A0A087X1B7_HUMAN Loading...

Chromatin target of PRMT1

AlphaFold DB , UniProt , Accession A0A087X1B7, Species HUMAN (Homo sapiens, Human), Gene CHTOP, Length 76 aa.

						>A0A087X1B7_HUMAN|A0A087X1B7|CHTOP
MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALKLKQVGV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.4	Very low	57.3	Low	252 Å²	252	139.3 Å²	139.3	100%	1.241	83%	0.825	S	S	*	*				0	104.3	0	-157.4	156.3	-171.1	0	0	107.2
2	A	40.9	Very low	58	Low	100 Å²	100	142.8 Å²	142.8	83%	0.826	82%	0.822	S	S	*	*			trans	-93.1	126.9	-174.1	0	0	0	0	0	110.3	Q4	A2-Q4 PolarHBondContact O-N 3.12Å
3	A	55.1	Low	57.9	Low	102 Å²	102	140.5 Å²	140.5	84%	0.843	82%	0.82	S	S	*	*			trans	-66.9	126.1	179.7	0	0	0	0	0	110.5	S5	A3-S5 PolarHBondContact O-N 3.47Å
4	Q	51.8	Low	58.6	Low	195 Å²	195	140.5 Å²	140.5	91%	0.911	82%	0.822	S	S	*	*			trans	-66.4	113.7	174.5	-67.2	178.8	-0.4	0	0	108.5	A2 A6	A2-Q4 PolarHBondContact O-N 3.12Å; Q4-A6 PolarHBondContact O-N 2.92Å
5	S	59.8	Low	59	Low	112 Å²	112	136.3 Å²	136.3	78%	0.783	80%	0.8	S	S	*	*	P	Polyproline II helix	trans	-63.6	131.1	173.1	49.8	0	0	0	0	109.3	A3	A3-S5 PolarHBondContact O-N 3.47Å
6	A	64.7	Low	59.7	Low	88 Å²	88	141.4 Å²	141.4	73%	0.727	81%	0.809	S	S	*	*	P	Polyproline II helix	trans	-53.1	136.7	-178.2	0	0	0	0	0	110.8	Q4 K8	Q4-A6 PolarHBondContact O-N 2.92Å; A6-K8 PolarHBondContact O-N 3.39Å; A6-K8 VanDerWaalsContact O-N 3.09Å
7	P	58.6	Low	60.7	Low	118 Å²	118	137.8 Å²	137.8	77%	0.766	78%	0.784	S	S	*	*	P	Polyproline II helix	trans	-60.6	118.9	-177	21.5	-30.4	0	0	0	109.9	V9	P7-V9 PolarHBondContact O-N 2.93Å
8	K	63.3	Low	62	Low	193 Å²	193	133.2 Å²	133.2	84%	0.839	76%	0.762	S	S	*	*			trans	-68.8	96.9	179.6	-164.4	174.2	-173.6	176.5	0	108.9	A6 V10	A6-K8 PolarHBondContact O-N 3.39Å; A6-K8 VanDerWaalsContact O-N 3.09Å; K8-V10 HydrophobicContact CG-CG2 4.31Å; K8-V10 PolarHBondContact O-N 3.43Å
9	V	64.6	Low	62.9	Low	120 Å²	120	132.9 Å²	132.9	73%	0.727	76%	0.757	S	S	*	*			trans	-70.8	98.2	176.3	-175.3	0	0	0	0	108.5	P7 L11	P7-V9 PolarHBondContact O-N 2.93Å; V9-L11 HydrophobicContact CG1-CD1 3.96Å; V9-L11 PolarHBondContact O-N 2.94Å
10	V	68.1	Low	63.8	Low	105 Å²	105	132.3 Å²	132.3	64%	0.636	75%	0.752	S	S	*	*			trans	-89.5	101.7	172.5	-176.5	0	0	0	0	108.3	K8 K12	K8-V10 HydrophobicContact CG-CG2 4.31Å; K8-V10 PolarHBondContact O-N 3.43Å; V10-K12 PolarHBondContact O-N 3.49Å; V10-K12 VanDerWaalsContact O-N 3.11Å
11	L	62.9	Low	64.7	Low	147 Å²	147	129.8 Å²	129.8	77%	0.77	73%	0.734	S	S	*	*			trans	-69.1	104.3	166.9	-86.8	94.4	0	0	0	108.7	V9 S13	V9-L11 HydrophobicContact CG1-CD1 3.96Å; V9-L11 PolarHBondContact O-N 2.94Å; L11-S13 PolarHBondContact O-N 2.87Å; L11-S13 VanDerWaalsContact O-N 3.13Å
12	K	66.1	Low	66.6	Low	181 Å²	181	124.7 Å²	124.7	79%	0.787	70%	0.701	S	S	*	*			trans	-68.6	106.8	165.6	-64.5	-177.2	174.8	-172.4	0	107.1	V10 T14	V10-K12 PolarHBondContact O-N 3.49Å; V10-K12 VanDerWaalsContact O-N 3.11Å; K12-T14 WeakPolarHBondContact O-CG2 3.36Å; K12-T14 PolarHBondContact O-N 3.49Å
13	S	56.7	Low	68.5	Low	114 Å²	114	126 Å²	126	80%	0.797	69%	0.688	S	S	*	*			trans	-40.1	105.7	-175.4	-62.1	0	0	0	0	112.6	L11 T15	L11-S13 PolarHBondContact O-N 2.87Å; L11-S13 VanDerWaalsContact O-N 3.13Å; S13-T15 PolarHBondContact O-N 3.19Å
14	T	66.7	Low	69.8	Low	140 Å²	140	123.9 Å²	123.9	86%	0.859	67%	0.665	S	S	*	*			trans	-87.3	14.3	178.6	58.8	0	0	0	0	113	K12	K12-T14 WeakPolarHBondContact O-CG2 3.36Å; K12-T14 PolarHBondContact O-N 3.49Å
15	T	65.4	Low	71.1	Confident	78 Å²	78	117.7 Å²	117.7	48%	0.479	64%	0.638	S	S	.	*	S	Bend	trans	-116.4	127.7	177.8	-59.6	0	0	0	0	109.5	S13 M17	S13-T15 PolarHBondContact O-N 3.19Å; T15-M17 HydrophobicContact CG2-CB 4Å; T15-M17 HydrophobicContact CG2-CG 4.23Å; T15-M17 PolarHBondContact O-N 2.63Å
16	K	69.6	Low	72	Confident	217 Å²	217	118.8 Å²	118.8	94%	0.943	63%	0.632	S	S	*	*	S	Bend	trans	-67.8	10.6	177.7	-62.7	-171.7	176.9	-173.9	0	114.5
17	M	77.3	Confident	72.6	Confident	80 Å²	80	120.4 Å²	120.4	39%	0.394	63%	0.628	S	S	.	*	S	Bend	trans	-121.3	137.7	-175.9	-55	-153.6	82.6	0	0	109.7	T15 E21	T15-M17 HydrophobicContact CG2-CB 4Å; T15-M17 HydrophobicContact CG2-CG 4.23Å; T15-M17 PolarHBondContact O-N 2.63Å; M17-E21 HydrophobicContact CE-CB 4.23Å; M17-E21 HydrophobicContact CE-CG 4.26Å; M17-E21 WeakPolarHBondContact CE-OE1 3.22Å
18	S	84.6	Confident	73.3	Confident	55 Å²	55	121.9 Å²	121.9	39%	0.385	62%	0.622	S	S	.	*			trans	-70.1	154	174.9	64.9	0	0	0	0	111.4	N20 E21 R22	S18-N20 PolarHBondContact O-N 3Å; S18-E21 PolarHBondContact N-OE2 2.87Å; S18-E21 WeakPolarHBondContact O-CB 3.4Å; S18-E21 PolarHBondContact O-N 3.4Å; S18-E21 WeakPolarHBondContact OG-CB 3.24Å; S18-E21 PolarHBondContact OG-N 2.94Å; S18-E21 PolarHBondContact OG-OE2 3.39Å; S18-R22 WeakPolarHBondContact O-CG 3.09Å; S18-R22 PolarHBondContact O-N 2.87Å; S18-R22 VanDerWaalsContact O-N 3.12Å
19	L	78.1	Confident	73.5	Confident	128 Å²	128	118.9 Å²	118.9	67%	0.67	62%	0.615	S	S	*	*	H	α-helix	trans	-58.4	-35.5	171.6	-166.2	75.8	0	0	0	110.9	R22 F23	L19-R22 WeakPolarHBondContact O-CB 3.39Å; L19-R22 PolarHBondContact O-N 3.44Å; L19-F23 HydrophobicContact CD1-CE2 4.4Å; L19-F23 HydrophobicContact CD2-CE2 3.7Å; L19-F23 HydrophobicContact CD2-CZ 4.33Å; L19-F23 HydrophobicContact CG-CD2 4.16Å; L19-F23 HydrophobicContact CG-CE2 3.59Å; L19-F23 HydrophobicContact CG-CZ 4.25Å; L19-F23 VanDerWaalsContact O-CD2 3.24Å; L19-F23 WeakPolarHBondContact O-CD2 3.09Å; L19-F23 PolarHBondContact O-N 3.43Å
20	N	80.6	Confident	73.5	Confident	121 Å²	121	120.8 Å²	120.8	65%	0.647	61%	0.614	S	S	*	*	H	α-helix	trans	-62.6	-43.1	174.9	-114.8	66.4	0	0	0	112.9	S18 R22 F23 T24	S18-N20 PolarHBondContact O-N 3Å; N20-R22 VanDerWaalsContact C-N 3.27Å; N20-R22 PolarHBondContact O-N 2.78Å; N20-F23 PolarHBondContact O-N 2.77Å; N20-T24 WeakPolarHBondContact O-CB 3.46Å; N20-T24 PolarHBondContact O-N 2.95Å; N20-T24 PolarHBondContact O-OG1 3.38Å
21	E	83.1	Confident	73	Confident	80 Å²	80	123.8 Å²	123.8	37%	0.374	62%	0.621	S	S	.	*	H	α-helix	trans	-59.7	-40.4	172.1	-99.8	165.9	111.2	0	0	111.7	M17 S18 T24 N25	M17-E21 HydrophobicContact CE-CB 4.23Å; M17-E21 HydrophobicContact CE-CG 4.26Å; M17-E21 WeakPolarHBondContact CE-OE1 3.22Å; S18-E21 PolarHBondContact N-OE2 2.87Å; S18-E21 WeakPolarHBondContact O-CB 3.4Å; S18-E21 PolarHBondContact O-N 3.4Å; S18-E21 WeakPolarHBondContact OG-CB 3.24Å; S18-E21 PolarHBondContact OG-N 2.94Å; S18-E21 PolarHBondContact OG-OE2 3.39Å; E21-T24 PolarHBondContact O-N 3.41Å; E21-N25 WeakPolarHBondContact O-CB 3.04Å; E21-N25 PolarHBondContact O-N 3.43Å; E21-N25 PolarHBondContact O-ND2 2.74Å
22	R	79.9	Confident	72.7	Confident	145 Å²	145	119.8 Å²	119.8	55%	0.547	60%	0.604	S	S	.	*	H	α-helix	trans	-62.7	-48.3	178.6	-64.3	-74.1	-79.4	-138.5	-6.4	110.9	S18 L19 N20 T24 N25 M26	S18-R22 WeakPolarHBondContact O-CG 3.09Å; S18-R22 PolarHBondContact O-N 2.87Å; S18-R22 VanDerWaalsContact O-N 3.12Å; L19-R22 WeakPolarHBondContact O-CB 3.39Å; L19-R22 PolarHBondContact O-N 3.44Å; N20-R22 VanDerWaalsContact C-N 3.27Å; N20-R22 PolarHBondContact O-N 2.78Å; R22-T24 VanDerWaalsContact C-N 3.34Å; R22-T24 PolarHBondContact O-N 3.39Å; R22-N25 PolarHBondContact O-N 2.77Å; R22-M26 WeakPolarHBondContact O-CG 3.4Å; R22-M26 PolarHBondContact O-N 2.74Å
23	F	81.8	Confident	72.2	Confident	126 Å²	126	115.5 Å²	115.5	55%	0.553	59%	0.593	S	S	*	*	H	α-helix	trans	-62.1	-41.1	175.9	-70.1	-53.7	0	0	0	112.6	L19 N20 N25 M26 L27	L19-F23 HydrophobicContact CD1-CE2 4.4Å; L19-F23 HydrophobicContact CD2-CE2 3.7Å; L19-F23 HydrophobicContact CD2-CZ 4.33Å; L19-F23 HydrophobicContact CG-CD2 4.16Å; L19-F23 HydrophobicContact CG-CE2 3.59Å; L19-F23 HydrophobicContact CG-CZ 4.25Å; L19-F23 VanDerWaalsContact O-CD2 3.24Å; L19-F23 WeakPolarHBondContact O-CD2 3.09Å; L19-F23 PolarHBondContact O-N 3.43Å; N20-F23 PolarHBondContact O-N 2.77Å; F23-N25 VanDerWaalsContact C-N 3.34Å; F23-N25 PolarHBondContact O-N 3.42Å; F23-M26 PolarHBondContact O-N 3.29Å; F23-L27 PolarHBondContact O-N 3.16Å
24	T	82.3	Confident	72.2	Confident	59 Å²	59	115.2 Å²	115.2	36%	0.362	59%	0.588	S	S	.	*	H	α-helix	trans	-61.3	-42.8	177.8	-57.7	0	0	0	0	111.5	N20 E21 R22 L27 K28	N20-T24 WeakPolarHBondContact O-CB 3.46Å; N20-T24 PolarHBondContact O-N 2.95Å; N20-T24 PolarHBondContact O-OG1 3.38Å; E21-T24 PolarHBondContact O-N 3.41Å; R22-T24 VanDerWaalsContact C-N 3.34Å; R22-T24 PolarHBondContact O-N 3.39Å; T24-L27 PolarHBondContact O-N 3.28Å; T24-K28 HydrophobicContact CG2-CD 4.03Å; T24-K28 WeakPolarHBondContact O-CB 3.32Å; T24-K28 VanDerWaalsContact O-CG 3.27Å; T24-K28 WeakPolarHBondContact O-CG 3.44Å; T24-K28 PolarHBondContact O-N 3.02Å
25	N	80	Confident	71.8	Confident	65 Å²	65	114.9 Å²	114.9	35%	0.348	59%	0.586	S	S	.	*	H	α-helix	trans	-68.9	-36.1	178.8	-70.1	-17	0	0	0	112.3	E21 R22 F23 L27 K28 N29	E21-N25 WeakPolarHBondContact O-CB 3.04Å; E21-N25 PolarHBondContact O-N 3.43Å; E21-N25 PolarHBondContact O-ND2 2.74Å; R22-N25 PolarHBondContact O-N 2.77Å; F23-N25 VanDerWaalsContact C-N 3.34Å; F23-N25 PolarHBondContact O-N 3.42Å; N25-L27 VanDerWaalsContact C-N 3.33Å; N25-K28 PolarHBondContact O-N 3.38Å; N25-N29 PolarHBondContact O-N 2.88Å
26	M	77.5	Confident	71.3	Confident	135 Å²	135	116.1 Å²	116.1	67%	0.665	59%	0.589	S	S	*	*	H	α-helix	trans	-65.2	-37	173.2	-68.8	177.2	77.3	0	0	111.8	R22 F23	R22-M26 WeakPolarHBondContact O-CG 3.4Å; R22-M26 PolarHBondContact O-N 2.74Å; F23-M26 PolarHBondContact O-N 3.29Å
27	L	78.4	Confident	70.7	Confident	122 Å²	122	108.6 Å²	108.6	64%	0.639	56%	0.559	S	S	*	*	H	α-helix	trans	-74.8	-31.8	178.6	-161.2	70.3	0	0	0	113	F23 T24 N25 K30	F23-L27 PolarHBondContact O-N 3.16Å; T24-L27 PolarHBondContact O-N 3.28Å; N25-L27 VanDerWaalsContact C-N 3.33Å; L27-K30 VanDerWaalsContact O-CG 3.23Å; L27-K30 WeakPolarHBondContact O-CG 3.46Å
28	K	73.3	Confident	69.9	Low	149 Å²	149	114.9 Å²	114.9	65%	0.648	58%	0.578	S	S	*	*	H	α-helix	trans	-72.1	-31.7	175	-75.2	172.8	178	176.4	0	112.5	T24 N25 K30	T24-K28 HydrophobicContact CG2-CD 4.03Å; T24-K28 WeakPolarHBondContact O-CB 3.32Å; T24-K28 VanDerWaalsContact O-CG 3.27Å; T24-K28 WeakPolarHBondContact O-CG 3.44Å; T24-K28 PolarHBondContact O-N 3.02Å; N25-K28 PolarHBondContact O-N 3.38Å; K28-K30 PolarHBondContact O-N 3.07Å
29	N	67.1	Low	68.8	Low	130 Å²	130	115 Å²	115	70%	0.695	58%	0.583	S	S	*	*	S	Bend	trans	-76.2	62.6	170.3	-70	-15.2	0	0	0	110.3	N25	N25-N29 PolarHBondContact O-N 2.88Å
30	K	63.6	Low	68.1	Low	159 Å²	159	110.6 Å²	110.6	69%	0.691	56%	0.562	S	S	*	*			trans	-68.2	138.8	167	-62.8	-171.9	-176.7	-70.3	0	108.2	L27 K28	L27-K30 VanDerWaalsContact O-CG 3.23Å; L27-K30 WeakPolarHBondContact O-CG 3.46Å; K28-K30 PolarHBondContact O-N 3.07Å
31	Q	58.5	Low	67.6	Low	168 Å²	168	109.6 Å²	109.6	79%	0.785	56%	0.555	S	S	*	*			trans	-42.7	130.6	-173.6	-65.9	-72.9	83	0	0	112.4
32	P	55.6	Low	67	Low	63 Å²	63	111.3 Å²	111.3	41%	0.409	56%	0.563	S	S	.	*			trans	-59.9	144.9	175.7	16.4	-21.3	0	0	0	110.8	I37	P32-I37 HydrophobicContact CB-CG1 4.4Å; P32-I37 HydrophobicContact CG-CG1 4.26Å; P32-I37 VanDerWaalsContact O-CD1 3.28Å; P32-I37 WeakPolarHBondContact O-CD1 3.12Å; P32-I37 WeakPolarHBondContact O-CG1 3.28Å
33	T	55.9	Low	66.6	Low	91 Å²	91	110.2 Å²	110.2	56%	0.558	56%	0.564	S	S	*	*			trans	-57.2	139.6	178.8	42.9	0	0	0	0	111.5	V35 N36 I37	T33-V35 VanDerWaalsContact C-N 3.26Å; T33-V35 PolarHBondContact O-N 3.38Å; T33-N36 PolarHBondContact O-N 3.31Å; T33-I37 PolarHBondContact O-N 3.24Å
34	P	57.2	Low	66.1	Low	109 Å²	109	110.5 Å²	110.5	71%	0.708	57%	0.567	S	S	*	*	H	α-helix	trans	-56	-28.8	-162.7	15.5	-28.9	0	0	0	116.4	I37	P34-I37 HydrophobicContact CB-CD1 4.22Å; P34-I37 PolarHBondContact O-N 3.14Å
35	V	57.4	Low	65.6	Low	132 Å²	132	114.1 Å²	114.1	80%	0.8	58%	0.58	S	S	*	*	H	α-helix	trans	-76.2	-27.3	176.4	-77.4	0	0	0	0	113.7	T33	T33-V35 VanDerWaalsContact C-N 3.26Å; T33-V35 PolarHBondContact O-N 3.38Å
36	N	55.3	Low	65.3	Low	104 Å²	104	117.4 Å²	117.4	56%	0.556	59%	0.593	S	S	*	*	H	α-helix	trans	-88.5	-9.1	171	-92.3	3.1	0	0	0	112.7	T33 R38 S40	T33-N36 PolarHBondContact O-N 3.31Å; N36-R38 PolarHBondContact O-N 3.48Å; N36-S40 WeakPolarHBondContact O-CB 3.47Å; N36-S40 PolarHBondContact O-N 2.78Å; N36-S40 PolarHBondContact O-OG 2.85Å
37	I	56.9	Low	65.1	Low	59 Å²	59	115.7 Å²	115.7	30%	0.303	59%	0.586	S	S	.	*	H	α-helix	trans	-62.5	-43.3	-179.9	-66.2	-179.7	0	0	0	110.9	P32 T33 P34 S40 M41	P32-I37 HydrophobicContact CB-CG1 4.4Å; P32-I37 HydrophobicContact CG-CG1 4.26Å; P32-I37 VanDerWaalsContact O-CD1 3.28Å; P32-I37 WeakPolarHBondContact O-CD1 3.12Å; P32-I37 WeakPolarHBondContact O-CG1 3.28Å; T33-I37 PolarHBondContact O-N 3.24Å; P34-I37 HydrophobicContact CB-CD1 4.22Å; P34-I37 PolarHBondContact O-N 3.14Å; I37-S40 WeakPolarHBondContact CA-OG 3.04Å; I37-S40 PolarHBondContact O-N 3.2Å; I37-S40 PolarHBondContact O-OG 2.84Å; I37-M41 HydrophobicContact CG2-CG 3.56Å; I37-M41 WeakPolarHBondContact O-CA 3Å; I37-M41 WeakPolarHBondContact O-CB 3.44Å; I37-M41 WeakPolarHBondContact O-CG 3.4Å; I37-M41 PolarHBondContact O-N 2.97Å
38	R	61.4	Low	64.8	Low	212 Å²	212	111.8 Å²	111.8	80%	0.8	57%	0.572	S	S	*	*	H	α-helix	trans	-66.8	-45.8	-173.8	-145.7	171.7	-164.3	165.8	2.9	112.2	N36 Q42	N36-R38 PolarHBondContact O-N 3.48Å; R38-Q42 WeakPolarHBondContact O-CG 3.28Å; R38-Q42 PolarHBondContact O-N 3.42Å; R38-Q42 VanDerWaalsContact O-N 3.12Å
39	A	61.2	Low	65.3	Low	58 Å²	58	107 Å²	107	48%	0.479	56%	0.557	S	S	.	*	H	α-helix	trans	-69.7	-43.6	176.2	0	0	0	0	0	112.1	Q42 Q43	A39-Q42 PolarHBondContact O-N 3.2Å; A39-Q43 WeakPolarHBondContact O-CB 3.14Å; A39-Q43 PolarHBondContact O-N 3.07Å
40	S	63.2	Low	66.1	Low	35 Å²	35	102.3 Å²	102.3	25%	0.245	54%	0.536	C	S	.	.	H	α-helix	trans	-68.5	-33.4	177.8	65.7	0	0	0	0	112.7	N36 I37 Q43 Q44	N36-S40 WeakPolarHBondContact O-CB 3.47Å; N36-S40 PolarHBondContact O-N 2.78Å; N36-S40 PolarHBondContact O-OG 2.85Å; I37-S40 WeakPolarHBondContact CA-OG 3.04Å; I37-S40 PolarHBondContact O-N 3.2Å; I37-S40 PolarHBondContact O-OG 2.84Å; S40-Q43 PolarHBondContact O-N 2.86Å; S40-Q44 WeakPolarHBondContact O-CA 3.48Å; S40-Q44 WeakPolarHBondContact O-CB 3.46Å; S40-Q44 PolarHBondContact O-N 3.34Å
41	M	70.3	Confident	67.3	Low	101 Å²	101	103.4 Å²	103.4	50%	0.498	54%	0.536	S	S	.	.	H	α-helix	trans	-67	-44.4	173.7	-76.5	-74.9	-73.3	0	0	110.8	I37 Q44 Q45	I37-M41 HydrophobicContact CG2-CG 3.56Å; I37-M41 WeakPolarHBondContact O-CA 3Å; I37-M41 WeakPolarHBondContact O-CB 3.44Å; I37-M41 WeakPolarHBondContact O-CG 3.4Å; I37-M41 PolarHBondContact O-N 2.97Å; M41-Q44 PolarHBondContact O-N 2.88Å; M41-Q45 WeakPolarHBondContact O-CB 3.39Å; M41-Q45 PolarHBondContact O-N 3.47Å
42	Q	69.4	Low	68.8	Low	115 Å²	115	100.3 Å²	100.3	54%	0.537	53%	0.525	S	S	.	.	H	α-helix	trans	-61.9	-45.1	175.2	-74.8	177.4	-38	0	0	111.4	R38 A39 Q45 Q46	R38-Q42 WeakPolarHBondContact O-CG 3.28Å; R38-Q42 PolarHBondContact O-N 3.42Å; R38-Q42 VanDerWaalsContact O-N 3.12Å; A39-Q42 PolarHBondContact O-N 3.2Å; Q42-Q45 PolarHBondContact O-N 3.45Å; Q42-Q46 WeakPolarHBondContact O-CB 3.47Å; Q42-Q46 VanDerWaalsContact O-CG 3.22Å; Q42-Q46 WeakPolarHBondContact O-CG 3.23Å; Q42-Q46 PolarHBondContact O-N 2.89Å
43	Q	72	Confident	70.5	Confident	123 Å²	123	104.9 Å²	104.9	58%	0.575	53%	0.534	S	S	*	.	H	α-helix	trans	-66.4	-42.4	177.8	-168.9	175.8	13.8	0	0	112	A39 S40 Q46 L47	A39-Q43 WeakPolarHBondContact O-CB 3.14Å; A39-Q43 PolarHBondContact O-N 3.07Å; S40-Q43 PolarHBondContact O-N 2.86Å; Q43-Q46 PolarHBondContact O-N 3.46Å; Q43-L47 HydrophobicContact CG-CD1 4.22Å; Q43-L47 WeakPolarHBondContact O-CB 3.43Å; Q43-L47 VanDerWaalsContact O-CG 3.24Å; Q43-L47 WeakPolarHBondContact O-CG 3.36Å; Q43-L47 PolarHBondContact O-N 2.98Å
44	Q	71.1	Confident	72.2	Confident	131 Å²	131	108.6 Å²	108.6	61%	0.612	54%	0.538	S	S	*	.	H	α-helix	trans	-67.1	-38.5	177.3	-174.8	172.5	71.8	0	0	111.2	S40 M41 L47 A48	S40-Q44 WeakPolarHBondContact O-CA 3.48Å; S40-Q44 WeakPolarHBondContact O-CB 3.46Å; S40-Q44 PolarHBondContact O-N 3.34Å; M41-Q44 PolarHBondContact O-N 2.88Å; Q44-L47 PolarHBondContact O-N 3.12Å; Q44-A48 WeakPolarHBondContact O-CB 3.35Å; Q44-A48 PolarHBondContact O-N 3.39Å
45	Q	71.8	Confident	73.9	Confident	135 Å²	135	107.4 Å²	107.4	63%	0.631	53%	0.525	S	S	*	.	H	α-helix	trans	-66.1	-43	175.9	-165.7	169.1	31.5	0	0	110.5	M41 Q42 A48 S49	M41-Q45 WeakPolarHBondContact O-CB 3.39Å; M41-Q45 PolarHBondContact O-N 3.47Å; Q42-Q45 PolarHBondContact O-N 3.45Å; Q45-A48 PolarHBondContact O-N 3.34Å; Q45-S49 VanDerWaalsContact O-CB 3.28Å; Q45-S49 WeakPolarHBondContact O-CB 3.41Å; Q45-S49 PolarHBondContact O-N 3.47Å; Q45-S49 PolarHBondContact O-OG 3.27Å
46	Q	73.4	Confident	75.4	Confident	134 Å²	134	103.8 Å²	103.8	63%	0.626	51%	0.509	S	S	*	.	H	α-helix	trans	-61.9	-46.1	174.1	-72.2	170.8	16.1	0	0	112.2	Q42 Q43 S49 A50	Q42-Q46 WeakPolarHBondContact O-CB 3.47Å; Q42-Q46 VanDerWaalsContact O-CG 3.22Å; Q42-Q46 WeakPolarHBondContact O-CG 3.23Å; Q42-Q46 PolarHBondContact O-N 2.89Å; Q43-Q46 PolarHBondContact O-N 3.46Å; Q46-S49 PolarHBondContact O-N 2.81Å; Q46-A50 WeakPolarHBondContact O-CB 3.27Å; Q46-A50 PolarHBondContact O-N 3.05Å
47	L	74.6	Confident	77.1	Confident	99 Å²	99	104.5 Å²	104.5	52%	0.518	51%	0.509	S	S	.	.	H	α-helix	trans	-64.5	-41.7	177.1	-71.8	171.1	0	0	0	111.9	Q43 Q44 A50 R51	Q43-L47 HydrophobicContact CG-CD1 4.22Å; Q43-L47 WeakPolarHBondContact O-CB 3.43Å; Q43-L47 VanDerWaalsContact O-CG 3.24Å; Q43-L47 WeakPolarHBondContact O-CG 3.36Å; Q43-L47 PolarHBondContact O-N 2.98Å; Q44-L47 PolarHBondContact O-N 3.12Å; L47-A50 PolarHBondContact O-N 3.38Å; L47-R51 WeakPolarHBondContact O-CG 3.46Å; L47-R51 PolarHBondContact O-N 3.33Å
48	A	71.4	Confident	78.8	Confident	40 Å²	40	107.8 Å²	107.8	33%	0.331	52%	0.523	S	S	.	.	H	α-helix	trans	-66.4	-44.4	176.1	0	0	0	0	0	111.3	Q44 Q45 A50 R51 N52	Q44-A48 WeakPolarHBondContact O-CB 3.35Å; Q44-A48 PolarHBondContact O-N 3.39Å; Q45-A48 PolarHBondContact O-N 3.34Å; A48-A50 VanDerWaalsContact C-N 3.32Å; A48-A50 PolarHBondContact O-N 3.02Å; A48-R51 PolarHBondContact O-N 3.22Å; A48-N52 WeakPolarHBondContact O-CB 2.99Å; A48-N52 PolarHBondContact O-N 3.46Å; A48-N52 PolarHBondContact O-OD1 3.12Å
49	S	85.1	Confident	80.1	Confident	49 Å²	49	101.6 Å²	101.6	34%	0.343	50%	0.504	S	S	.	.	H	α-helix	trans	-59.1	-42.5	174.2	-66.9	0	0	0	0	111.7	Q45 Q46 N52 R53	Q45-S49 VanDerWaalsContact O-CB 3.28Å; Q45-S49 WeakPolarHBondContact O-CB 3.41Å; Q45-S49 PolarHBondContact O-N 3.47Å; Q45-S49 PolarHBondContact O-OG 3.27Å; Q46-S49 PolarHBondContact O-N 2.81Å; S49-N52 PolarHBondContact O-N 3.3Å; S49-R53 WeakPolarHBondContact O-CB 3.49Å; S49-R53 WeakPolarHBondContact O-CG 3.44Å; S49-R53 PolarHBondContact O-N 2.98Å
50	A	82.3	Confident	81.4	Confident	31 Å²	31	105.3 Å²	105.3	26%	0.256	51%	0.511	S	S	.	.	H	α-helix	trans	-63.2	-42.8	175.8	0	0	0	0	0	112.2	Q46 L47 A48 R54	Q46-A50 WeakPolarHBondContact O-CB 3.27Å; Q46-A50 PolarHBondContact O-N 3.05Å; L47-A50 PolarHBondContact O-N 3.38Å; A48-A50 VanDerWaalsContact C-N 3.32Å; A48-A50 PolarHBondContact O-N 3.02Å; A50-R54 WeakPolarHBondContact O-CG 3.34Å; A50-R54 PolarHBondContact O-N 2.93Å; A50-R54 VanDerWaalsContact O-N 3.16Å
51	R	89.3	Confident	82.6	Confident	182 Å²	182	109.3 Å²	109.3	69%	0.687	53%	0.53	S	S	*	.	H	α-helix	trans	-65	-41.9	175.2	-73.1	176.7	177	179	0.2	112.1	L47 A48 R54 L55	L47-R51 WeakPolarHBondContact O-CG 3.46Å; L47-R51 PolarHBondContact O-N 3.33Å; A48-R51 PolarHBondContact O-N 3.22Å; R51-R54 PolarHBondContact O-N 3.35Å; R51-L55 PolarHBondContact O-N 2.78Å
52	N	91	Very high	83.7	Confident	103 Å²	103	111.3 Å²	111.3	55%	0.551	53%	0.532	S	S	*	.	H	α-helix	trans	-67.4	-38.8	178.6	-71.9	-2.5	0	0	0	111.7	A48 S49 R54 L55 A56	A48-N52 WeakPolarHBondContact O-CB 2.99Å; A48-N52 PolarHBondContact O-N 3.46Å; A48-N52 PolarHBondContact O-OD1 3.12Å; S49-N52 PolarHBondContact O-N 3.3Å; N52-R54 VanDerWaalsContact C-N 3.34Å; N52-R54 PolarHBondContact O-N 3.43Å; N52-L55 PolarHBondContact O-N 3.18Å; N52-A56 WeakPolarHBondContact O-CB 3.4Å; N52-A56 PolarHBondContact O-N 2.93Å
53	R	89.6	Confident	84.7	Confident	159 Å²	159	110.8 Å²	110.8	60%	0.6	54%	0.539	S	S	*	.	H	α-helix	trans	-58.6	-45.8	172	-77.2	-169.8	-63.4	-104.2	4.9	111.5	S49 A56 Q57	S49-R53 WeakPolarHBondContact O-CB 3.49Å; S49-R53 WeakPolarHBondContact O-CG 3.44Å; S49-R53 PolarHBondContact O-N 2.98Å; R53-A56 PolarHBondContact O-N 3.43Å; R53-Q57 WeakPolarHBondContact O-CG 3.24Å; R53-Q57 PolarHBondContact O-N 2.98Å
54	R	92.6	Very high	85.4	Confident	170 Å²	170	108.6 Å²	108.6	64%	0.642	54%	0.537	S	S	*	.	H	α-helix	trans	-62.5	-42.1	175.3	-70.4	176.3	-178.7	173.2	0.8	112.1	A50 R51 N52 A56 Q57 Q58	A50-R54 WeakPolarHBondContact O-CG 3.34Å; A50-R54 PolarHBondContact O-N 2.93Å; A50-R54 VanDerWaalsContact O-N 3.16Å; R51-R54 PolarHBondContact O-N 3.35Å; N52-R54 VanDerWaalsContact C-N 3.34Å; N52-R54 PolarHBondContact O-N 3.43Å; R54-A56 VanDerWaalsContact C-N 3.35Å; R54-Q57 PolarHBondContact O-N 3.17Å; R54-Q58 WeakPolarHBondContact O-CG 3.33Å; R54-Q58 PolarHBondContact O-N 3.38Å
55	L	91.9	Very high	86.1	Confident	84 Å²	84	104 Å²	104	44%	0.44	52%	0.518	S	S	.	.	H	α-helix	trans	-62.6	-42.1	176.4	178.1	60.9	0	0	0	111.5	R51 N52 Q58 M59	R51-L55 PolarHBondContact O-N 2.78Å; N52-L55 PolarHBondContact O-N 3.18Å; L55-Q58 WeakPolarHBondContact O-CB 3.45Å; L55-Q58 PolarHBondContact O-N 2.88Å; L55-M59 HydrophobicContact CD1-CG 4.15Å; L55-M59 HydrophobicContact CD1-SD 4.32Å; L55-M59 HydrophobicContact CG-CG 4.36Å; L55-M59 HydrophobicContact CG-SD 4.11Å; L55-M59 WeakPolarHBondContact O-CB 3.45Å; L55-M59 VanDerWaalsContact O-CG 3.29Å; L55-M59 WeakPolarHBondContact O-CG 3.4Å; L55-M59 PolarHBondContact O-N 3.26Å
56	A	89.3	Confident	86.8	Confident	55 Å²	55	101.5 Å²	101.5	46%	0.455	51%	0.506	S	S	.	.	H	α-helix	trans	-60.5	-46.2	176.6	0	0	0	0	0	111.5	N52 R53 R54 Q58 M59 E60	N52-A56 WeakPolarHBondContact O-CB 3.4Å; N52-A56 PolarHBondContact O-N 2.93Å; R53-A56 PolarHBondContact O-N 3.43Å; R54-A56 VanDerWaalsContact C-N 3.35Å; A56-Q58 VanDerWaalsContact C-N 3.3Å; A56-Q58 PolarHBondContact O-N 2.95Å; A56-M59 PolarHBondContact O-N 3.01Å; A56-M59 VanDerWaalsContact O-N 3.14Å; A56-E60 WeakPolarHBondContact O-CB 3.29Å; A56-E60 PolarHBondContact O-N 2.98Å
57	Q	90.7	Very high	87.3	Confident	119 Å²	119	97.5 Å²	97.5	56%	0.556	50%	0.496	S	S	*	.	H	α-helix	trans	-59.9	-39.9	174.3	-70	173.1	-22.5	0	0	112.2	R53 R54 N61	R53-Q57 WeakPolarHBondContact O-CG 3.24Å; R53-Q57 PolarHBondContact O-N 2.98Å; R54-Q57 PolarHBondContact O-N 3.17Å; Q57-N61 PolarHBondContact O-N 2.97Å; Q57-N61 PolarHBondContact O-ND2 3.04Å
58	Q	93.1	Very high	87.7	Confident	129 Å²	129	95.5 Å²	95.5	60%	0.603	49%	0.493	S	S	*	.	H	α-helix	trans	-65.6	-44.5	174.6	-73.7	179	-16.7	0	0	111.3	R54 L55 A56 E60 N61 R62	R54-Q58 WeakPolarHBondContact O-CG 3.33Å; R54-Q58 PolarHBondContact O-N 3.38Å; L55-Q58 WeakPolarHBondContact O-CB 3.45Å; L55-Q58 PolarHBondContact O-N 2.88Å; A56-Q58 VanDerWaalsContact C-N 3.3Å; A56-Q58 PolarHBondContact O-N 2.95Å; Q58-E60 VanDerWaalsContact C-N 3.33Å; Q58-E60 PolarHBondContact O-N 3.46Å; Q58-N61 PolarHBondContact O-N 2.88Å; Q58-R62 WeakPolarHBondContact O-CG 3.29Å; Q58-R62 PolarHBondContact O-N 3.47Å
59	M	90	Very high	88.2	Confident	82 Å²	82	98 Å²	98	40%	0.404	50%	0.501	S	S	.	.	H	α-helix	trans	-63.7	-38.1	179.9	-74.1	-176.5	70.1	0	0	112.3	L55 A56 N61 R62 V65	L55-M59 HydrophobicContact CD1-CG 4.15Å; L55-M59 HydrophobicContact CD1-SD 4.32Å; L55-M59 HydrophobicContact CG-CG 4.36Å; L55-M59 HydrophobicContact CG-SD 4.11Å; L55-M59 WeakPolarHBondContact O-CB 3.45Å; L55-M59 VanDerWaalsContact O-CG 3.29Å; L55-M59 WeakPolarHBondContact O-CG 3.4Å; L55-M59 PolarHBondContact O-N 3.26Å; A56-M59 PolarHBondContact O-N 3.01Å; A56-M59 VanDerWaalsContact O-N 3.14Å; M59-N61 PolarHBondContact O-N 3.38Å; M59-R62 WeakPolarHBondContact O-CB 3.33Å; M59-R62 PolarHBondContact O-N 2.99Å; M59-R62 VanDerWaalsContact O-N 3.12Å; M59-V65 VanDerWaalsContact O-CB 3.24Å; M59-V65 WeakPolarHBondContact O-CB 3.39Å; M59-V65 WeakPolarHBondContact O-CG1 3.48Å
60	E	86.9	Confident	87.9	Confident	135 Å²	135	102.3 Å²	102.3	63%	0.631	51%	0.513	S	S	*	.	H	α-helix	trans	-59	-36.4	175.3	-172.5	176.7	166.5	0	0	112.4	A56 Q58 R62 Q66	A56-E60 WeakPolarHBondContact O-CB 3.29Å; A56-E60 PolarHBondContact O-N 2.98Å; Q58-E60 VanDerWaalsContact C-N 3.33Å; Q58-E60 PolarHBondContact O-N 3.46Å; E60-R62 VanDerWaalsContact C-N 3.33Å; E60-R62 PolarHBondContact O-N 3.19Å; E60-Q66 WeakPolarHBondContact O-CG 3.37Å; E60-Q66 PolarHBondContact O-NE2 3Å
61	N	89.3	Confident	87.3	Confident	119 Å²	119	107.3 Å²	107.3	64%	0.636	54%	0.535	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.8	-2.2	179.1	-69.7	-55.3	0	0	0	114.1	Q57 Q58 M59 P63	Q57-N61 PolarHBondContact O-N 2.97Å; Q57-N61 PolarHBondContact O-ND2 3.04Å; Q58-N61 PolarHBondContact O-N 2.88Å; M59-N61 PolarHBondContact O-N 3.38Å; N61-P63 WeakPolarHBondContact O-CD 3.41Å
62	R	93.4	Very high	86.2	Confident	143 Å²	143	106.5 Å²	106.5	54%	0.54	54%	0.537	S	S	.	.			trans	-81.8	123.5	179.5	-71.4	179	77.3	172.2	4	110.4	Q58 M59 E60 S64 V65 Q66	Q58-R62 WeakPolarHBondContact O-CG 3.29Å; Q58-R62 PolarHBondContact O-N 3.47Å; M59-R62 WeakPolarHBondContact O-CB 3.33Å; M59-R62 PolarHBondContact O-N 2.99Å; M59-R62 VanDerWaalsContact O-N 3.12Å; E60-R62 VanDerWaalsContact C-N 3.33Å; E60-R62 PolarHBondContact O-N 3.19Å; R62-S64 VanDerWaalsContact C-N 3.26Å; R62-S64 PolarHBondContact O-N 3.36Å; R62-V65 HydrophobicContact CB-CB 4.11Å; R62-V65 HydrophobicContact CB-CG2 3.79Å; R62-V65 WeakPolarHBondContact O-CB 3.37Å; R62-V65 PolarHBondContact O-N 2.97Å; R62-Q66 PolarHBondContact O-N 3.39Å
63	P	89.1	Confident	84.8	Confident	105 Å²	105	109 Å²	109	68%	0.682	55%	0.545	S	S	*	.	H	α-helix	trans	-56.7	-37.7	-179.6	-27.3	34.8	0	0	0	113.8	N61 V65 Q66 A67	N61-P63 WeakPolarHBondContact O-CD 3.41Å; P63-V65 VanDerWaalsContact C-N 3.34Å; P63-V65 PolarHBondContact O-N 3.3Å; P63-Q66 PolarHBondContact O-N 3.19Å; P63-A67 WeakPolarHBondContact O-CB 3.47Å; P63-A67 PolarHBondContact O-N 2.96Å
64	S	87.8	Confident	83.3	Confident	77 Å²	77	107.3 Å²	107.3	54%	0.538	55%	0.552	S	S	.	*	H	α-helix	trans	-66	-34.7	177.5	59	0	0	0	0	113.1	R62 A68	R62-S64 VanDerWaalsContact C-N 3.26Å; R62-S64 PolarHBondContact O-N 3.36Å; S64-A68 WeakPolarHBondContact O-CB 3.37Å; S64-A68 PolarHBondContact O-N 3.28Å
65	V	86.5	Confident	81.7	Confident	33 Å²	33	102.4 Å²	102.4	20%	0.2	55%	0.554	C	S	.	*	H	α-helix	trans	-72.1	-43.7	176.4	176.7	0	0	0	0	109.7	M59 R62 P63 A67 A68 L69	M59-V65 VanDerWaalsContact O-CB 3.24Å; M59-V65 WeakPolarHBondContact O-CB 3.39Å; M59-V65 WeakPolarHBondContact O-CG1 3.48Å; R62-V65 HydrophobicContact CB-CB 4.11Å; R62-V65 HydrophobicContact CB-CG2 3.79Å; R62-V65 WeakPolarHBondContact O-CB 3.37Å; R62-V65 PolarHBondContact O-N 2.97Å; P63-V65 VanDerWaalsContact C-N 3.34Å; P63-V65 PolarHBondContact O-N 3.3Å; V65-A67 VanDerWaalsContact C-N 3.34Å; V65-A67 PolarHBondContact O-N 3.33Å; V65-A68 PolarHBondContact O-N 3.43Å; V65-L69 HydrophobicContact CG1-CD1 4.01Å; V65-L69 HydrophobicContact CG1-CG 4.37Å; V65-L69 WeakPolarHBondContact O-CB 3.24Å; V65-L69 VanDerWaalsContact O-CG 3.29Å; V65-L69 WeakPolarHBondContact O-CG 3.47Å; V65-L69 PolarHBondContact O-N 3.16Å
66	Q	85.6	Confident	79.4	Confident	84 Å²	84	107.7 Å²	107.7	39%	0.393	59%	0.59	S	S	.	*	H	α-helix	trans	-60.9	-43	174.9	-65.9	-179.5	10.9	0	0	112	E60 R62 P63 L69 K70	E60-Q66 WeakPolarHBondContact O-CG 3.37Å; E60-Q66 PolarHBondContact O-NE2 3Å; R62-Q66 PolarHBondContact O-N 3.39Å; P63-Q66 PolarHBondContact O-N 3.19Å; Q66-L69 PolarHBondContact O-N 3.49Å; Q66-K70 WeakPolarHBondContact O-CG 3.48Å; Q66-K70 PolarHBondContact O-N 3.44Å
67	A	84.8	Confident	78.9	Confident	49 Å²	49	110.3 Å²	110.3	41%	0.405	60%	0.596	S	S	.	*	H	α-helix	trans	-60.9	-46.9	175	0	0	0	0	0	111.4	P63 V65 L69 K70 L71	P63-A67 WeakPolarHBondContact O-CB 3.47Å; P63-A67 PolarHBondContact O-N 2.96Å; V65-A67 VanDerWaalsContact C-N 3.34Å; V65-A67 PolarHBondContact O-N 3.33Å; A67-L69 VanDerWaalsContact C-N 3.35Å; A67-L69 PolarHBondContact O-N 3.44Å; A67-K70 PolarHBondContact O-N 3.02Å; A67-L71 VanDerWaalsContact O-CG 3.29Å; A67-L71 WeakPolarHBondContact O-CG 3.36Å; A67-L71 PolarHBondContact O-N 3.37Å
68	A	83.1	Confident	78.3	Confident	57 Å²	57	109.8 Å²	109.8	47%	0.471	60%	0.598	S	S	.	*	H	α-helix	trans	-62.7	-38.5	177.4	0	0	0	0	0	113	S64 V65 K72	S64-A68 WeakPolarHBondContact O-CB 3.37Å; S64-A68 PolarHBondContact O-N 3.28Å; V65-A68 PolarHBondContact O-N 3.43Å; A68-K72 WeakPolarHBondContact O-CB 3.42Å; A68-K72 PolarHBondContact O-N 3.4Å
69	L	81.8	Confident	77.5	Confident	92 Å²	92	108.8 Å²	108.8	48%	0.482	60%	0.598	S	S	.	*	H	α-helix	trans	-68.1	-37.7	176.2	-71.4	173.1	0	0	0	112.4	V65 Q66 A67 K72 Q73	V65-L69 HydrophobicContact CG1-CD1 4.01Å; V65-L69 HydrophobicContact CG1-CG 4.37Å; V65-L69 WeakPolarHBondContact O-CB 3.24Å; V65-L69 VanDerWaalsContact O-CG 3.29Å; V65-L69 WeakPolarHBondContact O-CG 3.47Å; V65-L69 PolarHBondContact O-N 3.16Å; Q66-L69 PolarHBondContact O-N 3.49Å; A67-L69 VanDerWaalsContact C-N 3.35Å; A67-L69 PolarHBondContact O-N 3.44Å; L69-K72 PolarHBondContact O-N 3.45Å; L69-Q73 WeakPolarHBondContact O-CG 3.36Å; L69-Q73 PolarHBondContact O-N 3.02Å
70	K	78.4	Confident	76.8	Confident	141 Å²	141	110.4 Å²	110.4	61%	0.613	61%	0.61	S	S	*	*	H	α-helix	trans	-65.7	-44.8	174	-74	175.4	180	179.4	0	111.6	Q66 A67 K72 Q73 V74	Q66-K70 WeakPolarHBondContact O-CG 3.48Å; Q66-K70 PolarHBondContact O-N 3.44Å; A67-K70 PolarHBondContact O-N 3.02Å; K70-K72 VanDerWaalsContact C-N 3.29Å; K70-K72 PolarHBondContact O-N 3.11Å; K70-Q73 PolarHBondContact O-N 3.13Å; K70-Q73 VanDerWaalsContact O-N 3.16Å; K70-V74 WeakPolarHBondContact O-CG2 3.29Å; K70-V74 PolarHBondContact O-N 3.09Å
71	L	68.2	Low	76.1	Confident	135 Å²	135	108.8 Å²	108.8	71%	0.707	61%	0.608	S	S	*	*	H	α-helix	trans	-61.8	-36.9	176	-68.5	170.7	0	0	0	112	A67 Q73 V74 G75	A67-L71 VanDerWaalsContact O-CG 3.29Å; A67-L71 WeakPolarHBondContact O-CG 3.36Å; A67-L71 PolarHBondContact O-N 3.37Å; L71-Q73 VanDerWaalsContact C-N 3.34Å; L71-Q73 PolarHBondContact O-N 2.94Å; L71-V74 PolarHBondContact O-N 3.46Å; L71-G75 PolarHBondContact O-N 3.18Å
72	K	67.9	Low	75.2	Confident	166 Å²	166	108.1 Å²	108.1	72%	0.722	61%	0.606	S	S	*	*	H	α-helix	trans	-67	-30.4	175.3	-176.7	172	177.3	176.3	0	113.4	A68 L69 K70	A68-K72 WeakPolarHBondContact O-CB 3.42Å; A68-K72 PolarHBondContact O-N 3.4Å; L69-K72 PolarHBondContact O-N 3.45Å; K70-K72 VanDerWaalsContact C-N 3.29Å; K70-K72 PolarHBondContact O-N 3.11Å
73	Q	61.3	Low	73.9	Confident	154 Å²	154	105.6 Å²	105.6	72%	0.72	61%	0.611	S	S	*	*	H	α-helix	trans	-76.4	-26	177.8	-74.4	177	45.8	0	0	113.4	L69 K70 L71	L69-Q73 WeakPolarHBondContact O-CG 3.36Å; L69-Q73 PolarHBondContact O-N 3.02Å; K70-Q73 PolarHBondContact O-N 3.13Å; K70-Q73 VanDerWaalsContact O-N 3.16Å; L71-Q73 VanDerWaalsContact C-N 3.34Å; L71-Q73 PolarHBondContact O-N 2.94Å
74	V	58.5	Low	72.8	Confident	125 Å²	125	105.7 Å²	105.7	76%	0.758	61%	0.606	S	S	*	*	H	α-helix	trans	-86.2	-14	179.9	-179.3	0	0	0	0	112	K70 L71 V76	K70-V74 WeakPolarHBondContact O-CG2 3.29Å; K70-V74 PolarHBondContact O-N 3.09Å; L71-V74 PolarHBondContact O-N 3.46Å; V74-V76 VanDerWaalsContact C-N 3.34Å; V74-V76 PolarHBondContact O-N 3.46Å
75	G	57.7	Low	71.5	Confident	67 Å²	67	108.1 Å²	108.1	69%	0.691	61%	0.611	S	S	*	*			trans	-91.9	39.8	179	0	0	0	0	0	114.7	L71	L71-G75 PolarHBondContact O-N 3.18Å
76	V	44.6	Very low	70.2	Confident	194 Å²	194	114.9 Å²	114.9	100%	1.176	65%	0.649	S	S	*	*			trans	-119.6	0	167.8	-179.6	0	0	0	0	108.7	V74	V74-V76 VanDerWaalsContact C-N 3.34Å; V74-V76 PolarHBondContact O-N 3.46Å

Retrieved 76 of 76 residues in 29.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).