A0A087X1D4_HUMAN Loading...

Zinc finger protein 33B

AlphaFold DB , UniProt , Accession A0A087X1D4, Species HUMAN (Homo sapiens, Human), Gene ZNF33B, Length 36 aa.

						>A0A087X1D4_HUMAN|A0A087X1D4|ZNF33B
SQENQSKHLWEVVFINNEMLTKEQDVISLRREWYVP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	S	76.3	Confident	81.3	Confident	122 Å²	122	128.7 Å²	128.7	85%	0.853	63%	0.632	S	S	*	*				0	149.7	0	55	0	0	0	0	108.8	E3 N4	S1-E3 PolarHBondContact O-N 3.35Å; S1-N4 PolarHBondContact O-N 2.93Å
2	Q	74.6	Confident	81.7	Confident	172 Å²	172	123 Å²	123	80%	0.804	61%	0.61	S	S	*	*	H	α-helix	trans	-58.9	-35.4	178.2	-175.5	173.7	-45.1	0	0	112.3	N4 Q5 S6	Q2-N4 VanDerWaalsContact C-N 3.35Å; Q2-N4 PolarHBondContact O-N 3.33Å; Q2-Q5 PolarHBondContact O-N 3.46Å; Q2-S6 PolarHBondContact O-N 3.39Å; Q2-S6 VanDerWaalsContact O-N 3.1Å; Q2-S6 PolarHBondContact O-OG 3.41Å
3	E	75.1	Confident	82.1	Confident	169 Å²	169	120.1 Å²	120.1	79%	0.79	60%	0.602	S	S	*	*	H	α-helix	trans	-61.2	-38.5	179.3	-150.3	173.8	100.9	0	0	113.4	S1 Q5 S6 K7	S1-E3 PolarHBondContact O-N 3.35Å; E3-Q5 VanDerWaalsContact C-N 3.33Å; E3-Q5 PolarHBondContact O-N 3.03Å; E3-S6 PolarHBondContact O-N 3.23Å; E3-K7 PolarHBondContact O-N 3.31Å
4	N	76.3	Confident	82.3	Confident	113 Å²	113	121.5 Å²	121.5	60%	0.604	60%	0.603	S	S	*	*	H	α-helix	trans	-72.8	-26.8	179.6	-151.2	59.2	0	0	0	112.4	S1 Q2 H8	S1-N4 PolarHBondContact O-N 2.93Å; Q2-N4 VanDerWaalsContact C-N 3.35Å; Q2-N4 PolarHBondContact O-N 3.33Å; N4-H8 PolarHBondContact O-N 3.49Å
5	Q	78.3	Confident	82.4	Confident	146 Å²	146	119.3 Å²	119.3	68%	0.682	59%	0.593	S	S	*	*	H	α-helix	trans	-78	-38.8	174.8	-69.3	-149.3	-22.9	0	0	112.3	Q2 E3 K7 H8 L9	Q2-Q5 PolarHBondContact O-N 3.46Å; E3-Q5 VanDerWaalsContact C-N 3.33Å; E3-Q5 PolarHBondContact O-N 3.03Å; Q5-K7 VanDerWaalsContact C-N 3.32Å; Q5-K7 PolarHBondContact O-N 3.03Å; Q5-H8 PolarHBondContact O-N 3.32Å; Q5-L9 WeakPolarHBondContact O-CG 3.45Å; Q5-L9 PolarHBondContact O-N 3.34Å
6	S	82.7	Confident	82.5	Confident	54 Å²	54	117.4 Å²	117.4	38%	0.378	59%	0.586	S	S	.	*	H	α-helix	trans	-60.3	-42.9	173.7	-60.2	0	0	0	0	111.4	Q2 E3 H8 L9 W10	Q2-S6 PolarHBondContact O-N 3.39Å; Q2-S6 VanDerWaalsContact O-N 3.1Å; Q2-S6 PolarHBondContact O-OG 3.41Å; E3-S6 PolarHBondContact O-N 3.23Å; S6-H8 PolarHBondContact O-N 3.16Å; S6-L9 PolarHBondContact O-N 3.45Å; S6-W10 PolarHBondContact O-N 3.47Å; S6-W10 VanDerWaalsContact O-N 3.16Å
7	K	86	Confident	82.5	Confident	127 Å²	127	116.6 Å²	116.6	55%	0.552	58%	0.584	S	S	*	*	H	α-helix	trans	-59.7	-46.4	176.3	-172.8	178.9	176.8	-176	0	112.2	E3 Q5 L9 W10 E11	E3-K7 PolarHBondContact O-N 3.31Å; Q5-K7 VanDerWaalsContact C-N 3.32Å; Q5-K7 PolarHBondContact O-N 3.03Å; K7-L9 VanDerWaalsContact C-N 3.33Å; K7-L9 PolarHBondContact O-N 3.17Å; K7-W10 PolarHBondContact O-N 3.1Å; K7-E11 WeakPolarHBondContact O-CG 3.31Å; K7-E11 PolarHBondContact O-N 3.39Å
8	H	85.8	Confident	82.5	Confident	114 Å²	114	115.1 Å²	115.1	53%	0.528	58%	0.575	S	S	.	*	H	α-helix	trans	-61.9	-38.5	178.3	-177.8	-86.8	0	0	0	112.6	N4 Q5 S6 E11 V12	N4-H8 PolarHBondContact O-N 3.49Å; Q5-H8 PolarHBondContact O-N 3.32Å; S6-H8 PolarHBondContact O-N 3.16Å; H8-E11 PolarHBondContact O-N 3.32Å; H8-V12 WeakPolarHBondContact O-CG2 3.39Å; H8-V12 PolarHBondContact O-N 2.73Å
9	L	85.9	Confident	82.4	Confident	113 Å²	113	114.7 Å²	114.7	59%	0.592	57%	0.573	S	S	*	*	H	α-helix	trans	-63.5	-42.7	175.8	-74.2	168	0	0	0	112	Q5 S6 K7 V12 V13	Q5-L9 WeakPolarHBondContact O-CG 3.45Å; Q5-L9 PolarHBondContact O-N 3.34Å; S6-L9 PolarHBondContact O-N 3.45Å; K7-L9 VanDerWaalsContact C-N 3.33Å; K7-L9 PolarHBondContact O-N 3.17Å; L9-V12 PolarHBondContact O-N 3.08Å; L9-V13 VanDerWaalsContact O-CG2 3.31Å; L9-V13 WeakPolarHBondContact O-CG2 3.33Å; L9-V13 PolarHBondContact O-N 3.02Å
10	W	86.1	Confident	82.2	Confident	190 Å²	190	113.8 Å²	113.8	72%	0.72	57%	0.569	S	S	*	*	H	α-helix	trans	-65.7	-37.6	176.6	-74.8	113	0	0	0	112.7	S6 K7 V13 F14	S6-W10 PolarHBondContact O-N 3.47Å; S6-W10 VanDerWaalsContact O-N 3.16Å; K7-W10 PolarHBondContact O-N 3.1Å; W10-V13 PolarHBondContact O-N 3.47Å; W10-F14 VanDerWaalsContact O-CB 3.3Å; W10-F14 WeakPolarHBondContact O-CB 3.48Å; W10-F14 PolarHBondContact O-N 3.2Å
11	E	87.5	Confident	81.9	Confident	96 Å²	96	111.8 Å²	111.8	45%	0.449	56%	0.563	S	S	.	*	H	α-helix	trans	-62.7	-43.9	174.4	-73.6	172.2	154.2	0	0	111.6	K7 H8 F14 I15	K7-E11 WeakPolarHBondContact O-CG 3.31Å; K7-E11 PolarHBondContact O-N 3.39Å; H8-E11 PolarHBondContact O-N 3.32Å; E11-F14 PolarHBondContact O-N 3.36Å; E11-I15 WeakPolarHBondContact O-CD1 3.5Å; E11-I15 VanDerWaalsContact O-CG1 3.25Å; E11-I15 WeakPolarHBondContact O-CG1 3.3Å; E11-I15 PolarHBondContact O-N 3.01Å
12	V	86.1	Confident	82	Confident	60 Å²	60	111.6 Å²	111.6	36%	0.364	55%	0.547	S	S	.	.	H	α-helix	trans	-65	-43	177.1	172.6	0	0	0	0	111.8	H8 L9 F14 I15 N16	H8-V12 WeakPolarHBondContact O-CG2 3.39Å; H8-V12 PolarHBondContact O-N 2.73Å; L9-V12 PolarHBondContact O-N 3.08Å; V12-F14 VanDerWaalsContact C-N 3.33Å; V12-F14 PolarHBondContact O-N 3.32Å; V12-I15 PolarHBondContact O-N 3.43Å; V12-N16 WeakPolarHBondContact O-CB 3.25Å; V12-N16 PolarHBondContact O-N 2.99Å
13	V	86.9	Confident	81.9	Confident	85 Å²	85	109.3 Å²	109.3	52%	0.515	54%	0.536	S	S	.	.	H	α-helix	trans	-62	-43.1	176.3	171.1	0	0	0	0	110.6	L9 W10 N17	L9-V13 VanDerWaalsContact O-CG2 3.31Å; L9-V13 WeakPolarHBondContact O-CG2 3.33Å; L9-V13 PolarHBondContact O-N 3.02Å; W10-V13 PolarHBondContact O-N 3.47Å; V13-N17 WeakPolarHBondContact O-CB 3.36Å; V13-N17 PolarHBondContact O-N 3.47Å
14	F	84.8	Confident	81.7	Confident	140 Å²	140	107.3 Å²	107.3	61%	0.614	53%	0.527	S	S	*	.	H	α-helix	trans	-63.3	-47.2	179	-171.5	-92	0	0	0	112.1	W10 E11 V12 N17 E18	W10-F14 VanDerWaalsContact O-CB 3.3Å; W10-F14 WeakPolarHBondContact O-CB 3.48Å; W10-F14 PolarHBondContact O-N 3.2Å; E11-F14 PolarHBondContact O-N 3.36Å; V12-F14 VanDerWaalsContact C-N 3.33Å; V12-F14 PolarHBondContact O-N 3.32Å; F14-N17 PolarHBondContact O-N 2.96Å; F14-E18 PolarHBondContact O-N 3Å
15	I	84.1	Confident	81.4	Confident	89 Å²	89	106.5 Å²	106.5	46%	0.456	52%	0.523	S	S	.	.	H	α-helix	trans	-62.2	-45.4	178.5	-68.1	164.5	0	0	0	111.1	E11 V12 N17 E18 M19	E11-I15 WeakPolarHBondContact O-CD1 3.5Å; E11-I15 VanDerWaalsContact O-CG1 3.25Å; E11-I15 WeakPolarHBondContact O-CG1 3.3Å; E11-I15 PolarHBondContact O-N 3.01Å; V12-I15 PolarHBondContact O-N 3.43Å; I15-N17 VanDerWaalsContact C-N 3.32Å; I15-N17 PolarHBondContact O-N 3.49Å; I15-E18 PolarHBondContact O-N 3.37Å; I15-M19 HydrophobicContact CG2-CE 4.12Å; I15-M19 WeakPolarHBondContact O-CG 3.49Å; I15-M19 PolarHBondContact O-N 2.64Å
16	N	83.9	Confident	81	Confident	89 Å²	89	103.7 Å²	103.7	48%	0.476	52%	0.515	S	S	.	.	H	α-helix	trans	-62.8	-40.6	178.8	-78	-10	0	0	0	111.7	V12 M19 L20	V12-N16 WeakPolarHBondContact O-CB 3.25Å; V12-N16 PolarHBondContact O-N 2.99Å; N16-M19 PolarHBondContact O-N 2.86Å; N16-L20 WeakPolarHBondContact O-CB 3.24Å; N16-L20 WeakPolarHBondContact O-CD1 3.38Å; N16-L20 VanDerWaalsContact O-CG 3.24Å; N16-L20 WeakPolarHBondContact O-CG 3.23Å; N16-L20 PolarHBondContact O-N 2.76Å
17	N	81.5	Confident	80.5	Confident	104 Å²	104	105.4 Å²	105.4	56%	0.556	52%	0.519	S	S	*	.	H	α-helix	trans	-68.7	-37.3	-179.7	-154.1	59	0	0	0	112.1	V13 F14 I15 T21	V13-N17 WeakPolarHBondContact O-CB 3.36Å; V13-N17 PolarHBondContact O-N 3.47Å; F14-N17 PolarHBondContact O-N 2.96Å; I15-N17 VanDerWaalsContact C-N 3.32Å; I15-N17 PolarHBondContact O-N 3.49Å; N17-T21 PolarHBondContact O-N 3.34Å; N17-T21 VanDerWaalsContact O-N 3.08Å; N17-T21 PolarHBondContact O-OG1 3.13Å
18	E	83.4	Confident	79.6	Confident	89 Å²	89	102.1 Å²	102.1	42%	0.416	51%	0.512	S	S	.	.	H	α-helix	trans	-65.7	-43.8	174.6	-167.8	-170.8	114.1	0	0	111.9	F14 I15 T21 K22	F14-E18 PolarHBondContact O-N 3Å; I15-E18 PolarHBondContact O-N 3.37Å; E18-T21 PolarHBondContact O-N 3.18Å; E18-K22 WeakPolarHBondContact O-CG 3.37Å; E18-K22 PolarHBondContact O-N 3.33Å; E18-K22 VanDerWaalsContact O-N 3.11Å; E18-K22 IonicContact OE1-NZ 2.64Å; E18-K22 PolarHBondContact OE1-NZ 3.07Å
19	M	80.4	Confident	78.6	Confident	108 Å²	108	101.3 Å²	101.3	53%	0.532	51%	0.511	S	S	.	.	H	α-helix	trans	-64.6	-44.8	176.7	-73.5	-168	179.7	0	0	112	I15 N16 T21 K22 E23	I15-M19 HydrophobicContact CG2-CE 4.12Å; I15-M19 WeakPolarHBondContact O-CG 3.49Å; I15-M19 PolarHBondContact O-N 2.64Å; N16-M19 PolarHBondContact O-N 2.86Å; M19-T21 VanDerWaalsContact C-N 3.28Å; M19-T21 PolarHBondContact O-N 3.45Å; M19-K22 PolarHBondContact O-N 2.84Å; M19-E23 PolarHBondContact O-N 3.48Å
20	L	78.5	Confident	77.4	Confident	96 Å²	96	105.2 Å²	105.2	50%	0.503	52%	0.518	S	S	.	.	H	α-helix	trans	-57.5	-41.5	175.7	-77.9	167	0	0	0	111.9	N16 E23 Q24	N16-L20 WeakPolarHBondContact O-CB 3.24Å; N16-L20 WeakPolarHBondContact O-CD1 3.38Å; N16-L20 VanDerWaalsContact O-CG 3.24Å; N16-L20 WeakPolarHBondContact O-CG 3.23Å; N16-L20 PolarHBondContact O-N 2.76Å; L20-E23 PolarHBondContact O-N 3.07Å; L20-Q24 WeakPolarHBondContact O-CB 3.21Å; L20-Q24 PolarHBondContact O-N 3.31Å
21	T	76.8	Confident	76.1	Confident	72 Å²	72	105.2 Å²	105.2	44%	0.442	52%	0.518	S	S	.	.	H	α-helix	trans	-65.2	-42.6	178.6	-51.5	0	0	0	0	111.2	N17 E18 M19 Q24 D25	N17-T21 PolarHBondContact O-N 3.34Å; N17-T21 VanDerWaalsContact O-N 3.08Å; N17-T21 PolarHBondContact O-OG1 3.13Å; E18-T21 PolarHBondContact O-N 3.18Å; M19-T21 VanDerWaalsContact C-N 3.28Å; M19-T21 PolarHBondContact O-N 3.45Å; T21-Q24 PolarHBondContact O-N 3.43Å; T21-D25 PolarHBondContact O-N 3.5Å
22	K	76.5	Confident	74.9	Confident	118 Å²	118	107.9 Å²	107.9	51%	0.513	53%	0.53	S	S	.	.	H	α-helix	trans	-65.5	-42.8	177.3	-73.3	170.5	174	170.4	0	112.8	E18 M19 Q24 D25 V26	E18-K22 WeakPolarHBondContact O-CG 3.37Å; E18-K22 PolarHBondContact O-N 3.33Å; E18-K22 VanDerWaalsContact O-N 3.11Å; E18-K22 IonicContact OE1-NZ 2.64Å; E18-K22 PolarHBondContact OE1-NZ 3.07Å; M19-K22 PolarHBondContact O-N 2.84Å; K22-Q24 VanDerWaalsContact C-N 3.31Å; K22-D25 PolarHBondContact O-N 3.32Å; K22-V26 WeakPolarHBondContact O-CG2 3.22Å; K22-V26 PolarHBondContact O-N 3.49Å
23	E	72.9	Confident	73.8	Confident	124 Å²	124	115.7 Å²	115.7	58%	0.579	55%	0.553	S	S	*	*	H	α-helix	trans	-65.3	-37.9	175.8	-72.2	-171.5	94.3	0	0	111.4	M19 L20 V26 I27	M19-E23 PolarHBondContact O-N 3.48Å; L20-E23 PolarHBondContact O-N 3.07Å; E23-V26 PolarHBondContact O-N 2.93Å; E23-I27 WeakPolarHBondContact O-CB 3.5Å; E23-I27 VanDerWaalsContact O-CG1 3.25Å; E23-I27 WeakPolarHBondContact O-CG1 3.49Å; E23-I27 PolarHBondContact O-N 3.18Å
24	Q	70.4	Confident	72.5	Confident	127 Å²	127	120.8 Å²	120.8	59%	0.593	57%	0.565	S	S	*	*	H	α-helix	trans	-69.3	-35	177.8	-165.2	140.7	27	0	0	112.7	L20 T21 K22 I27 S28	L20-Q24 WeakPolarHBondContact O-CB 3.21Å; L20-Q24 PolarHBondContact O-N 3.31Å; T21-Q24 PolarHBondContact O-N 3.43Å; K22-Q24 VanDerWaalsContact C-N 3.31Å; Q24-I27 PolarHBondContact O-N 2.93Å; Q24-S28 VanDerWaalsContact O-CB 3.23Å; Q24-S28 WeakPolarHBondContact O-CB 3.25Å; Q24-S28 PolarHBondContact O-N 3.11Å; Q24-S28 PolarHBondContact O-OG 3.02Å
25	D	70.2	Confident	71.2	Confident	96 Å²	96	119.8 Å²	119.8	51%	0.513	57%	0.57	S	S	.	*	H	α-helix	trans	-64.7	-43.3	170.7	-78.5	-14.7	0	0	0	111.2	T21 K22 I27 S28 L29	T21-D25 PolarHBondContact O-N 3.5Å; K22-D25 PolarHBondContact O-N 3.32Å; D25-I27 PolarHBondContact O-N 2.94Å; D25-S28 PolarHBondContact O-N 3.34Å; D25-L29 WeakPolarHBondContact O-CB 3.33Å; D25-L29 WeakPolarHBondContact O-CG 3.45Å; D25-L29 PolarHBondContact O-N 3.16Å
26	V	71	Confident	70.2	Confident	86 Å²	86	124.2 Å²	124.2	52%	0.521	60%	0.604	S	S	.	*	H	α-helix	trans	-64.3	-41.4	176.9	172.2	0	0	0	0	111.8	K22 E23 R30	K22-V26 WeakPolarHBondContact O-CG2 3.22Å; K22-V26 PolarHBondContact O-N 3.49Å; E23-V26 PolarHBondContact O-N 2.93Å; V26-R30 WeakPolarHBondContact O-CB 3.46Å; V26-R30 PolarHBondContact O-N 3.16Å
27	I	72.2	Confident	69.5	Low	90 Å²	90	126 Å²	126	46%	0.462	61%	0.611	S	S	.	*	H	α-helix	trans	-68.6	-39.6	176.9	-68.7	166	0	0	0	110.8	E23 Q24 D25 R30 R31	E23-I27 WeakPolarHBondContact O-CB 3.5Å; E23-I27 VanDerWaalsContact O-CG1 3.25Å; E23-I27 WeakPolarHBondContact O-CG1 3.49Å; E23-I27 PolarHBondContact O-N 3.18Å; Q24-I27 PolarHBondContact O-N 2.93Å; D25-I27 PolarHBondContact O-N 2.94Å; I27-R30 PolarHBondContact O-N 3.28Å; I27-R31 WeakPolarHBondContact O-CG 3.46Å; I27-R31 PolarHBondContact O-N 3.4Å
28	S	66.1	Low	68.9	Low	59 Å²	59	127.1 Å²	127.1	41%	0.413	61%	0.613	S	S	.	*	H	α-helix	trans	-65.1	-46.5	177.2	-63.2	0	0	0	0	111.3	Q24 D25 R30 R31 E32	Q24-S28 VanDerWaalsContact O-CB 3.23Å; Q24-S28 WeakPolarHBondContact O-CB 3.25Å; Q24-S28 PolarHBondContact O-N 3.11Å; Q24-S28 PolarHBondContact O-OG 3.02Å; D25-S28 PolarHBondContact O-N 3.34Å; S28-R30 PolarHBondContact O-N 3.38Å; S28-R31 PolarHBondContact O-N 2.95Å; S28-E32 PolarHBondContact O-N 3.45Å; S28-E32 VanDerWaalsContact O-N 3.13Å
29	L	64.9	Low	68.1	Low	96 Å²	96	129.2 Å²	129.2	50%	0.503	62%	0.624	S	S	.	*	H	α-helix	trans	-58.7	-47.3	173.5	-70.4	169.7	0	0	0	110.8	D25 R31 E32 W33	D25-L29 WeakPolarHBondContact O-CB 3.33Å; D25-L29 WeakPolarHBondContact O-CG 3.45Å; D25-L29 PolarHBondContact O-N 3.16Å; L29-R31 VanDerWaalsContact C-N 3.28Å; L29-R31 PolarHBondContact O-N 3.11Å; L29-E32 PolarHBondContact O-N 2.97Å; L29-E32 VanDerWaalsContact O-N 3.11Å; L29-W33 PolarHBondContact O-N 2.9Å; L29-W33 VanDerWaalsContact O-N 3.16Å
30	R	60.3	Low	67.4	Low	196 Å²	196	130.5 Å²	130.5	74%	0.74	63%	0.63	S	S	*	*	H	α-helix	trans	-60.8	-32.5	177.5	-84.4	-149.5	-173.5	-165.4	5.2	114.1	V26 I27 S28 Y34	V26-R30 WeakPolarHBondContact O-CB 3.46Å; V26-R30 PolarHBondContact O-N 3.16Å; I27-R30 PolarHBondContact O-N 3.28Å; S28-R30 PolarHBondContact O-N 3.38Å; R30-Y34 WeakPolarHBondContact O-CB 3.39Å; R30-Y34 PolarHBondContact O-N 3.01Å; R30-Y34 VanDerWaalsContact O-N 3.16Å
31	R	59.2	Low	66.7	Low	190 Å²	190	132.6 Å²	132.6	72%	0.717	64%	0.638	S	S	*	*	H	α-helix	trans	-70.9	-33.8	175.1	-77.3	-175.5	-170.5	167.5	4.2	112.4	I27 S28 L29 W33	I27-R31 WeakPolarHBondContact O-CG 3.46Å; I27-R31 PolarHBondContact O-N 3.4Å; S28-R31 PolarHBondContact O-N 2.95Å; L29-R31 VanDerWaalsContact C-N 3.28Å; L29-R31 PolarHBondContact O-N 3.11Å; R31-W33 VanDerWaalsContact C-N 3.33Å
32	E	63.3	Low	66	Low	152 Å²	152	136.7 Å²	136.7	71%	0.71	65%	0.651	S	S	*	*	H	α-helix	trans	-68.7	-33.7	176.7	-134	172.5	137	0	0	112	S28 L29	S28-E32 PolarHBondContact O-N 3.45Å; S28-E32 VanDerWaalsContact O-N 3.13Å; L29-E32 PolarHBondContact O-N 2.97Å; L29-E32 VanDerWaalsContact O-N 3.11Å
33	W	62.2	Low	65.3	Low	224 Å²	224	138 Å²	138	85%	0.848	66%	0.661	S	S	*	*	H	α-helix	trans	-89.9	-8.8	179.8	-66.9	105.8	0	0	0	115	L29 R31	L29-W33 PolarHBondContact O-N 2.9Å; L29-W33 VanDerWaalsContact O-N 3.16Å; R31-W33 VanDerWaalsContact C-N 3.33Å
34	Y	58.9	Low	64.7	Low	192 Å²	192	139.1 Å²	139.1	75%	0.753	67%	0.667	S	S	*	*			trans	-115.9	81.6	177.3	-151.4	-91.9	0	0	0	110.4	R30	R30-Y34 WeakPolarHBondContact O-CB 3.39Å; R30-Y34 PolarHBondContact O-N 3.01Å; R30-Y34 VanDerWaalsContact O-N 3.16Å
35	V	58.4	Low	64.2	Low	119 Å²	119	140.1 Å²	140.1	72%	0.721	67%	0.673	S	S	*	*			trans	-108.8	117.1	162.3	-176.5	0	0	0	0	105.7
36	P	63.8	Low	63.7	Low	181 Å²	181	144.1 Å²	144.1	100%	1.175	69%	0.688	S	S	*	*			trans	-59.3	0	176	-2.3	8.2	0	0	0	112.8

Retrieved 36 of 36 residues in 31.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).