A0A087X1A9_HUMAN Loading...

SEC22 homolog B, vesicle trafficking protein

AlphaFold DB , UniProt , Accession A0A087X1A9, Species HUMAN (Homo sapiens, Human), Gene SEC22B, Length 79 aa.

						>A0A087X1A9_HUMAN|A0A087X1A9|SEC22B
YIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSGWSAMARSWLTATTISWVQAIFPPYPPEYLGLQACATTPG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	Y	58.7	Low	83.5	Confident	252 Å²	252	121.9 Å²	121.9	99%	0.988	58%	0.581	S	S	*	*				0	-34.5	0	-166.2	-117.5	0	0	0	113.3
2	I	65.8	Low	84.4	Confident	152 Å²	152	116.8 Å²	116.8	78%	0.779	57%	0.568	S	S	*	*			trans	-71	-34.1	177.8	-61.5	-79.8	0	0	0	113.6	S4 R5	I2-S4 PolarHBondContact O-N 3.44Å; I2-R5 PolarHBondContact O-N 3.46Å
3	D	79.4	Confident	85.3	Confident	90 Å²	90	115.2 Å²	115.2	48%	0.481	56%	0.562	S	S	.	*	H	α-helix	trans	-64.4	-38	-175.1	-174.5	63.9	0	0	0	114.7	R5 A6 R7	D3-R5 VanDerWaalsContact C-N 3.27Å; D3-R5 PolarHBondContact O-N 3.47Å; D3-A6 PolarHBondContact O-N 3.29Å; D3-R7 PolarHBondContact O-N 3.25Å; D3-R7 WeakPolarHBondContact OD2-CD 3.42Å; D3-R7 IonicContact OD2-CZ 3.86Å; D3-R7 IonicContact OD2-NE 3.9Å; D3-R7 IonicContact OD2-NH1 2.99Å; D3-R7 PolarHBondContact OD2-NH1 3.37Å
4	S	82.1	Confident	86.1	Confident	70 Å²	70	113.1 Å²	113.1	49%	0.49	56%	0.555	S	S	.	*	H	α-helix	trans	-70.2	-20.6	-176.6	-46.1	0	0	0	0	113.8	I2 R8	I2-S4 PolarHBondContact O-N 3.44Å; S4-R8 WeakPolarHBondContact O-CG 3.44Å; S4-R8 PolarHBondContact O-N 3.46Å; S4-R8 PolarHBondContact O-NE 3.46Å; S4-R8 VanDerWaalsContact O-NE 3.14Å
5	R	85.7	Confident	86.8	Confident	165 Å²	165	111.5 Å²	111.5	62%	0.623	55%	0.554	S	S	*	*	H	α-helix	trans	-81.3	-44.8	173.3	-173.7	176.4	-74.8	-113.7	2.1	110.3	I2 D3 R7 R8 N9	I2-R5 PolarHBondContact O-N 3.46Å; D3-R5 VanDerWaalsContact C-N 3.27Å; D3-R5 PolarHBondContact O-N 3.47Å; R5-R7 VanDerWaalsContact C-N 3.35Å; R5-R7 PolarHBondContact O-N 2.91Å; R5-R8 PolarHBondContact O-N 3.35Å; R5-N9 PolarHBondContact O-N 3.49Å; R5-N9 PolarHBondContact O-OD1 3.42Å
6	A	87.6	Confident	87.5	Confident	46 Å²	46	111.9 Å²	111.9	38%	0.38	55%	0.554	S	S	.	*	H	α-helix	trans	-58.6	-44.6	175.6	0	0	0	0	0	112	D3 R8 N9 L10	D3-A6 PolarHBondContact O-N 3.29Å; A6-R8 PolarHBondContact O-N 3.49Å; A6-N9 PolarHBondContact O-N 3.23Å; A6-L10 WeakPolarHBondContact O-CG 3.39Å; A6-L10 PolarHBondContact O-N 2.83Å
7	R	89.8	Confident	88.2	Confident	170 Å²	170	111.3 Å²	111.3	64%	0.642	55%	0.553	S	S	*	*	H	α-helix	trans	-64.8	-38.3	178.1	-76.1	164.2	84.4	177.1	7	113.6	D3 R5 G11	D3-R7 PolarHBondContact O-N 3.25Å; D3-R7 WeakPolarHBondContact OD2-CD 3.42Å; D3-R7 IonicContact OD2-CZ 3.86Å; D3-R7 IonicContact OD2-NE 3.9Å; D3-R7 IonicContact OD2-NH1 2.99Å; D3-R7 PolarHBondContact OD2-NH1 3.37Å; R5-R7 VanDerWaalsContact C-N 3.35Å; R5-R7 PolarHBondContact O-N 2.91Å; R7-G11 PolarHBondContact O-N 3.47Å
8	R	90.9	Very high	88.7	Confident	168 Å²	168	112.2 Å²	112.2	63%	0.634	56%	0.555	S	S	*	*	H	α-helix	trans	-67.2	-40.9	174.3	-76.8	-173.7	-69.1	165.3	-3.1	112	S4 R5 A6 G11 S12	S4-R8 WeakPolarHBondContact O-CG 3.44Å; S4-R8 PolarHBondContact O-N 3.46Å; S4-R8 PolarHBondContact O-NE 3.46Å; S4-R8 VanDerWaalsContact O-NE 3.14Å; R5-R8 PolarHBondContact O-N 3.35Å; A6-R8 PolarHBondContact O-N 3.49Å; R8-G11 PolarHBondContact O-N 3.29Å; R8-S12 PolarHBondContact O-N 2.75Å
9	N	91.5	Very high	89.2	Confident	91 Å²	91	111.1 Å²	111.1	49%	0.487	55%	0.551	S	S	.	*	H	α-helix	trans	-62.8	-44	176.7	-65.8	-4.6	0	0	0	111.2	R5 A6 G11 S12 I13	R5-N9 PolarHBondContact O-N 3.49Å; R5-N9 PolarHBondContact O-OD1 3.42Å; A6-N9 PolarHBondContact O-N 3.23Å; N9-G11 VanDerWaalsContact C-N 3.33Å; N9-G11 PolarHBondContact O-N 2.88Å; N9-S12 WeakPolarHBondContact O-CB 3.4Å; N9-S12 PolarHBondContact O-N 2.87Å; N9-I13 WeakPolarHBondContact O-CG1 3.21Å; N9-I13 PolarHBondContact O-N 3.41Å
10	L	92.9	Very high	89.7	Confident	103 Å²	103	109.1 Å²	109.1	54%	0.539	55%	0.545	S	S	.	.	H	α-helix	trans	-64	-36.6	174	-71.3	172.3	0	0	0	112.5	A6 N14	A6-L10 WeakPolarHBondContact O-CG 3.39Å; A6-L10 PolarHBondContact O-N 2.83Å; L10-N14 WeakPolarHBondContact O-CB 3.29Å; L10-N14 PolarHBondContact O-N 3.35Å; L10-N14 PolarHBondContact O-ND2 3.15Å
11	G	94.5	Very high	90.1	Very high	34 Å²	34	109.3 Å²	109.3	35%	0.351	55%	0.545	S	S	.	.	H	α-helix	trans	-62.4	-41.9	172.6	0	0	0	0	0	112.7	R7 R8 N9 T15	R7-G11 PolarHBondContact O-N 3.47Å; R8-G11 PolarHBondContact O-N 3.29Å; N9-G11 VanDerWaalsContact C-N 3.33Å; N9-G11 PolarHBondContact O-N 2.88Å; G11-T15 PolarHBondContact O-N 2.96Å; G11-T15 VanDerWaalsContact O-N 3.11Å; G11-T15 PolarHBondContact O-OG1 2.74Å
12	S	94.2	Very high	92	Very high	60 Å²	60	106.5 Å²	106.5	42%	0.42	53%	0.532	S	S	.	.	H	α-helix	trans	-63.1	-50.7	175.7	-160.7	0	0	0	0	111.1	R8 N9 N14 T15 E16	R8-S12 PolarHBondContact O-N 2.75Å; N9-S12 WeakPolarHBondContact O-CB 3.4Å; N9-S12 PolarHBondContact O-N 2.87Å; S12-N14 VanDerWaalsContact C-N 3.33Å; S12-N14 PolarHBondContact O-N 2.96Å; S12-T15 WeakPolarHBondContact O-CB 3.22Å; S12-T15 PolarHBondContact O-N 3.29Å; S12-E16 PolarHBondContact O-N 3.49Å; S12-E16 PolarHBondContact OG-OE1 3.33Å
13	I	96.4	Very high	93.6	Very high	96 Å²	96	103.2 Å²	103.2	49%	0.492	52%	0.516	S	S	.	.	H	α-helix	trans	-60.6	-42.4	-179.8	-68.3	165.5	0	0	0	111.2	N9 T15 E16 L17	N9-I13 WeakPolarHBondContact O-CG1 3.21Å; N9-I13 PolarHBondContact O-N 3.41Å; I13-T15 VanDerWaalsContact C-N 3.29Å; I13-T15 PolarHBondContact O-N 3.07Å; I13-E16 PolarHBondContact O-N 2.86Å; I13-L17 VanDerWaalsContact O-CB 3.31Å; I13-L17 WeakPolarHBondContact O-CB 3.21Å; I13-L17 PolarHBondContact O-N 3.2Å
14	N	96.1	Very high	94.5	Very high	86 Å²	86	103.7 Å²	103.7	46%	0.46	52%	0.516	S	S	.	.	H	α-helix	trans	-62.8	-37.9	176.6	-82.1	-45.5	0	0	0	111.9	L10 S12 Q18	L10-N14 WeakPolarHBondContact O-CB 3.29Å; L10-N14 PolarHBondContact O-N 3.35Å; L10-N14 PolarHBondContact O-ND2 3.15Å; S12-N14 VanDerWaalsContact C-N 3.33Å; S12-N14 PolarHBondContact O-N 2.96Å; N14-Q18 WeakPolarHBondContact O-CB 3.35Å; N14-Q18 WeakPolarHBondContact O-CG 3.48Å; N14-Q18 PolarHBondContact O-N 3.38Å
15	T	97.1	Very high	95.3	Very high	89 Å²	89	103.5 Å²	103.5	55%	0.546	51%	0.512	S	S	.	.	H	α-helix	trans	-67.1	-45.4	176.7	-53.9	0	0	0	0	111.3	G11 S12 I13 L17 Q18 D19	G11-T15 PolarHBondContact O-N 2.96Å; G11-T15 VanDerWaalsContact O-N 3.11Å; G11-T15 PolarHBondContact O-OG1 2.74Å; S12-T15 WeakPolarHBondContact O-CB 3.22Å; S12-T15 PolarHBondContact O-N 3.29Å; I13-T15 VanDerWaalsContact C-N 3.29Å; I13-T15 PolarHBondContact O-N 3.07Å; T15-L17 VanDerWaalsContact C-N 3.33Å; T15-L17 PolarHBondContact O-N 2.92Å; T15-Q18 WeakPolarHBondContact O-CB 3.46Å; T15-Q18 PolarHBondContact O-N 2.78Å; T15-D19 PolarHBondContact O-N 2.92Å
16	E	97.8	Very high	95.9	Very high	119 Å²	119	97.9 Å²	97.9	56%	0.556	50%	0.501	S	S	*	.	H	α-helix	trans	-61.6	-42.3	176.4	-72.5	172.6	-152.6	0	0	111.5	S12 I13 D19 V20	S12-E16 PolarHBondContact O-N 3.49Å; S12-E16 PolarHBondContact OG-OE1 3.33Å; I13-E16 PolarHBondContact O-N 2.86Å; E16-D19 PolarHBondContact O-N 3.49Å; E16-V20 WeakPolarHBondContact O-CG2 3.41Å; E16-V20 PolarHBondContact O-N 3.47Å
17	L	98.2	Very high	96.4	Very high	101 Å²	101	99.6 Å²	99.6	53%	0.529	50%	0.504	S	S	.	.	H	α-helix	trans	-67.1	-38	177.6	-175.9	60.4	0	0	0	112	I13 T15 D19 V20 Q21	I13-L17 VanDerWaalsContact O-CB 3.31Å; I13-L17 WeakPolarHBondContact O-CB 3.21Å; I13-L17 PolarHBondContact O-N 3.2Å; T15-L17 VanDerWaalsContact C-N 3.33Å; T15-L17 PolarHBondContact O-N 2.92Å; L17-D19 VanDerWaalsContact C-N 3.3Å; L17-D19 PolarHBondContact O-N 3.42Å; L17-V20 PolarHBondContact O-N 2.89Å; L17-Q21 WeakPolarHBondContact O-CB 3.38Å; L17-Q21 PolarHBondContact O-N 3.48Å
18	Q	98.2	Very high	96.8	Very high	128 Å²	128	96.4 Å²	96.4	60%	0.598	50%	0.498	S	S	*	.	H	α-helix	trans	-62.5	-38.8	173.1	-77.1	171.6	14.1	0	0	111.7	N14 T15 Q21 R22	N14-Q18 WeakPolarHBondContact O-CB 3.35Å; N14-Q18 WeakPolarHBondContact O-CG 3.48Å; N14-Q18 PolarHBondContact O-N 3.38Å; T15-Q18 WeakPolarHBondContact O-CB 3.46Å; T15-Q18 PolarHBondContact O-N 2.78Å; Q18-Q21 PolarHBondContact O-N 3.45Å; Q18-R22 WeakPolarHBondContact O-CB 3.38Å; Q18-R22 PolarHBondContact O-N 3.28Å
19	D	98.4	Very high	97.1	Very high	90 Å²	90	94.3 Å²	94.3	48%	0.481	50%	0.496	S	S	.	.	H	α-helix	trans	-66.7	-46.7	175.9	-170.9	55.2	0	0	0	111.6	T15 E16 L17 Q21 R22 I23	T15-D19 PolarHBondContact O-N 2.92Å; E16-D19 PolarHBondContact O-N 3.49Å; L17-D19 VanDerWaalsContact C-N 3.3Å; L17-D19 PolarHBondContact O-N 3.42Å; D19-Q21 VanDerWaalsContact C-N 3.28Å; D19-Q21 PolarHBondContact O-N 2.98Å; D19-R22 WeakPolarHBondContact O-CA 3.29Å; D19-R22 VanDerWaalsContact O-CB 3.29Å; D19-R22 WeakPolarHBondContact O-CB 3.36Å; D19-R22 PolarHBondContact O-N 3.03Å; D19-I23 WeakPolarHBondContact O-CG1 3.32Å; D19-I23 PolarHBondContact O-N 3.08Å
20	V	98.5	Very high	97.5	Very high	71 Å²	71	94 Å²	94	43%	0.43	49%	0.491	S	S	.	.	H	α-helix	trans	-57.4	-43.4	173.5	172.1	0	0	0	0	110.9	E16 L17 R22 I23 M24	E16-V20 WeakPolarHBondContact O-CG2 3.41Å; E16-V20 PolarHBondContact O-N 3.47Å; L17-V20 PolarHBondContact O-N 2.89Å; V20-R22 VanDerWaalsContact C-N 3.33Å; V20-R22 PolarHBondContact O-N 3.32Å; V20-I23 PolarHBondContact O-N 2.94Å; V20-M24 HydrophobicContact CG1-CE 4.1Å; V20-M24 HydrophobicContact CG1-CG 4.34Å; V20-M24 HydrophobicContact CG1-SD 4.31Å; V20-M24 WeakPolarHBondContact O-CG 3.39Å; V20-M24 PolarHBondContact O-N 3.4Å
21	Q	98.4	Very high	97.7	Very high	114 Å²	114	93.8 Å²	93.8	53%	0.533	49%	0.494	S	S	.	.	H	α-helix	trans	-60.6	-43.5	175.7	-176.8	179.5	-12.2	0	0	111.6	L17 Q18 D19 I23 M24 V25	L17-Q21 WeakPolarHBondContact O-CB 3.38Å; L17-Q21 PolarHBondContact O-N 3.48Å; Q18-Q21 PolarHBondContact O-N 3.45Å; D19-Q21 VanDerWaalsContact C-N 3.28Å; D19-Q21 PolarHBondContact O-N 2.98Å; Q21-I23 VanDerWaalsContact C-N 3.31Å; Q21-I23 PolarHBondContact O-N 2.71Å; Q21-M24 HydrophobicContact CB-CE 4.42Å; Q21-M24 PolarHBondContact O-N 3.3Å; Q21-V25 WeakPolarHBondContact O-CG2 3.43Å; Q21-V25 PolarHBondContact O-N 3.44Å
22	R	98.6	Very high	97.9	Very high	193 Å²	193	97.8 Å²	97.8	73%	0.728	51%	0.507	S	S	*	.	H	α-helix	trans	-58.4	-44.6	176	-166.3	-169	-162.5	95.8	4.8	111.3	Q18 D19 V20 V25 A26	Q18-R22 WeakPolarHBondContact O-CB 3.38Å; Q18-R22 PolarHBondContact O-N 3.28Å; D19-R22 WeakPolarHBondContact O-CA 3.29Å; D19-R22 VanDerWaalsContact O-CB 3.29Å; D19-R22 WeakPolarHBondContact O-CB 3.36Å; D19-R22 PolarHBondContact O-N 3.03Å; V20-R22 VanDerWaalsContact C-N 3.33Å; V20-R22 PolarHBondContact O-N 3.32Å; R22-V25 PolarHBondContact O-N 3.26Å; R22-A26 PolarHBondContact O-N 3.43Å
23	I	98.7	Very high	98.1	Very high	84 Å²	84	101.5 Å²	101.5	43%	0.431	52%	0.518	S	S	.	.	H	α-helix	trans	-65	-44.3	177.6	-66.4	166	0	0	0	110.8	D19 V20 Q21 V25 A26 N27	D19-I23 WeakPolarHBondContact O-CG1 3.32Å; D19-I23 PolarHBondContact O-N 3.08Å; V20-I23 PolarHBondContact O-N 2.94Å; Q21-I23 VanDerWaalsContact C-N 3.31Å; Q21-I23 PolarHBondContact O-N 2.71Å; I23-V25 VanDerWaalsContact C-N 3.32Å; I23-V25 PolarHBondContact O-N 2.92Å; I23-A26 PolarHBondContact O-N 2.95Å; I23-N27 WeakPolarHBondContact O-CB 3.49Å; I23-N27 PolarHBondContact O-N 3.42Å; I23-N27 PolarHBondContact O-ND2 2.75Å; I23-N27 PolarHBondContact O-OD1 2.81Å
24	M	98.6	Very high	98.1	Very high	99 Å²	99	104.4 Å²	104.4	49%	0.488	52%	0.522	S	S	.	.	H	α-helix	trans	-61	-41.9	178.4	-73.1	-170.7	-59.9	0	0	111.8	V20 Q21 N27 I28	V20-M24 HydrophobicContact CG1-CE 4.1Å; V20-M24 HydrophobicContact CG1-CG 4.34Å; V20-M24 HydrophobicContact CG1-SD 4.31Å; V20-M24 WeakPolarHBondContact O-CG 3.39Å; V20-M24 PolarHBondContact O-N 3.4Å; Q21-M24 HydrophobicContact CB-CE 4.42Å; Q21-M24 PolarHBondContact O-N 3.3Å; M24-N27 PolarHBondContact O-N 2.89Å; M24-I28 WeakPolarHBondContact O-CD1 3.37Å; M24-I28 VanDerWaalsContact O-CG1 3.25Å; M24-I28 WeakPolarHBondContact O-CG1 3.44Å; M24-I28 PolarHBondContact O-N 3.36Å
25	V	98.4	Very high	98.2	Very high	66 Å²	66	101.8 Å²	101.8	40%	0.4	52%	0.516	S	S	.	.	H	α-helix	trans	-62.6	-47.4	175.8	172	0	0	0	0	110.6	Q21 R22 I23 N27 I28 E29	Q21-V25 WeakPolarHBondContact O-CG2 3.43Å; Q21-V25 PolarHBondContact O-N 3.44Å; R22-V25 PolarHBondContact O-N 3.26Å; I23-V25 VanDerWaalsContact C-N 3.32Å; I23-V25 PolarHBondContact O-N 2.92Å; V25-N27 VanDerWaalsContact C-N 3.31Å; V25-N27 PolarHBondContact O-N 3.47Å; V25-I28 PolarHBondContact O-N 2.92Å; V25-I28 VanDerWaalsContact O-N 3.16Å; V25-E29 WeakPolarHBondContact O-CG 3.49Å; V25-E29 PolarHBondContact O-N 3Å
26	A	98.3	Very high	98.1	Very high	48 Å²	48	104.6 Å²	104.6	40%	0.397	52%	0.523	S	S	.	.	H	α-helix	trans	-59.3	-41.2	177.2	0	0	0	0	0	112.4	R22 I23 I28 E29 E30	R22-A26 PolarHBondContact O-N 3.43Å; I23-A26 PolarHBondContact O-N 2.95Å; A26-I28 PolarHBondContact O-N 3.24Å; A26-E29 PolarHBondContact O-N 3.25Å; A26-E30 WeakPolarHBondContact O-CB 3.47Å; A26-E30 PolarHBondContact O-N 2.94Å
27	N	98.1	Very high	98	Very high	81 Å²	81	101.5 Å²	101.5	43%	0.433	52%	0.518	S	S	.	.	H	α-helix	trans	-64.7	-39.3	177.2	-69.4	-13.2	0	0	0	112.1	I23 M24 V25 E30 V31	I23-N27 WeakPolarHBondContact O-CB 3.49Å; I23-N27 PolarHBondContact O-N 3.42Å; I23-N27 PolarHBondContact O-ND2 2.75Å; I23-N27 PolarHBondContact O-OD1 2.81Å; M24-N27 PolarHBondContact O-N 2.89Å; V25-N27 VanDerWaalsContact C-N 3.31Å; V25-N27 PolarHBondContact O-N 3.47Å; N27-E30 PolarHBondContact O-N 3.42Å; N27-V31 WeakPolarHBondContact O-CG2 3.47Å; N27-V31 PolarHBondContact O-N 2.88Å
28	I	98.4	Very high	98	Very high	104 Å²	104	102.7 Å²	102.7	53%	0.533	52%	0.524	S	S	.	.	H	α-helix	trans	-63.5	-47.5	176.4	-69.6	162.7	0	0	0	109.8	M24 V25 A26 E30 V31 L32	M24-I28 WeakPolarHBondContact O-CD1 3.37Å; M24-I28 VanDerWaalsContact O-CG1 3.25Å; M24-I28 WeakPolarHBondContact O-CG1 3.44Å; M24-I28 PolarHBondContact O-N 3.36Å; V25-I28 PolarHBondContact O-N 2.92Å; V25-I28 VanDerWaalsContact O-N 3.16Å; A26-I28 PolarHBondContact O-N 3.24Å; I28-E30 VanDerWaalsContact C-N 3.31Å; I28-E30 PolarHBondContact O-N 3Å; I28-V31 PolarHBondContact O-N 3.39Å; I28-L32 HydrophobicContact CG2-CD1 4.01Å; I28-L32 HydrophobicContact CG2-CG 4.44Å; I28-L32 VanDerWaalsContact O-CG 3.3Å; I28-L32 WeakPolarHBondContact O-CG 3.3Å; I28-L32 PolarHBondContact O-N 3.44Å
29	E	98.4	Very high	97.9	Very high	123 Å²	123	100.1 Å²	100.1	58%	0.575	52%	0.52	S	S	*	.	H	α-helix	trans	-59.2	-43.6	177.2	-70.7	174.3	-180	0	0	111.5	V25 A26 V31 L32 Q33	V25-E29 WeakPolarHBondContact O-CG 3.49Å; V25-E29 PolarHBondContact O-N 3Å; A26-E29 PolarHBondContact O-N 3.25Å; E29-V31 PolarHBondContact O-N 3.41Å; E29-L32 PolarHBondContact O-N 3.39Å; E29-Q33 WeakPolarHBondContact O-CB 3.4Å; E29-Q33 PolarHBondContact O-N 3.47Å
30	E	98.3	Very high	97.8	Very high	84 Å²	84	97.6 Å²	97.6	39%	0.393	52%	0.515	S	S	.	.	H	α-helix	trans	-61.5	-45.9	177	-171.9	-173.1	168.2	0	0	112	A26 N27 I28 L32 Q33 R34	A26-E30 WeakPolarHBondContact O-CB 3.47Å; A26-E30 PolarHBondContact O-N 2.94Å; N27-E30 PolarHBondContact O-N 3.42Å; I28-E30 VanDerWaalsContact C-N 3.31Å; I28-E30 PolarHBondContact O-N 3Å; E30-L32 VanDerWaalsContact C-N 3.33Å; E30-L32 PolarHBondContact O-N 2.95Å; E30-Q33 PolarHBondContact O-N 3.31Å; E30-R34 WeakPolarHBondContact O-CB 3.4Å; E30-R34 VanDerWaalsContact O-CG 3.31Å; E30-R34 WeakPolarHBondContact O-CG 3.4Å; E30-R34 PolarHBondContact O-N 3.14Å; E30-R34 IonicContact OE1-CZ 3.17Å; E30-R34 IonicContact OE1-NE 3Å; E30-R34 PolarHBondContact OE1-NE 3.5Å; E30-R34 IonicContact OE1-NH2 2.65Å; E30-R34 PolarHBondContact OE1-NH2 3.28Å
31	V	98.3	Very high	97.7	Very high	100 Å²	100	103.7 Å²	103.7	61%	0.606	53%	0.53	S	S	*	.	H	α-helix	trans	-62.2	-41.8	177.9	166.9	0	0	0	0	111	N27 I28 E29 R34 G35	N27-V31 WeakPolarHBondContact O-CG2 3.47Å; N27-V31 PolarHBondContact O-N 2.88Å; I28-V31 PolarHBondContact O-N 3.39Å; E29-V31 PolarHBondContact O-N 3.41Å; V31-R34 PolarHBondContact O-N 2.96Å; V31-G35 PolarHBondContact O-N 2.98Å
32	L	98.3	Very high	97.7	Very high	118 Å²	118	101.7 Å²	101.7	62%	0.618	53%	0.529	S	S	*	.	H	α-helix	trans	-63.3	-46.8	177.6	-71.4	173.8	0	0	0	111.6	I28 E29 E30 R34 G35 E36	I28-L32 HydrophobicContact CG2-CD1 4.01Å; I28-L32 HydrophobicContact CG2-CG 4.44Å; I28-L32 VanDerWaalsContact O-CG 3.3Å; I28-L32 WeakPolarHBondContact O-CG 3.3Å; I28-L32 PolarHBondContact O-N 3.44Å; E29-L32 PolarHBondContact O-N 3.39Å; E30-L32 VanDerWaalsContact C-N 3.33Å; E30-L32 PolarHBondContact O-N 2.95Å; L32-R34 VanDerWaalsContact C-N 3.34Å; L32-R34 PolarHBondContact O-N 2.99Å; L32-G35 PolarHBondContact O-N 2.97Å; L32-G35 VanDerWaalsContact O-N 3.1Å; L32-E36 PolarHBondContact O-N 3.48Å
33	Q	97.6	Very high	97.6	Very high	138 Å²	138	95.3 Å²	95.3	65%	0.645	52%	0.518	S	S	*	.	H	α-helix	trans	-62.4	-40.9	178.8	-171	177.7	10	0	0	112.1	E29 E30 G35 E36 A37	E29-Q33 WeakPolarHBondContact O-CB 3.4Å; E29-Q33 PolarHBondContact O-N 3.47Å; E30-Q33 PolarHBondContact O-N 3.31Å; Q33-G35 VanDerWaalsContact C-N 3.32Å; Q33-G35 PolarHBondContact O-N 2.97Å; Q33-E36 PolarHBondContact O-N 3.1Å; Q33-A37 PolarHBondContact O-N 2.96Å
34	R	97.7	Very high	97.5	Very high	156 Å²	156	97.1 Å²	97.1	59%	0.589	53%	0.526	S	S	*	.	H	α-helix	trans	-61.5	-41.1	173.1	-72.9	172.9	178.3	-131.3	5	111.4	E30 V31 L32 A37 L38	E30-R34 WeakPolarHBondContact O-CB 3.4Å; E30-R34 VanDerWaalsContact O-CG 3.31Å; E30-R34 WeakPolarHBondContact O-CG 3.4Å; E30-R34 PolarHBondContact O-N 3.14Å; E30-R34 IonicContact OE1-CZ 3.17Å; E30-R34 IonicContact OE1-NE 3Å; E30-R34 PolarHBondContact OE1-NE 3.5Å; E30-R34 IonicContact OE1-NH2 2.65Å; E30-R34 PolarHBondContact OE1-NH2 3.28Å; V31-R34 PolarHBondContact O-N 2.96Å; L32-R34 VanDerWaalsContact C-N 3.34Å; L32-R34 PolarHBondContact O-N 2.99Å; R34-A37 PolarHBondContact O-N 3.46Å; R34-L38 VanDerWaalsContact O-CG 3.3Å; R34-L38 WeakPolarHBondContact O-CG 3.31Å; R34-L38 PolarHBondContact O-N 3.43Å
35	G	97.1	Very high	97.5	Very high	31 Å²	31	95.3 Å²	95.3	32%	0.32	53%	0.527	S	S	.	.	H	α-helix	trans	-61.8	-40.8	176.6	0	0	0	0	0	113.4	V31 L32 Q33 S39	V31-G35 PolarHBondContact O-N 2.98Å; L32-G35 PolarHBondContact O-N 2.97Å; L32-G35 VanDerWaalsContact O-N 3.1Å; Q33-G35 VanDerWaalsContact C-N 3.32Å; Q33-G35 PolarHBondContact O-N 2.97Å; G35-S39 WeakPolarHBondContact O-CB 3.49Å; G35-S39 PolarHBondContact O-N 3.43Å; G35-S39 PolarHBondContact O-OG 3.35Å
36	E	96.4	Very high	97.4	Very high	149 Å²	149	101.2 Å²	101.2	70%	0.696	54%	0.542	S	S	*	.	H	α-helix	trans	-63.5	-47.4	174.2	-175	-178.3	-174	0	0	111.4	L32 Q33 L38 S39 G40	L32-E36 PolarHBondContact O-N 3.48Å; Q33-E36 PolarHBondContact O-N 3.1Å; E36-L38 PolarHBondContact O-N 3.05Å; E36-S39 WeakPolarHBondContact O-CB 3.47Å; E36-S39 PolarHBondContact O-N 3.41Å; E36-S39 VanDerWaalsContact O-N 3.14Å; E36-G40 PolarHBondContact O-N 3.25Å
37	A	95.5	Very high	97.4	Very high	54 Å²	54	102.7 Å²	102.7	45%	0.446	55%	0.549	S	S	.	.	H	α-helix	trans	-59	-45.4	177.5	0	0	0	0	0	111.8	Q33 R34 S39 G40 W41	Q33-A37 PolarHBondContact O-N 2.96Å; R34-A37 PolarHBondContact O-N 3.46Å; A37-S39 VanDerWaalsContact C-N 3.31Å; A37-S39 PolarHBondContact O-N 3.43Å; A37-G40 PolarHBondContact O-N 3.04Å; A37-W41 PolarHBondContact O-N 3.36Å
38	L	97.6	Very high	97.4	Very high	125 Å²	125	107.7 Å²	107.7	65%	0.654	56%	0.562	S	S	*	*	H	α-helix	trans	-60.9	-40.5	175.8	-71.7	173.4	0	0	0	112.1	R34 E36 W41 S42	R34-L38 VanDerWaalsContact O-CG 3.3Å; R34-L38 WeakPolarHBondContact O-CG 3.31Å; R34-L38 PolarHBondContact O-N 3.43Å; E36-L38 PolarHBondContact O-N 3.05Å; L38-W41 PolarHBondContact O-N 2.96Å; L38-S42 WeakPolarHBondContact O-CB 3.25Å; L38-S42 PolarHBondContact O-N 3.44Å
39	S	96.7	Very high	97.4	Very high	74 Å²	74	108.1 Å²	108.1	52%	0.517	57%	0.565	S	S	.	*	H	α-helix	trans	-61.8	-45.2	176.4	-59	0	0	0	0	111.1	G35 E36 A37 S42 A43	G35-S39 WeakPolarHBondContact O-CB 3.49Å; G35-S39 PolarHBondContact O-N 3.43Å; G35-S39 PolarHBondContact O-OG 3.35Å; E36-S39 WeakPolarHBondContact O-CB 3.47Å; E36-S39 PolarHBondContact O-N 3.41Å; E36-S39 VanDerWaalsContact O-N 3.14Å; A37-S39 VanDerWaalsContact C-N 3.31Å; A37-S39 PolarHBondContact O-N 3.43Å; S39-S42 PolarHBondContact O-N 3.27Å; S39-S42 PolarHBondContact O-OG 3.43Å; S39-A43 PolarHBondContact O-N 2.98Å
40	G	96.1	Very high	97.3	Very high	37 Å²	37	105.6 Å²	105.6	38%	0.381	56%	0.558	S	S	.	*	H	α-helix	trans	-59.4	-47.6	175	0	0	0	0	0	113	E36 A37 S42 A43 M44	E36-G40 PolarHBondContact O-N 3.25Å; A37-G40 PolarHBondContact O-N 3.04Å; G40-S42 VanDerWaalsContact C-N 3.34Å; G40-S42 PolarHBondContact O-N 3.16Å; G40-A43 PolarHBondContact O-N 3.48Å; G40-M44 WeakPolarHBondContact O-CG 3.33Å; G40-M44 PolarHBondContact O-N 3.49Å; G40-M44 VanDerWaalsContact O-N 3.08Å
41	W	97.1	Very high	97.2	Very high	199 Å²	199	104.3 Å²	104.3	75%	0.754	56%	0.562	S	S	*	*	H	α-helix	trans	-62.4	-40.6	176.7	-81	59.6	0	0	0	112.2	A37 L38 A43 M44 A45	A37-W41 PolarHBondContact O-N 3.36Å; L38-W41 PolarHBondContact O-N 2.96Å; W41-A43 VanDerWaalsContact C-N 3.32Å; W41-A43 PolarHBondContact O-N 2.85Å; W41-M44 PolarHBondContact O-N 3.38Å; W41-A45 WeakPolarHBondContact O-CB 3.3Å; W41-A45 PolarHBondContact O-N 2.88Å
42	S	96.7	Very high	97.2	Very high	73 Å²	73	102.3 Å²	102.3	51%	0.51	55%	0.55	S	S	.	.	H	α-helix	trans	-63.2	-38.1	177.5	79.1	0	0	0	0	112.2	L38 S39 G40 A45 R46	L38-S42 WeakPolarHBondContact O-CB 3.25Å; L38-S42 PolarHBondContact O-N 3.44Å; S39-S42 PolarHBondContact O-N 3.27Å; S39-S42 PolarHBondContact O-OG 3.43Å; G40-S42 VanDerWaalsContact C-N 3.34Å; G40-S42 PolarHBondContact O-N 3.16Å; S42-A45 PolarHBondContact O-N 3.36Å; S42-R46 WeakPolarHBondContact O-CB 3.34Å; S42-R46 PolarHBondContact O-N 2.89Å
43	A	97.1	Very high	97	Very high	59 Å²	59	100.1 Å²	100.1	49%	0.488	54%	0.541	S	S	.	.	H	α-helix	trans	-66.6	-43.5	176.6	0	0	0	0	0	111.4	S39 G40 W41 R46 S47	S39-A43 PolarHBondContact O-N 2.98Å; G40-A43 PolarHBondContact O-N 3.48Å; W41-A43 VanDerWaalsContact C-N 3.32Å; W41-A43 PolarHBondContact O-N 2.85Å; A43-R46 PolarHBondContact O-N 3.01Å; A43-S47 WeakPolarHBondContact O-CB 3.42Å; A43-S47 PolarHBondContact O-N 3.45Å
44	M	97.3	Very high	96.9	Very high	122 Å²	122	97.8 Å²	97.8	60%	0.601	53%	0.532	S	S	*	.	H	α-helix	trans	-61.7	-47.4	174.5	-68.8	178.9	73.7	0	0	111.7	G40 W41 R46 S47 W48	G40-M44 WeakPolarHBondContact O-CG 3.33Å; G40-M44 PolarHBondContact O-N 3.49Å; G40-M44 VanDerWaalsContact O-N 3.08Å; W41-M44 PolarHBondContact O-N 3.38Å; M44-R46 VanDerWaalsContact C-N 3.33Å; M44-R46 PolarHBondContact O-N 2.65Å; M44-S47 WeakPolarHBondContact O-CB 3.33Å; M44-S47 PolarHBondContact O-N 3.42Å; M44-W48 PolarHBondContact O-N 2.92Å
45	A	97.5	Very high	96.6	Very high	61 Å²	61	93.8 Å²	93.8	50%	0.504	53%	0.529	S	S	.	.	H	α-helix	trans	-59.7	-43	177.8	0	0	0	0	0	111.7	W41 S42 W48 L49	W41-A45 WeakPolarHBondContact O-CB 3.3Å; W41-A45 PolarHBondContact O-N 2.88Å; S42-A45 PolarHBondContact O-N 3.36Å; A45-W48 PolarHBondContact O-N 3.46Å; A45-L49 WeakPolarHBondContact O-CB 3.44Å; A45-L49 PolarHBondContact O-N 3.06Å
46	R	97.7	Very high	96.6	Very high	190 Å²	190	100.5 Å²	100.5	72%	0.717	54%	0.544	S	S	*	.	H	α-helix	trans	-65	-40.3	176.9	-171.1	173.8	-173.9	158.1	1.9	112.5	S42 A43 M44 L49 T50	S42-R46 WeakPolarHBondContact O-CB 3.34Å; S42-R46 PolarHBondContact O-N 2.89Å; A43-R46 PolarHBondContact O-N 3.01Å; M44-R46 VanDerWaalsContact C-N 3.33Å; M44-R46 PolarHBondContact O-N 2.65Å; R46-L49 PolarHBondContact O-N 3Å; R46-T50 WeakPolarHBondContact O-CB 3.36Å; R46-T50 PolarHBondContact O-N 2.93Å; R46-T50 PolarHBondContact O-OG1 2.86Å
47	S	97.3	Very high	96.3	Very high	79 Å²	79	97 Å²	97	55%	0.552	53%	0.533	S	S	*	.	H	α-helix	trans	-61.5	-49.9	175.2	-177	0	0	0	0	111.2	A43 M44 L49 T50 A51	A43-S47 WeakPolarHBondContact O-CB 3.42Å; A43-S47 PolarHBondContact O-N 3.45Å; M44-S47 WeakPolarHBondContact O-CB 3.33Å; M44-S47 PolarHBondContact O-N 3.42Å; S47-L49 PolarHBondContact O-N 2.92Å; S47-T50 PolarHBondContact O-N 3.49Å; S47-A51 WeakPolarHBondContact O-CB 3.15Å; S47-A51 PolarHBondContact O-N 3.25Å
48	W	98.2	Very high	95.9	Very high	185 Å²	185	99.8 Å²	99.8	70%	0.701	54%	0.537	S	S	*	.	H	α-helix	trans	-58.2	-45	176.1	-92.2	100.1	0	0	0	112.7	M44 A45 A51 T52	M44-W48 PolarHBondContact O-N 2.92Å; A45-W48 PolarHBondContact O-N 3.46Å; W48-A51 PolarHBondContact O-N 3.42Å; W48-T52 VanDerWaalsContact O-CB 3.29Å; W48-T52 WeakPolarHBondContact O-CB 3.49Å; W48-T52 PolarHBondContact O-N 2.86Å; W48-T52 PolarHBondContact O-OG1 2.87Å
49	L	98	Very high	95.4	Very high	113 Å²	113	97.7 Å²	97.7	59%	0.592	54%	0.538	S	S	*	.	H	α-helix	trans	-61.5	-46.6	176.7	-174.4	68.8	0	0	0	110.8	A45 R46 S47 A51 T52 T53	A45-L49 WeakPolarHBondContact O-CB 3.44Å; A45-L49 PolarHBondContact O-N 3.06Å; R46-L49 PolarHBondContact O-N 3Å; S47-L49 PolarHBondContact O-N 2.92Å; L49-A51 PolarHBondContact O-N 3.46Å; L49-T52 PolarHBondContact O-N 3.33Å; L49-T53 WeakPolarHBondContact O-CB 3.48Å; L49-T53 PolarHBondContact O-N 3.01Å; L49-T53 PolarHBondContact O-OG1 3.28Å
50	T	96.8	Very high	95.2	Very high	70 Å²	70	99.6 Å²	99.6	43%	0.429	54%	0.541	S	S	.	.	H	α-helix	trans	-61.1	-47.6	179.6	-56	0	0	0	0	111.3	R46 S47 T52 T53 I54	R46-T50 WeakPolarHBondContact O-CB 3.36Å; R46-T50 PolarHBondContact O-N 2.93Å; R46-T50 PolarHBondContact O-OG1 2.86Å; S47-T50 PolarHBondContact O-N 3.49Å; T50-T52 VanDerWaalsContact C-N 3.33Å; T50-T52 PolarHBondContact O-N 2.92Å; T50-T53 PolarHBondContact O-N 3.47Å; T50-I54 HydrophobicContact CG2-CD1 3.76Å; T50-I54 HydrophobicContact CG2-CG1 4.42Å; T50-I54 WeakPolarHBondContact O-CB 3.49Å; T50-I54 VanDerWaalsContact O-CG1 3.22Å; T50-I54 WeakPolarHBondContact O-CG1 3.31Å; T50-I54 PolarHBondContact O-N 2.94Å
51	A	96.5	Very high	94.7	Very high	57 Å²	57	105 Å²	105	47%	0.471	55%	0.554	S	S	.	*	H	α-helix	trans	-60.8	-43.4	177.2	0	0	0	0	0	111.8	S47 W48 L49 I54 S55	S47-A51 WeakPolarHBondContact O-CB 3.15Å; S47-A51 PolarHBondContact O-N 3.25Å; W48-A51 PolarHBondContact O-N 3.42Å; L49-A51 PolarHBondContact O-N 3.46Å; A51-I54 PolarHBondContact O-N 3.23Å; A51-S55 WeakPolarHBondContact O-CB 3.49Å; A51-S55 PolarHBondContact O-N 3.41Å
52	T	97	Very high	93.7	Very high	58 Å²	58	100.2 Å²	100.2	36%	0.356	55%	0.548	S	S	.	.	H	α-helix	trans	-63.8	-50.4	177.4	-57.5	0	0	0	0	110.5	W48 L49 T50 I54 S55 W56	W48-T52 VanDerWaalsContact O-CB 3.29Å; W48-T52 WeakPolarHBondContact O-CB 3.49Å; W48-T52 PolarHBondContact O-N 2.86Å; W48-T52 PolarHBondContact O-OG1 2.87Å; L49-T52 PolarHBondContact O-N 3.33Å; T50-T52 VanDerWaalsContact C-N 3.33Å; T50-T52 PolarHBondContact O-N 2.92Å; T52-I54 VanDerWaalsContact C-N 3.35Å; T52-I54 PolarHBondContact O-N 2.95Å; T52-S55 WeakPolarHBondContact O-CB 3.4Å; T52-S55 PolarHBondContact O-N 3.06Å; T52-S55 VanDerWaalsContact O-N 3.15Å; T52-W56 VanDerWaalsContact CG2-CD1 3.48Å; T52-W56 PolarHBondContact O-N 3.37Å
53	T	96.1	Very high	92.6	Very high	72 Å²	72	101.7 Å²	101.7	44%	0.442	56%	0.556	S	S	.	*	H	α-helix	trans	-59.2	-44.2	178.1	-59.8	0	0	0	0	111.7	L49 T50 S55 W56 V57	L49-T53 WeakPolarHBondContact O-CB 3.48Å; L49-T53 PolarHBondContact O-N 3.01Å; L49-T53 PolarHBondContact O-OG1 3.28Å; T50-T53 PolarHBondContact O-N 3.47Å; T53-S55 VanDerWaalsContact C-N 3.33Å; T53-S55 PolarHBondContact O-N 3.21Å; T53-W56 PolarHBondContact O-N 2.95Å; T53-V57 HydrophobicContact CG2-CG2 4.24Å; T53-V57 WeakPolarHBondContact O-CB 3.36Å; T53-V57 WeakPolarHBondContact O-CG2 3.29Å; T53-V57 PolarHBondContact O-N 2.95Å
54	I	94.6	Very high	90.9	Very high	89 Å²	89	107.6 Å²	107.6	46%	0.456	57%	0.567	S	S	.	*	H	α-helix	trans	-59.9	-46	175.8	-70.7	168.2	0	0	0	110.5	T50 A51 T52 V57 Q58	T50-I54 HydrophobicContact CG2-CD1 3.76Å; T50-I54 HydrophobicContact CG2-CG1 4.42Å; T50-I54 WeakPolarHBondContact O-CB 3.49Å; T50-I54 VanDerWaalsContact O-CG1 3.22Å; T50-I54 WeakPolarHBondContact O-CG1 3.31Å; T50-I54 PolarHBondContact O-N 2.94Å; A51-I54 PolarHBondContact O-N 3.23Å; T52-I54 VanDerWaalsContact C-N 3.35Å; T52-I54 PolarHBondContact O-N 2.95Å; I54-V57 PolarHBondContact O-N 2.93Å; I54-Q58 HydrophobicContact CG2-CG 4.43Å; I54-Q58 WeakPolarHBondContact O-CB 3.41Å; I54-Q58 VanDerWaalsContact O-CG 3.29Å; I54-Q58 WeakPolarHBondContact O-CG 3.46Å; I54-Q58 PolarHBondContact O-N 2.97Å
55	S	91.9	Very high	89.3	Confident	73 Å²	73	104.9 Å²	104.9	51%	0.51	56%	0.559	S	S	.	*	H	α-helix	trans	-60.4	-46.9	177.5	179.9	0	0	0	0	112.1	A51 T52 T53 V57 Q58 A59	A51-S55 WeakPolarHBondContact O-CB 3.49Å; A51-S55 PolarHBondContact O-N 3.41Å; T52-S55 WeakPolarHBondContact O-CB 3.4Å; T52-S55 PolarHBondContact O-N 3.06Å; T52-S55 VanDerWaalsContact O-N 3.15Å; T53-S55 VanDerWaalsContact C-N 3.33Å; T53-S55 PolarHBondContact O-N 3.21Å; S55-V57 PolarHBondContact O-N 3.23Å; S55-Q58 PolarHBondContact O-N 3.43Å; S55-A59 PolarHBondContact O-N 3.11Å
56	W	95.8	Very high	87.7	Confident	171 Å²	171	106.6 Å²	106.6	65%	0.648	57%	0.565	S	S	*	*	H	α-helix	trans	-63.1	-41.9	176	-83.2	97.6	0	0	0	112.6	T52 T53 Q58 A59 I60	T52-W56 VanDerWaalsContact CG2-CD1 3.48Å; T52-W56 PolarHBondContact O-N 3.37Å; T53-W56 PolarHBondContact O-N 2.95Å; W56-Q58 VanDerWaalsContact C-N 3.35Å; W56-A59 PolarHBondContact O-N 3.29Å; W56-I60 WeakPolarHBondContact O-CG1 3.43Å; W56-I60 PolarHBondContact O-N 3.36Å
57	V	91.6	Very high	85.7	Confident	77 Å²	77	104.3 Å²	104.3	47%	0.467	56%	0.562	S	S	.	*	H	α-helix	trans	-62.3	-43.3	175.9	168.2	0	0	0	0	110.5	T53 I54 S55 A59 I60 F61	T53-V57 HydrophobicContact CG2-CG2 4.24Å; T53-V57 WeakPolarHBondContact O-CB 3.36Å; T53-V57 WeakPolarHBondContact O-CG2 3.29Å; T53-V57 PolarHBondContact O-N 2.95Å; I54-V57 PolarHBondContact O-N 2.93Å; S55-V57 PolarHBondContact O-N 3.23Å; V57-A59 VanDerWaalsContact C-N 3.33Å; V57-A59 PolarHBondContact O-N 2.96Å; V57-I60 PolarHBondContact O-N 2.99Å; V57-F61 WeakPolarHBondContact O-CA 3.36Å; V57-F61 WeakPolarHBondContact O-CB 3.33Å; V57-F61 PolarHBondContact O-N 3.44Å
58	Q	87.3	Confident	83.7	Confident	112 Å²	112	107.9 Å²	107.9	52%	0.523	57%	0.565	S	S	.	*	H	α-helix	trans	-64.7	-35.6	176.5	-74.5	173.5	-18.4	0	0	112.8	I54 S55 W56 F61 P62	I54-Q58 HydrophobicContact CG2-CG 4.43Å; I54-Q58 WeakPolarHBondContact O-CB 3.41Å; I54-Q58 VanDerWaalsContact O-CG 3.29Å; I54-Q58 WeakPolarHBondContact O-CG 3.46Å; I54-Q58 PolarHBondContact O-N 2.97Å; S55-Q58 PolarHBondContact O-N 3.43Å; W56-Q58 VanDerWaalsContact C-N 3.35Å; Q58-F61 CarbonylContact O-C 3.45Å; Q58-P62 WeakPolarHBondContact O-CA 3.39Å
59	A	86.8	Confident	81.8	Confident	81 Å²	81	105.3 Å²	105.3	67%	0.669	56%	0.564	S	S	*	*	H	α-helix	trans	-69.2	-35.5	177.6	0	0	0	0	0	112.6	S55 W56 V57	S55-A59 PolarHBondContact O-N 3.11Å; W56-A59 PolarHBondContact O-N 3.29Å; V57-A59 VanDerWaalsContact C-N 3.33Å; V57-A59 PolarHBondContact O-N 2.96Å
60	I	91	Very high	80	Confident	113 Å²	113	102.1 Å²	102.1	58%	0.579	56%	0.558	S	S	*	*	H	α-helix	trans	-87	-42.2	-179.1	-63.8	169.6	0	0	0	111.6	W56 V57 P62	W56-I60 WeakPolarHBondContact O-CG1 3.43Å; W56-I60 PolarHBondContact O-N 3.36Å; V57-I60 PolarHBondContact O-N 2.99Å; I60-P62 VanDerWaalsContact C-CD 3.46Å; I60-P62 WeakPolarHBondContact O-CD 3.02Å
61	F	85.6	Confident	78.2	Confident	152 Å²	152	104.6 Å²	104.6	67%	0.667	57%	0.568	S	S	*	*	S	Bend	trans	-113	80.9	177.2	-67.1	-82	0	0	0	108.6	V57 Q58	V57-F61 WeakPolarHBondContact O-CA 3.36Å; V57-F61 WeakPolarHBondContact O-CB 3.33Å; V57-F61 PolarHBondContact O-N 3.44Å; Q58-F61 CarbonylContact O-C 3.45Å
62	P	77.9	Confident	76.3	Confident	97 Å²	97	108.6 Å²	108.6	63%	0.63	58%	0.577	S	S	*	*	P	Polyproline II helix	trans	-56.8	136	176.2	20.8	-30.2	0	0	0	109.5	Q58 I60 Y64	Q58-P62 WeakPolarHBondContact O-CA 3.39Å; I60-P62 VanDerWaalsContact C-CD 3.46Å; I60-P62 WeakPolarHBondContact O-CD 3.02Å; P62-Y64 PolarHBondContact O-N 3.48Å
63	P	72.9	Confident	74.3	Confident	105 Å²	105	109.2 Å²	109.2	68%	0.682	59%	0.588	S	S	*	*	P	Polyproline II helix	trans	-57.2	136.2	173.7	24	-31.5	0	0	0	108.9
64	Y	60.8	Low	72.6	Confident	183 Å²	183	111 Å²	111	72%	0.718	60%	0.602	S	S	*	*	P	Polyproline II helix	trans	-51.1	133.5	178.4	-146.8	-87	0	0	0	109.8	P62 Y68	P62-Y64 PolarHBondContact O-N 3.48Å; Y64-Y68 HydrophobicContact CD1-CE2 4.28Å; Y64-Y68 AromaticContact CE1-CE2 3.81Å; Y64-Y68 HydrophobicContact CE1-CE2 3.81Å
65	P	64.5	Low	70.8	Confident	64 Å²	64	110.4 Å²	110.4	42%	0.416	61%	0.611	S	S	.	*	P	Polyproline II helix	trans	-63.3	143	-174.2	24	-32.8	0	0	0	111.2	E67	P65-E67 HydrophobicContact CB-CG 4.17Å; P65-E67 PolarHBondContact O-N 3.27Å
66	P	62.4	Low	69.2	Low	98 Å²	98	112.1 Å²	112.1	64%	0.636	62%	0.618	S	S	*	*			trans	-77.9	37.5	-179.6	34.7	-35.9	0	0	0	112.3	Y68 L69	P66-Y68 PolarHBondContact O-N 3.44Å; P66-L69 HydrophobicContact CB-CD1 4.35Å; P66-L69 PolarHBondContact O-N 3.28Å
67	E	57.1	Low	67.6	Low	141 Å²	141	109.8 Å²	109.8	66%	0.659	62%	0.623	S	S	*	*	H	α-helix	trans	-69	-18	-177.7	-74.2	176.2	-166	0	0	112.6	P65 L71	P65-E67 HydrophobicContact CB-CG 4.17Å; P65-E67 PolarHBondContact O-N 3.27Å; E67-L71 WeakPolarHBondContact O-CG 3.38Å
68	Y	55.4	Low	65.7	Low	155 Å²	155	112.2 Å²	112.2	61%	0.608	64%	0.641	S	S	*	*	H	α-helix	trans	-78.3	-21.2	174.7	-58.5	-71.2	0	0	0	114.3	Y64 P66 Q72	Y64-Y68 HydrophobicContact CD1-CE2 4.28Å; Y64-Y68 AromaticContact CE1-CE2 3.81Å; Y64-Y68 HydrophobicContact CE1-CE2 3.81Å; P66-Y68 PolarHBondContact O-N 3.44Å; Y68-Q72 PolarHBondContact O-N 2.9Å
69	L	58.2	Low	64.2	Low	131 Å²	131	113.9 Å²	113.9	69%	0.686	69%	0.687	S	S	*	*	H	α-helix	trans	-77.5	-31.8	177.8	-80.6	168.7	0	0	0	112.4	P66	P66-L69 HydrophobicContact CB-CD1 4.35Å; P66-L69 PolarHBondContact O-N 3.28Å
70	G	59.9	Low	63	Low	46 Å²	46	115.5 Å²	115.5	47%	0.474	69%	0.688	S	S	.	*	H	α-helix	trans	-71.8	-33.7	174.1	0	0	0	0	0	113.1	Q72 A73	G70-Q72 VanDerWaalsContact C-N 3.34Å; G70-Q72 PolarHBondContact O-N 2.98Å; G70-A73 PolarHBondContact O-N 3.5Å
71	L	58.3	Low	61.6	Low	121 Å²	121	115.6 Å²	115.6	63%	0.634	69%	0.694	S	S	*	*	H	α-helix	trans	-70.3	-28.8	178.3	-70.5	169.1	0	0	0	112.8	E67 A75	E67-L71 WeakPolarHBondContact O-CG 3.38Å; L71-A75 PolarHBondContact O-N 3.31Å
72	Q	56.5	Low	60.2	Low	142 Å²	142	113.6 Å²	113.6	66%	0.664	70%	0.695	S	S	*	*	H	α-helix	trans	-76.1	-26.7	177.1	-166.5	157.3	-0.8	0	0	113.1	Y68 G70 A75	Y68-Q72 PolarHBondContact O-N 2.9Å; G70-Q72 VanDerWaalsContact C-N 3.34Å; G70-Q72 PolarHBondContact O-N 2.98Å; Q72-A75 PolarHBondContact O-N 3.46Å
73	A	56.6	Low	59.2	Low	70 Å²	70	114.6 Å²	114.6	58%	0.579	70%	0.699	S	S	*	*	H	α-helix	trans	-70.3	-33	174.3	0	0	0	0	0	112.7	G70 T76	G70-A73 PolarHBondContact O-N 3.5Å; A73-T76 PolarHBondContact O-OG1 3.25Å
74	C	59.7	Low	58.3	Low	109 Å²	109	115.2 Å²	115.2	74%	0.736	70%	0.7	S	S	*	*	H	α-helix	trans	-80.9	-13.9	177.1	-65.5	0	0	0	0	113.7
75	A	56.8	Low	58.2	Low	78 Å²	78	110.7 Å²	110.7	65%	0.645	70%	0.699	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87	-10	-179.5	0	0	0	0	0	113.8	L71 Q72	L71-A75 PolarHBondContact O-N 3.31Å; Q72-A75 PolarHBondContact O-N 3.46Å
76	T	59.2	Low	57.7	Low	108 Å²	108	114 Å²	114	66%	0.663	72%	0.72	S	S	*	*			trans	-103.1	70	176	49.4	0	0	0	0	111.2	A73	A73-T76 PolarHBondContact O-OG1 3.25Å
77	T	60.9	Low	57.3	Low	123 Å²	123	115.2 Å²	115.2	76%	0.755	73%	0.726	S	S	*	*			trans	-83.5	117.8	149.1	48.8	0	0	0	0	107.6	G79	T77-G79 PolarHBondContact O-N 3.14Å
78	P	52.3	Low	57.4	Low	128 Å²	128	113.1 Å²	113.1	83%	0.831	73%	0.732	S	S	*	*			trans	-74.6	112.6	167.7	23.8	-16.2	0	0	0	107.7
79	G	54.7	Low	57.6	Low	146 Å²	146	109.3 Å²	109.3	100%	1.505	74%	0.743	S	S	*	*			trans	-79.7	0	156.8	0	0	0	0	0	110	T77	T77-G79 PolarHBondContact O-N 3.14Å

Retrieved 79 of 79 residues in 58.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).