A0A087X1A3_HUMAN Loading...

Rho GTPase activating protein 45

AlphaFold DB , UniProt , Accession A0A087X1A3, Species HUMAN (Homo sapiens, Human), Gene ARHGAP45, Length 78 aa.

						>A0A087X1A3_HUMAN|A0A087X1A3|ARHGAP45
GRQDGSESEAVAVALAGRLRELLRDLPPENRASLQYLLRHLRRPASSRLSSSTTAWSSRRSRRRPPGARTSHPTSELR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	G	53.2	Low	67.4	Low	115 Å²	115	112.5 Å²	112.5	100%	1.186	66%	0.661	S	S	*	*				0	69.7	0	0	0	0	0	0	112.9
2	R	54.3	Low	68.6	Low	235 Å²	235	107.5 Å²	107.5	89%	0.887	64%	0.642	S	S	*	*			trans	-130	-2.2	162.8	-72.9	-165.9	-155.9	144.8	4.2	112.6
3	Q	56.6	Low	69.8	Low	162 Å²	162	106.8 Å²	106.8	76%	0.757	64%	0.639	S	S	*	*	H	α-helix	trans	-81.8	-30.8	-176.8	-70.7	175.4	-1.1	0	0	111.6	G5 S6 E7	Q3-G5 VanDerWaalsContact C-N 3.26Å; Q3-G5 PolarHBondContact O-N 2.75Å; Q3-S6 PolarHBondContact O-N 3.29Å; Q3-E7 WeakPolarHBondContact O-CB 3.22Å; Q3-E7 PolarHBondContact O-N 3.11Å
4	D	59.6	Low	71.2	Confident	115 Å²	115	103.9 Å²	103.9	62%	0.615	63%	0.632	S	S	*	*	H	α-helix	trans	-62.7	-31.2	-178.5	-48.9	-61.7	0	0	0	113.1	S8	D4-S8 WeakPolarHBondContact O-CB 3.44Å; D4-S8 PolarHBondContact O-N 2.94Å
5	G	61.3	Low	72.2	Confident	49 Å²	49	104.5 Å²	104.5	51%	0.505	63%	0.63	S	S	.	*	H	α-helix	trans	-71.1	-44.7	178.4	0	0	0	0	0	112.6	Q3 E9	Q3-G5 VanDerWaalsContact C-N 3.26Å; Q3-G5 PolarHBondContact O-N 2.75Å; G5-E9 WeakPolarHBondContact O-CB 3.4Å; G5-E9 PolarHBondContact O-N 3.45Å
6	S	64.6	Low	73	Confident	81 Å²	81	100.1 Å²	100.1	57%	0.566	61%	0.608	S	S	*	*	H	α-helix	trans	-71.2	-36.2	179.6	-53	0	0	0	0	112.1	Q3 A10	Q3-S6 PolarHBondContact O-N 3.29Å; S6-A10 WeakPolarHBondContact O-CB 3.47Å; S6-A10 PolarHBondContact O-N 3.46Å
7	E	69.3	Low	73.8	Confident	128 Å²	128	95.9 Å²	95.9	60%	0.598	59%	0.589	S	S	*	*	H	α-helix	trans	-68.3	-44.1	174.5	-172.3	174.5	178.5	0	0	111.4	Q3 E9 A10 V11	Q3-E7 WeakPolarHBondContact O-CB 3.22Å; Q3-E7 PolarHBondContact O-N 3.11Å; E7-E9 VanDerWaalsContact C-N 3.32Å; E7-E9 PolarHBondContact O-N 3.33Å; E7-A10 PolarHBondContact O-N 3.44Å; E7-V11 VanDerWaalsContact O-CG2 3.28Å; E7-V11 WeakPolarHBondContact O-CG2 3.22Å; E7-V11 PolarHBondContact O-N 3.3Å
8	S	75.9	Confident	74.5	Confident	79 Å²	79	98.3 Å²	98.3	55%	0.552	59%	0.586	S	S	*	*	H	α-helix	trans	-62.2	-38.9	175.5	-174.8	0	0	0	0	112.3	D4 V11 A12	D4-S8 WeakPolarHBondContact O-CB 3.44Å; D4-S8 PolarHBondContact O-N 2.94Å; S8-V11 PolarHBondContact O-N 2.61Å; S8-A12 VanDerWaalsContact O-CB 3.31Å; S8-A12 WeakPolarHBondContact O-CB 3.47Å; S8-A12 PolarHBondContact O-N 3.36Å
9	E	79.9	Confident	75.1	Confident	136 Å²	136	98.5 Å²	98.5	64%	0.636	58%	0.583	S	S	*	*	H	α-helix	trans	-66	-43.4	174.6	-170.8	172.3	-170	0	0	111.8	G5 E7 V11 A12 V13	G5-E9 WeakPolarHBondContact O-CB 3.4Å; G5-E9 PolarHBondContact O-N 3.45Å; E7-E9 VanDerWaalsContact C-N 3.32Å; E7-E9 PolarHBondContact O-N 3.33Å; E9-V11 VanDerWaalsContact C-N 3.33Å; E9-V11 PolarHBondContact O-N 3.38Å; E9-A12 PolarHBondContact O-N 3.38Å; E9-V13 VanDerWaalsContact O-CG2 3.3Å; E9-V13 WeakPolarHBondContact O-CG2 3.3Å; E9-V13 PolarHBondContact O-N 3.14Å
10	A	81.6	Confident	75.6	Confident	62 Å²	62	102.8 Å²	102.8	51%	0.512	59%	0.588	S	S	.	*	H	α-helix	trans	-60.9	-42.2	175	0	0	0	0	0	112	S6 E7 V13 A14	S6-A10 WeakPolarHBondContact O-CB 3.47Å; S6-A10 PolarHBondContact O-N 3.46Å; E7-A10 PolarHBondContact O-N 3.44Å; A10-V13 PolarHBondContact O-N 3.48Å; A10-A14 WeakPolarHBondContact O-CB 3.26Å; A10-A14 PolarHBondContact O-N 3.29Å
11	V	84.8	Confident	76.2	Confident	75 Å²	75	103 Å²	103	46%	0.455	58%	0.584	S	S	.	*	H	α-helix	trans	-64.7	-42.6	174.6	172.8	0	0	0	0	110.9	E7 S8 E9 V13 A14 L15	E7-V11 VanDerWaalsContact O-CG2 3.28Å; E7-V11 WeakPolarHBondContact O-CG2 3.22Å; E7-V11 PolarHBondContact O-N 3.3Å; S8-V11 PolarHBondContact O-N 2.61Å; E9-V11 VanDerWaalsContact C-N 3.33Å; E9-V11 PolarHBondContact O-N 3.38Å; V11-V13 VanDerWaalsContact C-N 3.33Å; V11-V13 PolarHBondContact O-N 3.05Å; V11-A14 PolarHBondContact O-N 3.09Å; V11-L15 HydrophobicContact CG1-CD1 3.83Å; V11-L15 HydrophobicContact CG1-CG 4.26Å; V11-L15 WeakPolarHBondContact O-CB 3.43Å; V11-L15 VanDerWaalsContact O-CG 3.28Å; V11-L15 WeakPolarHBondContact O-CG 3.32Å; V11-L15 PolarHBondContact O-N 3.03Å
12	A	82.4	Confident	77.7	Confident	53 Å²	53	101.6 Å²	101.6	44%	0.438	55%	0.549	S	S	.	.	H	α-helix	trans	-62.1	-40.1	177	0	0	0	0	0	111.9	S8 E9 A16	S8-A12 VanDerWaalsContact O-CB 3.31Å; S8-A12 WeakPolarHBondContact O-CB 3.47Å; S8-A12 PolarHBondContact O-N 3.36Å; E9-A12 PolarHBondContact O-N 3.38Å; A12-A16 WeakPolarHBondContact O-CB 3.32Å; A12-A16 PolarHBondContact O-N 2.96Å
13	V	84.1	Confident	79	Confident	98 Å²	98	92.8 Å²	92.8	59%	0.594	52%	0.519	S	S	*	.	H	α-helix	trans	-66.5	-43.3	175.7	173	0	0	0	0	111	E9 A10 V11 A16 G17	E9-V13 VanDerWaalsContact O-CG2 3.3Å; E9-V13 WeakPolarHBondContact O-CG2 3.3Å; E9-V13 PolarHBondContact O-N 3.14Å; A10-V13 PolarHBondContact O-N 3.48Å; V11-V13 VanDerWaalsContact C-N 3.33Å; V11-V13 PolarHBondContact O-N 3.05Å; V13-A16 PolarHBondContact O-N 2.93Å; V13-G17 PolarHBondContact O-N 2.96Å
14	A	88.6	Confident	80.3	Confident	66 Å²	66	94.7 Å²	94.7	55%	0.545	52%	0.519	S	S	.	.	H	α-helix	trans	-61.6	-46.3	176.1	0	0	0	0	0	111.9	A10 V11 A16 G17 R18	A10-A14 WeakPolarHBondContact O-CB 3.26Å; A10-A14 PolarHBondContact O-N 3.29Å; V11-A14 PolarHBondContact O-N 3.09Å; A14-A16 VanDerWaalsContact C-N 3.35Å; A14-A16 PolarHBondContact O-N 3.44Å; A14-G17 PolarHBondContact O-N 3.13Å; A14-R18 PolarHBondContact O-N 3.31Å
15	L	87.1	Confident	81.7	Confident	114 Å²	114	95.7 Å²	95.7	60%	0.597	53%	0.525	S	S	*	.	H	α-helix	trans	-65.1	-38.1	176.4	-70.1	174.1	0	0	0	111.9	V11 G17 R18 L19	V11-L15 HydrophobicContact CG1-CD1 3.83Å; V11-L15 HydrophobicContact CG1-CG 4.26Å; V11-L15 WeakPolarHBondContact O-CB 3.43Å; V11-L15 VanDerWaalsContact O-CG 3.28Å; V11-L15 WeakPolarHBondContact O-CG 3.32Å; V11-L15 PolarHBondContact O-N 3.03Å; L15-G17 VanDerWaalsContact C-N 3.29Å; L15-G17 PolarHBondContact O-N 3.2Å; L15-R18 PolarHBondContact O-N 3.46Å; L15-L19 VanDerWaalsContact O-CB 3.32Å; L15-L19 WeakPolarHBondContact O-CB 3.21Å; L15-L19 PolarHBondContact O-N 3.28Å
16	A	85.1	Confident	82.7	Confident	34 Å²	34	95.6 Å²	95.6	28%	0.281	51%	0.513	S	S	.	.	H	α-helix	trans	-64.8	-34.7	174.7	0	0	0	0	0	112	A12 V13 A14 R20	A12-A16 WeakPolarHBondContact O-CB 3.32Å; A12-A16 PolarHBondContact O-N 2.96Å; V13-A16 PolarHBondContact O-N 2.93Å; A14-A16 VanDerWaalsContact C-N 3.35Å; A14-A16 PolarHBondContact O-N 3.44Å; A16-R20 VanDerWaalsContact O-CG 3.26Å; A16-R20 WeakPolarHBondContact O-CG 3.28Å; A16-R20 PolarHBondContact O-N 3.32Å; A16-R20 VanDerWaalsContact O-N 3.12Å; A16-R20 PolarHBondContact O-NE 3.2Å
17	G	86.7	Confident	83.6	Confident	28 Å²	28	94.7 Å²	94.7	29%	0.289	51%	0.505	S	S	.	.	H	α-helix	trans	-62.4	-52.5	171.2	0	0	0	0	0	111.4	V13 A14 L15 L19 R20 E21	V13-G17 PolarHBondContact O-N 2.96Å; A14-G17 PolarHBondContact O-N 3.13Å; L15-G17 VanDerWaalsContact C-N 3.29Å; L15-G17 PolarHBondContact O-N 3.2Å; G17-L19 VanDerWaalsContact C-N 3.29Å; G17-L19 PolarHBondContact O-N 3.02Å; G17-R20 WeakPolarHBondContact O-CB 3.35Å; G17-R20 PolarHBondContact O-N 3.07Å; G17-R20 VanDerWaalsContact O-N 3.07Å; G17-E21 PolarHBondContact O-N 3.48Å; G17-E21 VanDerWaalsContact O-N 3.14Å
18	R	86.3	Confident	83.9	Confident	140 Å²	140	92.7 Å²	92.7	53%	0.528	50%	0.503	S	S	.	.	H	α-helix	trans	-60.8	-38.2	179.1	-172.5	58.8	-179.2	157.2	1.5	112.7	A14 L15 E21 L22	A14-R18 PolarHBondContact O-N 3.31Å; L15-R18 PolarHBondContact O-N 3.46Å; R18-E21 IonicContact CZ-OE2 3.8Å; R18-E21 IonicContact NH1-OE2 2.75Å; R18-E21 PolarHBondContact NH1-OE2 3.12Å; R18-E21 PolarHBondContact O-N 2.9Å; R18-L22 HydrophobicContact CG-CD1 4.49Å; R18-L22 WeakPolarHBondContact O-CG 3.28Å; R18-L22 PolarHBondContact O-N 2.86Å; R18-L22 VanDerWaalsContact O-N 3.11Å
19	L	85	Confident	84	Confident	101 Å²	101	95 Å²	95	53%	0.529	51%	0.505	S	S	.	.	H	α-helix	trans	-63.4	-41.8	175.4	-176.2	63.8	0	0	0	111.6	L15 G17 E21 L22 L23	L15-L19 VanDerWaalsContact O-CB 3.32Å; L15-L19 WeakPolarHBondContact O-CB 3.21Å; L15-L19 PolarHBondContact O-N 3.28Å; G17-L19 VanDerWaalsContact C-N 3.29Å; G17-L19 PolarHBondContact O-N 3.02Å; L19-E21 VanDerWaalsContact C-N 3.32Å; L19-E21 PolarHBondContact O-N 3.38Å; L19-L22 PolarHBondContact O-N 2.9Å; L19-L23 HydrophobicContact CD1-CG 4.48Å; L19-L23 HydrophobicContact CG-CD1 4.19Å; L19-L23 HydrophobicContact CG-CG 4.41Å; L19-L23 WeakPolarHBondContact O-CB 3.44Å; L19-L23 VanDerWaalsContact O-CG 3.22Å; L19-L23 WeakPolarHBondContact O-CG 3.35Å; L19-L23 PolarHBondContact O-N 2.86Å
20	R	84.9	Confident	84.1	Confident	185 Å²	185	92.4 Å²	92.4	70%	0.698	50%	0.496	S	S	*	.	H	α-helix	trans	-61.9	-40.3	177	-73.5	172.9	-142.3	-145.4	6.4	112.2	A16 G17 L23 R24	A16-R20 VanDerWaalsContact O-CG 3.26Å; A16-R20 WeakPolarHBondContact O-CG 3.28Å; A16-R20 PolarHBondContact O-N 3.32Å; A16-R20 VanDerWaalsContact O-N 3.12Å; A16-R20 PolarHBondContact O-NE 3.2Å; G17-R20 WeakPolarHBondContact O-CB 3.35Å; G17-R20 PolarHBondContact O-N 3.07Å; G17-R20 VanDerWaalsContact O-N 3.07Å; R20-L23 PolarHBondContact O-N 3.39Å; R20-R24 PolarHBondContact O-N 2.89Å
21	E	87.7	Confident	84.2	Confident	107 Å²	107	94 Å²	94	50%	0.5	49%	0.488	S	S	.	.	H	α-helix	trans	-60.5	-49.5	174.8	-67.8	175.5	177.1	0	0	110.9	G17 R18 L19 L23 R24 D25	G17-E21 PolarHBondContact O-N 3.48Å; G17-E21 VanDerWaalsContact O-N 3.14Å; R18-E21 IonicContact CZ-OE2 3.8Å; R18-E21 IonicContact NH1-OE2 2.75Å; R18-E21 PolarHBondContact NH1-OE2 3.12Å; R18-E21 PolarHBondContact O-N 2.9Å; L19-E21 VanDerWaalsContact C-N 3.32Å; L19-E21 PolarHBondContact O-N 3.38Å; E21-L23 VanDerWaalsContact C-N 3.3Å; E21-L23 PolarHBondContact O-N 2.94Å; E21-R24 WeakPolarHBondContact O-CA 3.43Å; E21-R24 VanDerWaalsContact O-CB 3.22Å; E21-R24 WeakPolarHBondContact O-CB 3.41Å; E21-R24 PolarHBondContact O-N 3.32Å; E21-D25 PolarHBondContact O-N 3.45Å
22	L	85.4	Confident	84	Confident	86 Å²	86	93.3 Å²	93.3	45%	0.45	49%	0.49	S	S	.	.	H	α-helix	trans	-62.4	-37.1	178.4	-67	172	0	0	0	112.5	R18 L19 R24 D25 L26	R18-L22 HydrophobicContact CG-CD1 4.49Å; R18-L22 WeakPolarHBondContact O-CG 3.28Å; R18-L22 PolarHBondContact O-N 2.86Å; R18-L22 VanDerWaalsContact O-N 3.11Å; L19-L22 PolarHBondContact O-N 2.9Å; L22-R24 PolarHBondContact O-N 3.18Å; L22-D25 PolarHBondContact O-N 3.23Å; L22-L26 PolarHBondContact O-N 3.42Å
23	L	82.8	Confident	83.9	Confident	49 Å²	49	93.1 Å²	93.1	26%	0.257	49%	0.486	S	S	.	.	H	α-helix	trans	-66.4	-24.9	173.8	-68.9	177.7	0	0	0	112.7	L19 R20 E21 D25 L26 R31 L34	L19-L23 HydrophobicContact CD1-CG 4.48Å; L19-L23 HydrophobicContact CG-CD1 4.19Å; L19-L23 HydrophobicContact CG-CG 4.41Å; L19-L23 WeakPolarHBondContact O-CB 3.44Å; L19-L23 VanDerWaalsContact O-CG 3.22Å; L19-L23 WeakPolarHBondContact O-CG 3.35Å; L19-L23 PolarHBondContact O-N 2.86Å; R20-L23 PolarHBondContact O-N 3.39Å; E21-L23 VanDerWaalsContact C-N 3.3Å; E21-L23 PolarHBondContact O-N 2.94Å; L23-D25 VanDerWaalsContact C-N 3.32Å; L23-L26 HydrophobicContact CD2-CD1 3.67Å; L23-L26 PolarHBondContact O-N 3.03Å; L23-R31 PolarHBondContact O-NE 3.37Å; L23-R31 PolarHBondContact O-NH2 3Å; L23-L34 HydrophobicContact CD1-CD2 4.44Å; L23-L34 HydrophobicContact CD2-CD1 3.72Å; L23-L34 HydrophobicContact CD2-CD2 3.75Å; L23-L34 HydrophobicContact CD2-CG 4.36Å
24	R	83.7	Confident	83.9	Confident	202 Å²	202	91.2 Å²	91.2	76%	0.762	47%	0.472	S	S	*	.	H	α-helix	trans	-74.1	-21.9	176.9	-169.4	175.8	169.3	164.3	-2.4	113.2	R20 E21 L22 R31	R20-R24 PolarHBondContact O-N 2.89Å; E21-R24 WeakPolarHBondContact O-CA 3.43Å; E21-R24 VanDerWaalsContact O-CB 3.22Å; E21-R24 WeakPolarHBondContact O-CB 3.41Å; E21-R24 PolarHBondContact O-N 3.32Å; L22-R24 PolarHBondContact O-N 3.18Å; R24-R31 PolarHBondContact O-NH2 2.9Å
25	D	87.4	Confident	83.7	Confident	137 Å²	137	94.4 Å²	94.4	73%	0.733	48%	0.476	S	S	*	.	S	Bend	trans	-97.9	-2.7	176.5	-60.7	-31.1	0	0	0	113	E21 L22 L23	E21-D25 PolarHBondContact O-N 3.45Å; L22-D25 PolarHBondContact O-N 3.23Å; L23-D25 VanDerWaalsContact C-N 3.32Å
26	L	82.4	Confident	83.5	Confident	47 Å²	47	95.1 Å²	95.1	25%	0.246	47%	0.471	C	S	.	.	S	Bend	trans	-73.7	133.9	-179.9	-103.8	139.6	0	0	0	112.2	L22 L23 N30 R31	L22-L26 PolarHBondContact O-N 3.42Å; L23-L26 HydrophobicContact CD2-CD1 3.67Å; L23-L26 PolarHBondContact O-N 3.03Å; L26-N30 HydrophobicContact CD2-CB 3.18Å; L26-R31 HydrophobicContact CB-CG 4.12Å; L26-R31 PolarHBondContact O-NE 3.45Å
27	P	83.4	Confident	83.5	Confident	62 Å²	62	96.3 Å²	96.3	40%	0.403	47%	0.472	S	S	.	.			trans	-61.2	150.8	174.2	22.8	-32.6	0	0	0	111.7	E29 N30 R31	P27-E29 VanDerWaalsContact C-N 3.28Å; P27-E29 PolarHBondContact O-N 3.23Å; P27-N30 HydrophobicContact CG-CB 4.26Å; P27-N30 PolarHBondContact O-N 2.89Å; P27-R31 PolarHBondContact O-N 3.44Å; P27-R31 VanDerWaalsContact O-N 3.13Å
28	P	76.4	Confident	83.4	Confident	86 Å²	86	99.7 Å²	99.7	56%	0.558	48%	0.484	S	S	*	.	H	α-helix	trans	-59	-33.9	-169.6	19.5	-29.6	0	0	0	113.9	N30 R31 A32	P28-N30 VanDerWaalsContact C-N 3.32Å; P28-N30 PolarHBondContact O-N 3.42Å; P28-R31 PolarHBondContact O-N 3.42Å; P28-A32 PolarHBondContact O-N 3.24Å; P28-A32 VanDerWaalsContact O-N 3.09Å
29	E	78.1	Confident	83.3	Confident	126 Å²	126	101.7 Å²	101.7	59%	0.589	49%	0.491	S	S	*	.	H	α-helix	trans	-64	-39.1	177.2	-61.9	72.7	-158.3	0	0	111.9	P27 S33	P27-E29 VanDerWaalsContact C-N 3.28Å; P27-E29 PolarHBondContact O-N 3.23Å; E29-S33 PolarHBondContact O-N 2.88Å; E29-S33 PolarHBondContact O-OG 2.83Å
30	N	83.2	Confident	83	Confident	83 Å²	83	100.9 Å²	100.9	44%	0.444	48%	0.484	S	S	.	.	H	α-helix	trans	-75.4	-32.3	179.3	-68.9	-8	0	0	0	111	L26 P27 P28 S33 L34	L26-N30 HydrophobicContact CD2-CB 3.18Å; P27-N30 HydrophobicContact CG-CB 4.26Å; P27-N30 PolarHBondContact O-N 2.89Å; P28-N30 VanDerWaalsContact C-N 3.32Å; P28-N30 PolarHBondContact O-N 3.42Å; N30-S33 PolarHBondContact O-N 3.43Å; N30-L34 VanDerWaalsContact O-CB 3.32Å; N30-L34 WeakPolarHBondContact O-CB 3.31Å; N30-L34 PolarHBondContact O-N 3.38Å
31	R	82.9	Confident	82.7	Confident	96 Å²	96	98.2 Å²	98.2	36%	0.362	48%	0.483	S	S	.	.	H	α-helix	trans	-62.2	-46.7	172.3	-73.3	-175	175	144.9	7.2	112.2	L23 R24 L26 P27 P28 S33 L34 Q35	L23-R31 PolarHBondContact O-NE 3.37Å; L23-R31 PolarHBondContact O-NH2 3Å; R24-R31 PolarHBondContact O-NH2 2.9Å; L26-R31 HydrophobicContact CB-CG 4.12Å; L26-R31 PolarHBondContact O-NE 3.45Å; P27-R31 PolarHBondContact O-N 3.44Å; P27-R31 VanDerWaalsContact O-N 3.13Å; P28-R31 PolarHBondContact O-N 3.42Å; R31-S33 VanDerWaalsContact C-N 3.29Å; R31-S33 PolarHBondContact O-N 3.21Å; R31-L34 PolarHBondContact O-N 2.87Å; R31-Q35 WeakPolarHBondContact O-CG 3.38Å; R31-Q35 PolarHBondContact O-N 3.43Å
32	A	79.9	Confident	82.1	Confident	59 Å²	59	103.8 Å²	103.8	49%	0.488	50%	0.5	S	S	.	.	H	α-helix	trans	-60.4	-42	177.3	0	0	0	0	0	111.3	P28 Y36	P28-A32 PolarHBondContact O-N 3.24Å; P28-A32 VanDerWaalsContact O-N 3.09Å; A32-Y36 WeakPolarHBondContact O-CB 3.41Å; A32-Y36 PolarHBondContact O-N 2.89Å
33	S	81.3	Confident	81.1	Confident	50 Å²	50	109.5 Å²	109.5	35%	0.35	52%	0.515	S	S	.	.	H	α-helix	trans	-63.1	-42.5	176.1	-58.3	0	0	0	0	112.2	E29 N30 R31 Y36 L37	E29-S33 PolarHBondContact O-N 2.88Å; E29-S33 PolarHBondContact O-OG 2.83Å; N30-S33 PolarHBondContact O-N 3.43Å; R31-S33 VanDerWaalsContact C-N 3.29Å; R31-S33 PolarHBondContact O-N 3.21Å; S33-Y36 WeakPolarHBondContact O-CB 3.36Å; S33-Y36 PolarHBondContact O-N 3.01Å; S33-L37 WeakPolarHBondContact O-CG 3.04Å; S33-L37 PolarHBondContact O-N 3.37Å
34	L	84.3	Confident	79.8	Confident	57 Å²	57	112.2 Å²	112.2	30%	0.298	54%	0.536	S	S	.	.	H	α-helix	trans	-70.5	-40.8	-179.6	-167.9	137.8	0	0	0	112.1	L23 N30 R31 Y36 L37 L38	L23-L34 HydrophobicContact CD1-CD2 4.44Å; L23-L34 HydrophobicContact CD2-CD1 3.72Å; L23-L34 HydrophobicContact CD2-CD2 3.75Å; L23-L34 HydrophobicContact CD2-CG 4.36Å; N30-L34 VanDerWaalsContact O-CB 3.32Å; N30-L34 WeakPolarHBondContact O-CB 3.31Å; N30-L34 PolarHBondContact O-N 3.38Å; R31-L34 PolarHBondContact O-N 2.87Å; L34-Y36 VanDerWaalsContact C-N 3.29Å; L34-Y36 PolarHBondContact O-N 3.49Å; L34-L37 PolarHBondContact O-N 3.25Å; L34-L38 HydrophobicContact CD2-CD1 3.6Å; L34-L38 HydrophobicContact CD2-CG 4.14Å; L34-L38 WeakPolarHBondContact O-CG 3.49Å; L34-L38 PolarHBondContact O-N 2.93Å
35	Q	82.9	Confident	78.5	Confident	134 Å²	134	107.3 Å²	107.3	63%	0.626	54%	0.538	S	S	*	.	H	α-helix	trans	-60.7	-40.2	172.3	-72.1	177.2	12.5	0	0	111.8	R31 L38 R39	R31-Q35 WeakPolarHBondContact O-CG 3.38Å; R31-Q35 PolarHBondContact O-N 3.43Å; Q35-L38 PolarHBondContact O-N 3.02Å; Q35-R39 WeakPolarHBondContact O-CB 3.11Å; Q35-R39 PolarHBondContact O-N 3.35Å
36	Y	84.2	Confident	76.5	Confident	128 Å²	128	106.5 Å²	106.5	50%	0.502	54%	0.543	S	S	.	.	H	α-helix	trans	-60.7	-47.3	174.4	175	-94.5	0	0	0	111.7	A32 S33 L34 R39 H40	A32-Y36 WeakPolarHBondContact O-CB 3.41Å; A32-Y36 PolarHBondContact O-N 2.89Å; S33-Y36 WeakPolarHBondContact O-CB 3.36Å; S33-Y36 PolarHBondContact O-N 3.01Å; L34-Y36 VanDerWaalsContact C-N 3.29Å; L34-Y36 PolarHBondContact O-N 3.49Å; Y36-R39 PolarHBondContact O-N 3.43Å; Y36-H40 WeakPolarHBondContact O-CB 3.45Å; Y36-H40 PolarHBondContact O-N 3.38Å
37	L	84.4	Confident	75	Confident	59 Å²	59	107.6 Å²	107.6	31%	0.309	56%	0.555	S	S	.	*	H	α-helix	trans	-61.8	-47.7	177.2	-71.7	173.7	0	0	0	112	S33 L34 R39 H40 L41 W56	S33-L37 WeakPolarHBondContact O-CG 3.04Å; S33-L37 PolarHBondContact O-N 3.37Å; L34-L37 PolarHBondContact O-N 3.25Å; L37-R39 VanDerWaalsContact C-N 3.3Å; L37-R39 PolarHBondContact O-N 2.96Å; L37-H40 WeakPolarHBondContact O-CB 3.33Å; L37-H40 PolarHBondContact O-N 2.82Å; L37-H40 VanDerWaalsContact O-N 3.11Å; L37-L41 WeakPolarHBondContact O-CB 3.24Å; L37-L41 VanDerWaalsContact O-CG 3.24Å; L37-L41 WeakPolarHBondContact O-CG 3.44Å; L37-L41 PolarHBondContact O-N 3.45Å; L37-W56 HydrophobicContact CD1-CH2 3.54Å; L37-W56 HydrophobicContact CD1-CZ2 4.18Å; L37-W56 HydrophobicContact CD1-CZ3 3.79Å; L37-W56 HydrophobicContact CD2-CE3 4.06Å; L37-W56 HydrophobicContact CD2-CH2 4.39Å; L37-W56 HydrophobicContact CD2-CZ3 3.8Å; L37-W56 HydrophobicContact CG-CH2 4.14Å; L37-W56 HydrophobicContact CG-CZ3 3.88Å
38	L	84	Confident	73.6	Confident	100 Å²	100	116.1 Å²	116.1	52%	0.524	58%	0.579	S	S	.	*	H	α-helix	trans	-61.1	-40.5	178.3	-71.5	177.6	0	0	0	111.7	L34 Q35 H40 L41 R42	L34-L38 HydrophobicContact CD2-CD1 3.6Å; L34-L38 HydrophobicContact CD2-CG 4.14Å; L34-L38 WeakPolarHBondContact O-CG 3.49Å; L34-L38 PolarHBondContact O-N 2.93Å; Q35-L38 PolarHBondContact O-N 3.02Å; L38-H40 VanDerWaalsContact C-N 3.33Å; L38-L41 PolarHBondContact O-N 3.39Å; L38-R42 WeakPolarHBondContact O-CB 3.39Å; L38-R42 PolarHBondContact O-N 3.46Å
39	R	84.5	Confident	72.8	Confident	182 Å²	182	120.1 Å²	120.1	69%	0.687	60%	0.595	S	S	*	*	H	α-helix	trans	-65.3	-37.7	175.1	-172.2	173.8	66.5	145.3	0.2	112.1	Q35 Y36 L37 R43	Q35-R39 WeakPolarHBondContact O-CB 3.11Å; Q35-R39 PolarHBondContact O-N 3.35Å; Y36-R39 PolarHBondContact O-N 3.43Å; L37-R39 VanDerWaalsContact C-N 3.3Å; L37-R39 PolarHBondContact O-N 2.96Å; R39-R43 PolarHBondContact O-N 3.48Å
40	H	78.9	Confident	71.3	Confident	84 Å²	84	117.4 Å²	117.4	39%	0.389	59%	0.59	S	S	.	*	H	α-helix	trans	-68.1	-41.1	177.3	-174.5	70.4	0	0	0	112	Y36 L37 L38	Y36-H40 WeakPolarHBondContact O-CB 3.45Å; Y36-H40 PolarHBondContact O-N 3.38Å; L37-H40 WeakPolarHBondContact O-CB 3.33Å; L37-H40 PolarHBondContact O-N 2.82Å; L37-H40 VanDerWaalsContact O-N 3.11Å; L38-H40 VanDerWaalsContact C-N 3.33Å
41	L	78.6	Confident	69.7	Low	129 Å²	129	118.7 Å²	118.7	68%	0.675	61%	0.606	S	S	*	*	H	α-helix	trans	-76.2	-30.1	178.1	-64.8	171.2	0	0	0	113.2	L37 L38 R43	L37-L41 WeakPolarHBondContact O-CB 3.24Å; L37-L41 VanDerWaalsContact O-CG 3.24Å; L37-L41 WeakPolarHBondContact O-CG 3.44Å; L37-L41 PolarHBondContact O-N 3.45Å; L38-L41 PolarHBondContact O-N 3.39Å; L41-R43 VanDerWaalsContact C-N 3.27Å; L41-R43 PolarHBondContact O-N 3.28Å
42	R	76.4	Confident	68.1	Low	224 Å²	224	116.7 Å²	116.7	85%	0.845	61%	0.606	S	S	*	*	H	α-helix	trans	-77.7	-10.5	177.8	-176.5	171.2	156.5	163.3	-4	112.9	L38 P44	L38-R42 WeakPolarHBondContact O-CB 3.39Å; L38-R42 PolarHBondContact O-N 3.46Å; R42-P44 WeakPolarHBondContact O-CD 3.47Å
43	R	64.5	Low	67	Low	206 Å²	206	120.1 Å²	120.1	78%	0.777	62%	0.621	S	S	*	*	S	Bend	trans	-70.1	113	160.9	-164.2	171.9	-177.2	169.9	-0.5	105.4	R39 L41 A45	R39-R43 PolarHBondContact O-N 3.48Å; L41-R43 VanDerWaalsContact C-N 3.27Å; L41-R43 PolarHBondContact O-N 3.28Å; R43-A45 PolarHBondContact O-N 3.03Å
44	P	54.8	Low	66	Low	105 Å²	105	122.5 Å²	122.5	68%	0.682	63%	0.634	S	S	*	*			trans	-51.7	143.2	-178.3	22.8	-32.7	0	0	0	108.2	R42 S46	R42-P44 WeakPolarHBondContact O-CD 3.47Å; P44-S46 PolarHBondContact O-N 3.27Å
45	A	56.2	Low	64.6	Low	99 Å²	99	122.7 Å²	122.7	82%	0.818	64%	0.644	S	S	*	*	S	Bend	trans	-61.9	46.8	-170.4	0	0	0	0	0	115.3	R43 S47	R43-A45 PolarHBondContact O-N 3.03Å; A45-S47 PolarHBondContact O-N 3.24Å; A45-S47 VanDerWaalsContact O-N 3.16Å
46	S	45.2	Very low	62.9	Low	120 Å²	120	122 Å²	122	84%	0.839	64%	0.636	S	S	*	*			trans	-82.2	31.4	170.6	-168.6	0	0	0	0	111.8	P44	P44-S46 PolarHBondContact O-N 3.27Å
47	S	51	Low	61.4	Low	71 Å²	71	119 Å²	119	50%	0.497	63%	0.633	S	S	.	*			trans	-144.4	72.3	156	69.7	0	0	0	0	107.3	A45 L49	A45-S47 PolarHBondContact O-N 3.24Å; A45-S47 VanDerWaalsContact O-N 3.16Å; S47-L49 VanDerWaalsContact C-N 3.28Å; S47-L49 CarbonylContact O-C 3.48Å; S47-L49 PolarHBondContact O-N 2.98Å
48	R	54.8	Low	59.7	Low	241 Å²	241	119.5 Å²	119.5	91%	0.909	64%	0.641	S	S	*	*	S	Bend	trans	-42.1	105	147.2	-152.3	179.6	-149.6	-153.7	5.3	105.5
49	L	58.4	Low	58.3	Low	169 Å²	169	124.1 Å²	124.1	89%	0.885	65%	0.652	S	S	*	*			trans	79.2	96	-169.7	-46.9	164	0	0	0	115.3	S47	S47-L49 VanDerWaalsContact C-N 3.28Å; S47-L49 CarbonylContact O-C 3.48Å; S47-L49 PolarHBondContact O-N 2.98Å
50	S	47.3	Very low	56.8	Low	69 Å²	69	124.7 Å²	124.7	48%	0.483	65%	0.654	S	S	.	*			trans	-147.8	82.9	153.2	-163.1	0	0	0	0	110.8	S52	S50-S52 WeakPolarHBondContact O-CB 3.35Å; S50-S52 PolarHBondContact O-N 3.21Å; S50-S52 PolarHBondContact O-OG 2.85Å
51	S	49.4	Very low	55.2	Low	111 Å²	111	125.1 Å²	125.1	78%	0.776	67%	0.666	S	S	*	*			trans	34.8	6.6	141.2	-32.4	0	0	0	0	122.5
52	S	49.8	Very low	54.1	Low	54 Å²	54	129.4 Å²	129.4	38%	0.378	67%	0.673	S	S	.	*	T	Hydrogen-bonded Turn	trans	-87.8	-10.4	-165.5	-58.3	0	0	0	0	114	S50 T54 A55	S50-S52 WeakPolarHBondContact O-CB 3.35Å; S50-S52 PolarHBondContact O-N 3.21Å; S50-S52 PolarHBondContact O-OG 2.85Å; S52-T54 PolarHBondContact O-N 3.11Å; S52-A55 PolarHBondContact O-N 3.39Å
53	T	56.9	Low	52.9	Low	130 Å²	130	129.9 Å²	129.9	80%	0.798	68%	0.675	S	S	*	*	H	α-helix	trans	-64.7	-27.3	175.5	-61.6	0	0	0	0	112.4	S57	T53-S57 PolarHBondContact O-OG 3.38Å
54	T	59.8	Low	52.3	Low	101 Å²	101	130.6 Å²	130.6	62%	0.62	68%	0.678	S	S	*	*	H	α-helix	trans	-87.2	-24.5	-178	-43	0	0	0	0	113.2	S52 S57 S58	S52-T54 PolarHBondContact O-N 3.11Å; T54-S57 PolarHBondContact O-OG 3.37Å; T54-S57 VanDerWaalsContact O-OG 3.14Å; T54-S58 PolarHBondContact O-OG 2.93Å
55	A	55.1	Low	52.1	Low	60 Å²	60	131.4 Å²	131.4	50%	0.496	68%	0.683	S	S	.	*	H	α-helix	trans	-81.5	-30.4	-176.1	0	0	0	0	0	113.4	S52	S52-A55 PolarHBondContact O-N 3.39Å
56	W	46.5	Very low	51.6	Low	121 Å²	121	132.7 Å²	132.7	46%	0.458	68%	0.683	S	S	.	*	H	α-helix	trans	-79.2	-39.3	178.8	-179.8	-83.5	0	0	0	112.5	L37 S58 R59 R60	L37-W56 HydrophobicContact CD1-CH2 3.54Å; L37-W56 HydrophobicContact CD1-CZ2 4.18Å; L37-W56 HydrophobicContact CD1-CZ3 3.79Å; L37-W56 HydrophobicContact CD2-CE3 4.06Å; L37-W56 HydrophobicContact CD2-CH2 4.39Å; L37-W56 HydrophobicContact CD2-CZ3 3.8Å; L37-W56 HydrophobicContact CG-CH2 4.14Å; L37-W56 HydrophobicContact CG-CZ3 3.88Å; W56-S58 VanDerWaalsContact C-N 3.29Å; W56-S58 PolarHBondContact O-N 3.38Å; W56-R59 PolarHBondContact O-N 3.14Å; W56-R60 PolarHBondContact O-N 3.33Å
57	S	52.5	Low	52	Low	64 Å²	64	130.5 Å²	130.5	45%	0.448	68%	0.68	S	S	.	*	H	α-helix	trans	-62.3	-36.8	177	56.6	0	0	0	0	112.1	T53 T54 R59 R60 S61	T53-S57 PolarHBondContact O-OG 3.38Å; T54-S57 PolarHBondContact O-OG 3.37Å; T54-S57 VanDerWaalsContact O-OG 3.14Å; S57-R59 VanDerWaalsContact C-N 3.26Å; S57-R59 PolarHBondContact O-N 3.49Å; S57-R60 PolarHBondContact O-N 3.45Å; S57-S61 PolarHBondContact O-N 3.4Å; S57-S61 PolarHBondContact O-OG 3.03Å
58	S	48.4	Very low	51.6	Low	69 Å²	69	130.9 Å²	130.9	48%	0.483	69%	0.687	S	S	.	*	H	α-helix	trans	-64.3	-25.5	177.5	-64	0	0	0	0	114.1	T54 W56	T54-S58 PolarHBondContact O-OG 2.93Å; W56-S58 VanDerWaalsContact C-N 3.29Å; W56-S58 PolarHBondContact O-N 3.38Å
59	R	55.4	Low	51.1	Low	197 Å²	197	130.1 Å²	130.1	74%	0.743	68%	0.684	S	S	*	*	H	α-helix	trans	-87.3	-30.7	-177.5	-131.7	176.1	-82.8	-106.9	3	112.5	W56 S57	W56-R59 PolarHBondContact O-N 3.14Å; S57-R59 VanDerWaalsContact C-N 3.26Å; S57-R59 PolarHBondContact O-N 3.49Å
60	R	53.2	Low	50.7	Low	195 Å²	195	127.7 Å²	127.7	74%	0.736	68%	0.676	S	S	*	*	H	α-helix	trans	-69.3	-33	174.9	-172.8	174.3	-75.2	-109.1	0.5	112.2	W56 S57 R62	W56-R60 PolarHBondContact O-N 3.33Å; S57-R60 PolarHBondContact O-N 3.45Å; R60-R62 VanDerWaalsContact C-N 3.28Å; R60-R62 PolarHBondContact O-N 2.67Å
61	S	46	Very low	50.7	Low	92 Å²	92	129.2 Å²	129.2	64%	0.643	69%	0.687	S	S	*	*	G	3₁₀ helix	trans	-73.5	-12.2	179.8	-60.1	0	0	0	0	114.8	S57 R63	S57-S61 PolarHBondContact O-N 3.4Å; S57-S61 PolarHBondContact O-OG 3.03Å; S61-R63 VanDerWaalsContact C-N 3.27Å; S61-R63 PolarHBondContact O-N 2.64Å
62	R	54.5	Low	50.4	Low	219 Å²	219	132.1 Å²	132.1	83%	0.826	69%	0.688	S	S	*	*	G	3₁₀ helix	trans	-80.4	-0.4	178.9	-70	-172	179.2	-150.5	-0.5	114.6	R60	R60-R62 VanDerWaalsContact C-N 3.28Å; R60-R62 PolarHBondContact O-N 2.67Å
63	R	51.4	Low	50.6	Low	234 Å²	234	135.5 Å²	135.5	88%	0.883	71%	0.709	S	S	*	*	G	3₁₀ helix	trans	-106.5	17.2	179.1	-76.7	-168.3	166.5	-153.1	-1.2	114.8	S61	S61-R63 VanDerWaalsContact C-N 3.27Å; S61-R63 PolarHBondContact O-N 2.64Å
64	R	51	Low	50	Low	221 Å²	221	134.8 Å²	134.8	83%	0.834	70%	0.704	S	S	*	*			trans	-108.9	118.6	161	-80.5	177.4	76.5	-177.1	4	108.4	P66	R64-P66 WeakPolarHBondContact O-CD 3.49Å
65	P	50.4	Low	49.4	Very low	123 Å²	123	134.4 Å²	134.4	80%	0.799	71%	0.706	S	S	*	*			trans	-84.5	121.7	165.5	31.7	-25	0	0	0	108.2	G67	P65-G67 PolarHBondContact O-N 2.9Å
66	P	46.2	Very low	48.8	Very low	125 Å²	125	139 Å²	139	81%	0.812	72%	0.717	S	S	*	*			trans	-84.8	94.4	147.1	28.9	-18.2	0	0	0	106.3	R64 A68	R64-P66 WeakPolarHBondContact O-CD 3.49Å; P66-A68 PolarHBondContact O-N 3.16Å
67	G	54.4	Low	48.7	Very low	75 Å²	75	140.5 Å²	140.5	77%	0.773	73%	0.733	S	S	*	*			trans	-64.2	113.5	156.4	0	0	0	0	0	107.7	P65	P65-G67 PolarHBondContact O-N 2.9Å
68	A	41.6	Very low	47.9	Very low	78 Å²	78	152.4 Å²	152.4	65%	0.645	77%	0.768	S	S	*	*				165.3	114.7	127.9	0	0	0	0	0	111	P66	P66-A68 PolarHBondContact O-N 3.16Å
69	R	44.8	Very low	47.9	Very low	225 Å²	225	156.6 Å²	156.6	85%	0.849	78%	0.783	S	S	*	*			trans	67.3	95.3	131.1	-59.5	172.7	-165	-103.4	2	116
70	T	50.4	Low	47.5	Very low	118 Å²	118	154.4 Å²	154.4	72%	0.724	79%	0.785	S	S	*	*				57.4	100.2	95.4	62.8	0	0	0	0	113.5
71	S	46.3	Very low	47.2	Very low	101 Å²	101	152.2 Å²	152.2	71%	0.706	79%	0.787	S	S	*	*			trans	33.6	115.4	134.8	54.3	0	0	0	0	118.9
72	H	43	Very low	47.2	Very low	173 Å²	173	155.7 Å²	155.7	80%	0.801	80%	0.796	S	S	*	*			trans	-135.5	125.2	136	-82.1	-77.8	0	0	0	108.9
73	P	55.3	Low	46.8	Very low	124 Å²	124	151.8 Å²	151.8	81%	0.805	79%	0.794	S	S	*	*			trans	-80.9	115.4	156.3	31.9	-23	0	0	0	106.1
74	T	44.4	Very low	46.5	Very low	115 Å²	115	146.3 Å²	146.3	71%	0.706	79%	0.788	S	S	*	*			trans	-124.5	103.6	167.3	-43.8	0	0	0	0	106.3
75	S	45.7	Very low	46.2	Very low	93 Å²	93	140.9 Å²	140.9	65%	0.65	79%	0.785	S	S	*	*			trans	-27.9	138.2	153	40	0	0	0	0	112.8
76	E	43.3	Very low	45.8	Very low	157 Å²	157	142.3 Å²	142.3	73%	0.734	78%	0.784	S	S	*	*				160.6	135.6	124.1	-83.2	-74	134	0	0	111
77	L	43.5	Very low	45.8	Very low	153 Å²	153	143.8 Å²	143.8	80%	0.801	78%	0.781	S	S	*	*			trans	76.1	97.8	153.3	-60.2	153.1	0	0	0	118.9
78	R	36.9	Very low	45	Very low	313 Å²	313	150 Å²	150	100%	1.181	78%	0.782	S	S	*	*				168.7	0	79.3	-167.8	172.6	-172.2	-110.8	3.3	111.3

Retrieved 78 of 78 residues in 37.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).