContact O-N 2.91Å
82	Q	51.3	Low	49.3	Very low	145 Å²	145	85.4 Å²	85.4	68%	0.678	56%	0.561	S	S	*	*	H	α-helix	trans	-73.7	-35.5	175.2	-152.7	179.3	-11.7	0	0	111.3	V78 A86	V78-Q82 VanDerWaalsContact O-CB 3.28Å; V78-Q82 WeakPolarHBondContact O-CB 3.43Å; V78-Q82 PolarHBondContact O-N 2.87Å; Q82-A86 WeakPolarHBondContact O-CB 3.02Å; Q82-A86 PolarHBondContact O-N 2.75Å
83	S	47.9	Very low	49.6	Very low	69 Å²	69	82.9 Å²	82.9	48%	0.483	55%	0.546	S	S	.	.	H	α-helix	trans	-66.7	-50.1	173.2	-171.6	0	0	0	0	111.3	A79 T80 G85 A86 T87	A79-S83 VanDerWaalsContact O-CB 3.23Å; A79-S83 WeakPolarHBondContact O-CB 3.48Å; A79-S83 PolarHBondContact O-N 3.04Å; T80-S83 PolarHBondContact O-N 3.44Å; S83-G85 VanDerWaalsContact C-N 3.32Å; S83-G85 PolarHBondContact O-N 2.68Å; S83-A86 PolarHBondContact O-N 3.45Å; S83-T87 WeakPolarHBondContact O-CB 3.31Å; S83-T87 PolarHBondContact O-N 3.07Å; S83-T87 PolarHBondContact O-OG1 3.31Å
84	L	48	Very low	50.5	Low	107 Å²	107	86.1 Å²	86.1	56%	0.56	55%	0.546	S	S	*	.	H	α-helix	trans	-65	-34	175	-66.9	171.9	0	0	0	112.5	T80 G88	T80-L84 HydrophobicContact CG2-CD1 4.06Å; T80-L84 HydrophobicContact CG2-CG 4.41Å; T80-L84 VanDerWaalsContact O-CB 3.31Å; T80-L84 WeakPolarHBondContact O-CB 2.84Å; T80-L84 WeakPolarHBondContact O-CG 3.15Å; T80-L84 PolarHBondContact O-N 3.41Å; L84-G88 WeakPolarHBondContact O-CA 3.3Å; L84-G88 PolarHBondContact O-N 3.39Å
85	G	54	Low	51.3	Low	39 Å²	39	83.7 Å²	83.7	40%	0.402	52%	0.518	S	S	.	.	H	α-helix	trans	-66.7	-43.3	175.7	0	0	0	0	0	112.4	L81 S83 L89	L81-G85 WeakPolarHBondContact O-CA 3.29Å; L81-G85 PolarHBondContact O-N 2.91Å; S83-G85 VanDerWaalsContact C-N 3.32Å; S83-G85 PolarHBondContact O-N 2.68Å; G85-L89 WeakPolarHBondContact O-CB 3.4Å; G85-L89 PolarHBondContact O-N 3.45Å
86	A	47.9	Very low	52	Low	67 Å²	67	84.1 Å²	84.1	55%	0.554	50%	0.502	S	S	*	.	H	α-helix	trans	-78.1	-41.1	179.4	0	0	0	0	0	112.8	Q82 S83 S90	Q82-A86 WeakPolarHBondContact O-CB 3.02Å; Q82-A86 PolarHBondContact O-N 2.75Å; S83-A86 PolarHBondContact O-N 3.45Å; A86-S90 WeakPolarHBondContact O-CB 3.48Å; A86-S90 PolarHBondContact O-N 3.01Å
87	T	53	Low	53.2	Low	90 Å²	90	87.5 Å²	87.5	55%	0.552	52%	0.516	S	S	*	.	H	α-helix	trans	-82.9	-35.2	-178.7	61	0	0	0	0	112.9	S83 G91	S83-T87 WeakPolarHBondContact O-CB 3.31Å; S83-T87 PolarHBondContact O-N 3.07Å; S83-T87 PolarHBondContact O-OG1 3.31Å; T87-G91 PolarHBondContact O-N 2.9Å
88	G	53.2	Low	54.6	Low	36 Å²	36	83.7 Å²	83.7	37%	0.371	51%	0.506	S	S	.	.	H	α-helix	trans	-72	-42.2	177	0	0	0	0	0	112.5	L84 L92	L84-G88 WeakPolarHBondContact O-CA 3.3Å; L84-G88 PolarHBondContact O-N 3.39Å; G88-L92 WeakPolarHBondContact O-CB 3.43Å; G88-L92 PolarHBondContact O-N 3.27Å
89	L	52.3	Low	55.9	Low	113 Å²	113	81.6 Å²	81.6	59%	0.592	50%	0.496	S	S	*	.	H	α-helix	trans	-68.8	-41.9	175.3	-167.8	67.6	0	0	0	111.3	G85 G91 L92 T93	G85-L89 WeakPolarHBondContact O-CB 3.4Å; G85-L89 PolarHBondContact O-N 3.45Å; L89-G91 PolarHBondContact O-N 2.84Å; L89-L92 PolarHBondContact O-N 2.92Å; L89-T93 WeakPolarHBondContact O-CB 3.13Å; L89-T93 PolarHBondContact O-N 2.98Å; L89-T93 PolarHBondContact O-OG1 3.48Å
90	S	53.7	Low	57.3	Low	59 Å²	59	82.9 Å²	82.9	41%	0.413	49%	0.493	S	S	.	.	H	α-helix	trans	-66.6	-36.6	177.4	-162.8	0	0	0	0	112.6	A86 K94	A86-S90 WeakPolarHBondContact O-CB 3.48Å; A86-S90 PolarHBondContact O-N 3.01Å; S90-K94 WeakPolarHBondContact O-CB 3.34Å; S90-K94 VanDerWaalsContact O-CG 3.3Å; S90-K94 WeakPolarHBondContact O-CG 2.99Å; S90-K94 PolarHBondContact O-N 3.22Å
91	G	58.3	Low	58.5	Low	39 Å²	39	80.8 Å²	80.8	40%	0.402	49%	0.487	S	S	.	.	H	α-helix	trans	-64	-44.2	172.2	0	0	0	0	0	112.4	T87 L89 K94 F95	T87-G91 PolarHBondContact O-N 2.9Å; L89-G91 PolarHBondContact O-N 2.84Å; G91-K94 PolarHBondContact O-N 3.29Å; G91-F95 VanDerWaalsContact O-CB 3.31Å; G91-F95 WeakPolarHBondContact O-CB 3.31Å; G91-F95 PolarHBondContact O-N 2.98Å
92	L	55.8	Low	59.4	Low	77 Å²	77	79.1 Å²	79.1	40%	0.403	49%	0.485	S	S	.	.	H	α-helix	trans	-66	-43.2	176.6	-176.6	61.6	0	0	0	112.1	G88 L89 K94 F95 I96	G88-L92 WeakPolarHBondContact O-CB 3.43Å; G88-L92 PolarHBondContact O-N 3.27Å; L89-L92 PolarHBondContact O-N 2.92Å; L92-K94 PolarHBondContact O-N 3.43Å; L92-F95 PolarHBondContact O-N 3.47Å; L92-I96 HydrophobicContact CD1-CD1 3.92Å; L92-I96 HydrophobicContact CD1-CG1 4.16Å; L92-I96 HydrophobicContact CD2-CD1 4.46Å; L92-I96 HydrophobicContact CG-CD1 3.78Å; L92-I96 HydrophobicContact CG-CG1 4.41Å; L92-I96 WeakPolarHBondContact O-CB 3.11Å; L92-I96 VanDerWaalsContact O-CG1 3.28Å; L92-I96 WeakPolarHBondContact O-CG1 3.31Å; L92-I96 PolarHBondContact O-N 3.22Å
93	T	54.3	Low	60.1	Low	80 Å²	80	75 Å²	75	49%	0.491	48%	0.476	S	S	.	.	H	α-helix	trans	-62.4	-42.6	176.3	-54.7	0	0	0	0	111.3	L89 F95 L97	L89-T93 WeakPolarHBondContact O-CB 3.13Å; L89-T93 PolarHBondContact O-N 2.98Å; L89-T93 PolarHBondContact O-OG1 3.48Å; T93-F95 VanDerWaalsContact C-N 3.34Å; T93-L97 WeakPolarHBondContact O-CB 3.43Å; T93-L97 PolarHBondContact O-N 2.81Å
94	K	61	Low	61.2	Low	148 Å²	148	76.1 Å²	76.1	64%	0.643	48%	0.476	S	S	*	.	H	α-helix	trans	-66.2	-35.8	175.3	-75	173.7	178.5	-72.5	0	112.3	S90 G91 L92 G98	S90-K94 WeakPolarHBondContact O-CB 3.34Å; S90-K94 VanDerWaalsContact O-CG 3.3Å; S90-K94 WeakPolarHBondContact O-CG 2.99Å; S90-K94 PolarHBondContact O-N 3.22Å; G91-K94 PolarHBondContact O-N 3.29Å; L92-K94 PolarHBondContact O-N 3.43Å; K94-G98 WeakPolarHBondContact O-CA 3.28Å; K94-G98 PolarHBondContact O-N 3.47Å
95	F	62.1	Low	62.2	Low	85 Å²	85	73.7 Å²	73.7	37%	0.373	47%	0.471	S	S	.	.	H	α-helix	trans	-69.6	-44.2	176.7	-179.5	-100.5	0	0	0	112.6	V27 V31 G91 L92 T93 G98 S99	V27-F95 HydrophobicContact CB-CE2 4.03Å; V27-F95 HydrophobicContact CB-CZ 3.92Å; V27-F95 HydrophobicContact CG1-CE2 3.65Å; V27-F95 HydrophobicContact CG1-CZ 4.09Å; V31-F95 HydrophobicContact CG2-CE1 4.17Å; G91-F95 VanDerWaalsContact O-CB 3.31Å; G91-F95 WeakPolarHBondContact O-CB 3.31Å; G91-F95 PolarHBondContact O-N 2.98Å; L92-F95 PolarHBondContact O-N 3.47Å; T93-F95 VanDerWaalsContact C-N 3.34Å; F95-G98 PolarHBondContact O-N 2.87Å; F95-S99 VanDerWaalsContact O-CB 3.31Å; F95-S99 WeakPolarHBondContact O-CB 3.45Å; F95-S99 PolarHBondContact O-N 2.83Å; F95-S99 PolarHBondContact O-OG 2.84Å
96	I	65.4	Low	62.6	Low	84 Å²	84	74.7 Å²	74.7	43%	0.431	48%	0.476	S	S	.	.	H	α-helix	trans	-65.5	-48.3	175.8	-68.6	169.2	0	0	0	109.9	L92 G98 S99 I100	L92-I96 HydrophobicContact CD1-CD1 3.92Å; L92-I96 HydrophobicContact CD1-CG1 4.16Å; L92-I96 HydrophobicContact CD2-CD1 4.46Å; L92-I96 HydrophobicContact CG-CD1 3.78Å; L92-I96 HydrophobicContact CG-CG1 4.41Å; L92-I96 WeakPolarHBondContact O-CB 3.11Å; L92-I96 VanDerWaalsContact O-CG1 3.28Å; L92-I96 WeakPolarHBondContact O-CG1 3.31Å; L92-I96 PolarHBondContact O-N 3.22Å; I96-G98 VanDerWaalsContact C-N 3.31Å; I96-G98 PolarHBondContact O-N 2.81Å; I96-S99 PolarHBondContact O-N 3.22Å; I96-I100 HydrophobicContact CG2-CD1 3.64Å; I96-I100 HydrophobicContact CG2-CG1 4.45Å; I96-I100 WeakPolarHBondContact O-CB 3.27Å; I96-I100 VanDerWaalsContact O-CG1 3.28Å; I96-I100 WeakPolarHBondContact O-CG1 3.2Å; I96-I100 PolarHBondContact O-N 2.9Å
97	L	70.8	Confident	63.4	Low	120 Å²	120	75.7 Å²	75.7	63%	0.628	48%	0.475	S	S	*	.	H	α-helix	trans	-64.6	-37.3	178.5	-173	60.2	0	0	0	111.7	T93 G101	T93-L97 WeakPolarHBondContact O-CB 3.43Å; T93-L97 PolarHBondContact O-N 2.81Å; L97-G101 PolarHBondContact O-N 3.4Å
98	G	73.3	Confident	64.3	Low	44 Å²	44	76.5 Å²	76.5	45%	0.454	47%	0.474	S	S	.	.	H	α-helix	trans	-67.3	-38.8	173.6	0	0	0	0	0	112.9	K94 F95 I96 S102	K94-G98 WeakPolarHBondContact O-CA 3.28Å; K94-G98 PolarHBondContact O-N 3.47Å; F95-G98 PolarHBondContact O-N 2.87Å; I96-G98 VanDerWaalsContact C-N 3.31Å; I96-G98 PolarHBondContact O-N 2.81Å; G98-S102 VanDerWaalsContact O-CB 3.24Å; G98-S102 WeakPolarHBondContact O-CB 3.26Å; G98-S102 PolarHBondContact O-N 2.9Å
99	S	70.6	Confident	64.8	Low	54 Å²	54	78 Å²	78	38%	0.378	48%	0.483	S	S	.	.	H	α-helix	trans	-68.2	-44.7	176.7	-63	0	0	0	0	111.7	F95 I96 S102 A103	F95-S99 VanDerWaalsContact O-CB 3.31Å; F95-S99 WeakPolarHBondContact O-CB 3.45Å; F95-S99 PolarHBondContact O-N 2.83Å; F95-S99 PolarHBondContact O-OG 2.84Å; I96-S99 PolarHBondContact O-N 3.22Å; S99-S102 PolarHBondContact O-N 2.84Å; S99-A103 WeakPolarHBondContact O-CB 3.48Å; S99-A103 PolarHBondContact O-N 2.94Å
100	I	73.4	Confident	64.7	Low	89 Å²	89	82.3 Å²	82.3	46%	0.456	49%	0.492	S	S	.	.	H	α-helix	trans	-65.7	-45	176.1	-65.9	166.4	0	0	0	110	I96 S102 A103 I104	I96-I100 HydrophobicContact CG2-CD1 3.64Å; I96-I100 HydrophobicContact CG2-CG1 4.45Å; I96-I100 WeakPolarHBondContact O-CB 3.27Å; I96-I100 VanDerWaalsContact O-CG1 3.28Å; I96-I100 WeakPolarHBondContact O-CG1 3.2Å; I96-I100 PolarHBondContact O-N 2.9Å; I100-S102 VanDerWaalsContact C-N 3.31Å; I100-S102 PolarHBondContact O-N 3.24Å; I100-A103 PolarHBondContact O-N 2.89Å; I100-I104 HydrophobicContact CG2-CD1 3.65Å; I100-I104 HydrophobicContact CG2-CG1 4.4Å; I100-I104 VanDerWaalsContact O-CG1 3.26Å; I100-I104 WeakPolarHBondContact O-CG1 3.24Å; I100-I104 PolarHBondContact O-N 2.84Å
101	G	73.5	Confident	64.6	Low	36 Å²	36	87.6 Å²	87.6	37%	0.371	51%	0.508	S	S	.	.	H	α-helix	trans	-59.7	-40.3	175.5	0	0	0	0	0	112.6	L97 A105	L97-G101 PolarHBondContact O-N 3.4Å; G101-A105 WeakPolarHBondContact O-CB 3.43Å; G101-A105 PolarHBondContact O-N 3.38Å
102	S	67.1	Low	63.9	Low	80 Å²	80	98.4 Å²	98.4	56%	0.559	54%	0.538	S	S	*	.	H	α-helix	trans	-68.8	-38.7	175.9	-171.8	0	0	0	0	112.5	G98 S99 I100 A106	G98-S102 VanDerWaalsContact O-CB 3.24Å; G98-S102 WeakPolarHBondContact O-CB 3.26Å; G98-S102 PolarHBondContact O-N 2.9Å; S99-S102 PolarHBondContact O-N 2.84Å; I100-S102 VanDerWaalsContact C-N 3.31Å; I100-S102 PolarHBondContact O-N 3.24Å; S102-A106 VanDerWaalsContact O-CB 3.27Å; S102-A106 WeakPolarHBondContact O-CB 3.28Å; S102-A106 PolarHBondContact O-N 2.92Å
103	A	66.3	Low	64.3	Low	59 Å²	59	99.5 Å²	99.5	49%	0.488	55%	0.545	S	S	.	.	H	α-helix	trans	-66.8	-42.4	177.4	0	0	0	0	0	111.4	S99 I100 A106 V107	S99-A103 WeakPolarHBondContact O-CB 3.48Å; S99-A103 PolarHBondContact O-N 2.94Å; I100-A103 PolarHBondContact O-N 2.89Å; A103-A106 PolarHBondContact O-N 3.15Å; A103-V107 WeakPolarHBondContact O-CG2 3.29Å; A103-V107 PolarHBondContact O-N 2.83Å
104	I	71.8	Confident	64.9	Low	93 Å²	93	100.5 Å²	100.5	48%	0.477	55%	0.548	S	S	.	.	H	α-helix	trans	-66.5	-44.6	176.3	-65.2	166.5	0	0	0	110.3	I100 A106 V107 I108	I100-I104 HydrophobicContact CG2-CD1 3.65Å; I100-I104 HydrophobicContact CG2-CG1 4.4Å; I100-I104 VanDerWaalsContact O-CG1 3.26Å; I100-I104 WeakPolarHBondContact O-CG1 3.24Å; I100-I104 PolarHBondContact O-N 2.84Å; I104-A106 VanDerWaalsContact C-N 3.32Å; I104-A106 PolarHBondContact O-N 3.03Å; I104-V107 PolarHBondContact O-N 3.25Å; I104-I108 HydrophobicContact CG2-CD1 3.67Å; I104-I108 HydrophobicContact CG2-CG1 4.37Å; I104-I108 VanDerWaalsContact O-CG1 3.29Å; I104-I108 WeakPolarHBondContact O-CG1 3.18Å; I104-I108 PolarHBondContact O-N 3.42Å
105	A	68.7	Low	65.1	Low	56 Å²	56	97.8 Å²	97.8	46%	0.463	54%	0.542	S	S	.	.	H	α-helix	trans	-61.8	-39.4	176.5	0	0	0	0	0	112.1	G101 I108 A109	G101-A105 WeakPolarHBondContact O-CB 3.43Å; G101-A105 PolarHBondContact O-N 3.38Å; A105-I108 PolarHBondContact O-N 2.9Å; A105-A109 WeakPolarHBondContact O-CB 3.5Å; A105-A109 PolarHBondContact O-N 3.42Å
106	A	62.8	Low	65.2	Low	60 Å²	60	98.6 Å²	98.6	50%	0.496	55%	0.552	S	S	.	*	H	α-helix	trans	-66.4	-38.2	175.8	0	0	0	0	0	112.3	S102 A103 I104 R110	S102-A106 VanDerWaalsContact O-CB 3.27Å; S102-A106 WeakPolarHBondContact O-CB 3.28Å; S102-A106 PolarHBondContact O-N 2.92Å; A103-A106 PolarHBondContact O-N 3.15Å; I104-A106 VanDerWaalsContact C-N 3.32Å; I104-A106 PolarHBondContact O-N 3.03Å; A106-R110 VanDerWaalsContact O-CB 3.24Å; A106-R110 WeakPolarHBondContact O-CB 3.24Å; A106-R110 PolarHBondContact O-N 3.42Å
107	V	64.9	Low	65.2	Low	87 Å²	87	99.5 Å²	99.5	53%	0.527	56%	0.56	S	S	.	*	H	α-helix	trans	-65.7	-45.7	174	166.8	0	0	0	0	110.8	A103 I104 R110 F111	A103-V107 WeakPolarHBondContact O-CG2 3.29Å; A103-V107 PolarHBondContact O-N 2.83Å; I104-V107 PolarHBondContact O-N 3.25Å; V107-R110 WeakPolarHBondContact O-CB 3.4Å; V107-R110 PolarHBondContact O-N 3.23Å; V107-R110 VanDerWaalsContact O-N 3.15Å; V107-F111 HydrophobicContact CG1-CD2 4.36Å; V107-F111 WeakPolarHBondContact O-CD2 3.39Å; V107-F111 PolarHBondContact O-N 3.34Å
108	I	70.5	Confident	64.9	Low	107 Å²	107	98.1 Å²	98.1	55%	0.549	56%	0.555	S	S	.	*	H	α-helix	trans	-64.3	-44.2	178.7	-66.4	167.3	0	0	0	110.8	I104 A105 R110 F111 Y112	I104-I108 HydrophobicContact CG2-CD1 3.67Å; I104-I108 HydrophobicContact CG2-CG1 4.37Å; I104-I108 VanDerWaalsContact O-CG1 3.29Å; I104-I108 WeakPolarHBondContact O-CG1 3.18Å; I104-I108 PolarHBondContact O-N 3.42Å; A105-I108 PolarHBondContact O-N 2.9Å; I108-R110 PolarHBondContact O-N 3.01Å; I108-F111 PolarHBondContact O-N 3.39Å; I108-Y112 PolarHBondContact O-N 3.05Å
109	A	63.4	Low	64.3	Low	67 Å²	67	102 Å²	102	55%	0.554	56%	0.563	S	S	*	*	H	α-helix	trans	-66	-19.3	176	0	0	0	0	0	113.3	A105 F111	A105-A109 WeakPolarHBondContact O-CB 3.5Å; A105-A109 PolarHBondContact O-N 3.42Å; A109-F111 VanDerWaalsContact C-N 3.32Å
110	R	49.9	Very low	63.8	Low	204 Å²	204	105.7 Å²	105.7	77%	0.77	58%	0.577	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.5	-9.7	174.9	-166.9	-104.1	168.3	148.2	-0.9	112.7	A106 V107 I108	A106-R110 VanDerWaalsContact O-CB 3.24Å; A106-R110 WeakPolarHBondContact O-CB 3.24Å; A106-R110 PolarHBondContact O-N 3.42Å; V107-R110 WeakPolarHBondContact O-CB 3.4Å; V107-R110 PolarHBondContact O-N 3.23Å; V107-R110 VanDerWaalsContact O-N 3.15Å; I108-R110 PolarHBondContact O-N 3.01Å
111	F	52	Low	63	Low	170 Å²	170	107.1 Å²	107.1	75%	0.746	59%	0.587	S	S	*	*			trans	-110.6	2.3	177.9	-87.7	-80.5	0	0	0	113.6	V107 I108 A109	V107-F111 HydrophobicContact CG1-CD2 4.36Å; V107-F111 WeakPolarHBondContact O-CD2 3.39Å; V107-F111 PolarHBondContact O-N 3.34Å; I108-F111 PolarHBondContact O-N 3.39Å; A109-F111 VanDerWaalsContact C-N 3.32Å
112	Y	44.5	Very low	62	Low	266 Å²	266	113.5 Å²	113.5	100%	1.043	61%	0.606	S	S	*	*			trans	-116.2	0	173.8	-149.8	-84.5	0	0	0	109.3	I108	I108-Y112 PolarHBondContact O-N 3.05Å

Retrieved 112 of 112 residues in 166.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).