A0A087X1J1_HUMAN Loading...

Protein tyrosine phosphatase receptor type T

AlphaFold DB , UniProt , Accession A0A087X1J1, Species HUMAN (Homo sapiens, Human), Gene PTPRT, Length 47 aa.

						>A0A087X1J1_HUMAN|A0A087X1J1|PTPRT
MASLAALALSLLLRLQLPPLPGARAQSAAGVAVPLMSTTATVVIVWL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.8	Low	72.1	Confident	230 Å²	230	98.8 Å²	98.8	100%	1.133	60%	0.603	S	S	*	*				0	-26.2	0	-122.9	143.9	161.2	0	0	114.2
2	A	58.9	Low	73.2	Confident	86 Å²	86	98.6 Å²	98.6	71%	0.711	59%	0.594	S	S	*	*	H	α-helix	trans	-69.1	-29.9	-178.5	0	0	0	0	0	115.8	L4 A6	A2-L4 PolarHBondContact O-N 3.37Å; A2-A6 PolarHBondContact O-N 3.22Å
3	S	64.4	Low	73.9	Confident	91 Å²	91	99.1 Å²	99.1	64%	0.636	59%	0.591	S	S	*	*	H	α-helix	trans	-69.4	-26.9	-177.9	-61.2	0	0	0	0	114.6	A6 L7	S3-A6 PolarHBondContact O-N 3.17Å; S3-L7 WeakPolarHBondContact O-CB 2.96Å; S3-L7 PolarHBondContact O-N 3.03Å; S3-L7 VanDerWaalsContact O-CG 3.29Å; S3-L7 WeakPolarHBondContact O-CG 3.43Å
4	L	67.1	Low	74	Confident	136 Å²	136	106 Å²	106	71%	0.712	60%	0.602	S	S	*	*	H	α-helix	trans	-67.9	-42.3	179.3	-167.9	86.1	0	0	0	111	A2 L7 A8	A2-L4 PolarHBondContact O-N 3.37Å; L4-L7 PolarHBondContact O-N 2.77Å; L4-A8 WeakPolarHBondContact O-CB 3.5Å; L4-A8 PolarHBondContact O-N 2.93Å
5	A	74.7	Confident	74.2	Confident	59 Å²	59	107.6 Å²	107.6	49%	0.488	61%	0.607	S	S	.	*	H	α-helix	trans	-65.8	-38.8	176.6	0	0	0	0	0	111.6	A8 L9	A5-A8 PolarHBondContact O-N 2.83Å; A5-L9 WeakPolarHBondContact O-CB 3.03Å; A5-L9 WeakPolarHBondContact O-CG 3.36Å; A5-L9 PolarHBondContact O-N 2.91Å
6	A	79.2	Confident	74.4	Confident	58 Å²	58	110.6 Å²	110.6	48%	0.479	61%	0.614	S	S	.	*	H	α-helix	trans	-66.7	-37.6	174.6	0	0	0	0	0	112.5	A2 S3 S10	A2-A6 PolarHBondContact O-N 3.22Å; S3-A6 PolarHBondContact O-N 3.17Å; A6-S10 WeakPolarHBondContact O-CB 3.17Å; A6-S10 PolarHBondContact O-N 3.25Å; A6-S10 VanDerWaalsContact O-CB 3.25Å
7	L	74.5	Confident	74.3	Confident	119 Å²	119	110.4 Å²	110.4	62%	0.623	61%	0.611	S	S	*	*	H	α-helix	trans	-66.7	-44.1	173.6	-77.4	167.9	0	0	0	111.7	S3 L4 S10 L11	S3-L7 WeakPolarHBondContact O-CB 2.96Å; S3-L7 PolarHBondContact O-N 3.03Å; S3-L7 VanDerWaalsContact O-CG 3.29Å; S3-L7 WeakPolarHBondContact O-CG 3.43Å; L4-L7 PolarHBondContact O-N 2.77Å; L7-S10 PolarHBondContact O-N 2.96Å; L7-L11 VanDerWaalsContact O-CB 3.31Å; L7-L11 WeakPolarHBondContact O-CB 3.18Å; L7-L11 PolarHBondContact O-N 2.88Å
8	A	81.8	Confident	73.6	Confident	49 Å²	49	109.9 Å²	109.9	41%	0.405	61%	0.614	S	S	.	*	H	α-helix	trans	-62.9	-44.6	176	0	0	0	0	0	111.4	L4 A5 L11 L12	L4-A8 WeakPolarHBondContact O-CB 3.5Å; L4-A8 PolarHBondContact O-N 2.93Å; A5-A8 PolarHBondContact O-N 2.83Å; A8-L11 PolarHBondContact O-N 3.34Å; A8-L12 WeakPolarHBondContact O-CB 3.35Å; A8-L12 WeakPolarHBondContact O-CG 3.32Å; A8-L12 PolarHBondContact O-N 2.87Å
9	L	78.3	Confident	73.2	Confident	108 Å²	108	110.6 Å²	110.6	57%	0.565	62%	0.623	S	S	*	*	H	α-helix	trans	-62.1	-44.8	173.5	-77.4	169.8	0	0	0	111.3	A5 L11 L12 L13	A5-L9 WeakPolarHBondContact O-CB 3.03Å; A5-L9 WeakPolarHBondContact O-CG 3.36Å; A5-L9 PolarHBondContact O-N 2.91Å; L9-L11 PolarHBondContact O-N 3.18Å; L9-L11 VanDerWaalsContact C-N 3.29Å; L9-L12 PolarHBondContact O-N 3.49Å; L9-L13 WeakPolarHBondContact O-CB 3.3Å; L9-L13 WeakPolarHBondContact O-CG 3.25Å; L9-L13 PolarHBondContact O-N 2.85Å
10	S	82.1	Confident	72.6	Confident	49 Å²	49	112.2 Å²	112.2	34%	0.343	63%	0.629	S	S	.	*	H	α-helix	trans	-63.6	-34.7	176.7	-175	0	0	0	0	112.5	A6 L7 R14	A6-S10 WeakPolarHBondContact O-CB 3.17Å; A6-S10 PolarHBondContact O-N 3.25Å; A6-S10 VanDerWaalsContact O-CB 3.25Å; L7-S10 PolarHBondContact O-N 2.96Å; S10-R14 WeakPolarHBondContact O-CB 3.15Å; S10-R14 WeakPolarHBondContact O-CG 3.37Å; S10-R14 PolarHBondContact O-N 3.47Å
11	L	79.6	Confident	72	Confident	102 Å²	102	112.5 Å²	112.5	53%	0.534	64%	0.637	S	S	.	*	H	α-helix	trans	-71.1	-45.9	176.8	-177.2	67.8	0	0	0	110.9	L7 A8 L9 L13 R14 L15	L7-L11 VanDerWaalsContact O-CB 3.31Å; L7-L11 WeakPolarHBondContact O-CB 3.18Å; L7-L11 PolarHBondContact O-N 2.88Å; A8-L11 PolarHBondContact O-N 3.34Å; L9-L11 PolarHBondContact O-N 3.18Å; L9-L11 VanDerWaalsContact C-N 3.29Å; L11-L13 VanDerWaalsContact C-N 3.31Å; L11-L13 PolarHBondContact O-N 3.46Å; L11-R14 PolarHBondContact O-N 2.82Å; L11-L15 HydrophobicContact CG-CD1 4.11Å; L11-L15 PolarHBondContact O-N 3.41Å; L11-L15 WeakPolarHBondContact O-CG 3.16Å; L11-L15 VanDerWaalsContact O-CG 3.32Å; L11-L15 WeakPolarHBondContact O-CB 3.34Å; L11-L15 HydrophobicContact CD1-CD1 4.43Å
12	L	85.1	Confident	72.3	Confident	96 Å²	96	104.6 Å²	104.6	50%	0.503	61%	0.614	S	S	.	*	H	α-helix	trans	-59.4	-43.8	174.8	-70.7	171	0	0	0	110.8	A8 L9 L15 Q16	A8-L12 WeakPolarHBondContact O-CB 3.35Å; A8-L12 WeakPolarHBondContact O-CG 3.32Å; A8-L12 PolarHBondContact O-N 2.87Å; L9-L12 PolarHBondContact O-N 3.49Å; L12-L15 PolarHBondContact O-N 3.37Å; L12-Q16 VanDerWaalsContact O-CB 3.3Å; L12-Q16 WeakPolarHBondContact O-CB 3.31Å; L12-Q16 WeakPolarHBondContact O-CG 3.47Å; L12-Q16 PolarHBondContact O-N 3.32Å
13	L	83.1	Confident	72.1	Confident	105 Å²	105	104.7 Å²	104.7	55%	0.55	61%	0.614	S	S	.	*	H	α-helix	trans	-63.8	-41.3	174.9	-69	171.7	0	0	0	111.7	L9 L11 L15 Q16 L17	L9-L13 WeakPolarHBondContact O-CB 3.3Å; L9-L13 WeakPolarHBondContact O-CG 3.25Å; L9-L13 PolarHBondContact O-N 2.85Å; L11-L13 VanDerWaalsContact C-N 3.31Å; L11-L13 PolarHBondContact O-N 3.46Å; L13-L15 VanDerWaalsContact C-N 3.34Å; L13-L15 PolarHBondContact O-N 2.92Å; L13-Q16 PolarHBondContact O-N 3.36Å; L13-L17 WeakPolarHBondContact O-CB 3.33Å; L13-L17 HydrophobicContact CB-CD1 4.44Å; L13-L17 PolarHBondContact O-N 2.86Å; L13-L17 WeakPolarHBondContact O-CD1 3.34Å
14	R	75.3	Confident	71.7	Confident	196 Å²	196	110.5 Å²	110.5	74%	0.74	62%	0.622	S	S	*	*	H	α-helix	trans	-67.3	-31.8	176.9	-78.3	173.8	177.2	-162.1	0.6	113.6	S10 L11	S10-R14 WeakPolarHBondContact O-CB 3.15Å; S10-R14 WeakPolarHBondContact O-CG 3.37Å; S10-R14 PolarHBondContact O-N 3.47Å; L11-R14 PolarHBondContact O-N 2.82Å
15	L	76.4	Confident	71	Confident	130 Å²	130	106.4 Å²	106.4	68%	0.681	61%	0.609	S	S	*	*	H	α-helix	trans	-81.1	-33	176.7	-69.6	173.2	0	0	0	112.4	L11 L12 L13	L11-L15 HydrophobicContact CG-CD1 4.11Å; L11-L15 PolarHBondContact O-N 3.41Å; L11-L15 WeakPolarHBondContact O-CG 3.16Å; L11-L15 VanDerWaalsContact O-CG 3.32Å; L11-L15 WeakPolarHBondContact O-CB 3.34Å; L11-L15 HydrophobicContact CD1-CD1 4.43Å; L12-L15 PolarHBondContact O-N 3.37Å; L13-L15 VanDerWaalsContact C-N 3.34Å; L13-L15 PolarHBondContact O-N 2.92Å
16	Q	76.9	Confident	70.1	Confident	155 Å²	155	111.6 Å²	111.6	72%	0.724	62%	0.623	S	S	*	*	H	α-helix	trans	-85.1	-20.7	178.3	-70.6	-161.1	-4.2	0	0	113.7	L12 L13 P18	L12-Q16 VanDerWaalsContact O-CB 3.3Å; L12-Q16 WeakPolarHBondContact O-CB 3.31Å; L12-Q16 WeakPolarHBondContact O-CG 3.47Å; L12-Q16 PolarHBondContact O-N 3.32Å; L13-Q16 PolarHBondContact O-N 3.36Å; Q16-P18 WeakPolarHBondContact O-CD 3.32Å
17	L	72.6	Confident	68.9	Low	108 Å²	108	112.9 Å²	112.9	57%	0.565	63%	0.628	S	S	*	*	S	Bend	trans	-67.4	114.4	171.2	-102.2	97.4	0	0	0	108.7	L13	L13-L17 WeakPolarHBondContact O-CB 3.33Å; L13-L17 HydrophobicContact CB-CD1 4.44Å; L13-L17 PolarHBondContact O-N 2.86Å; L13-L17 WeakPolarHBondContact O-CD1 3.34Å
18	P	62.5	Low	67.9	Low	101 Å²	101	110.4 Å²	110.4	66%	0.656	63%	0.625	S	S	*	*			trans	-59.3	140.6	171.2	-14.3	28.9	0	0	0	108.3	Q16 L20	Q16-P18 WeakPolarHBondContact O-CD 3.32Å; P18-L20 PolarHBondContact O-N 2.82Å
19	P	65.2	Low	66.5	Low	123 Å²	123	112 Å²	112	80%	0.799	64%	0.638	S	S	*	*			trans	-60.9	109.9	175.4	24.9	-32.1	0	0	0	108.7	P21	P19-P21 WeakPolarHBondContact O-CD 3.21Å
20	L	61.6	Low	65.1	Low	142 Å²	142	109.3 Å²	109.3	74%	0.743	64%	0.637	S	S	*	*			trans	-52.2	121.4	177.5	-76.1	162.9	0	0	0	109.8	P18 G22	P18-L20 PolarHBondContact O-N 2.82Å; L20-G22 PolarHBondContact O-N 3.44Å
21	P	59.4	Low	63.6	Low	120 Å²	120	111.9 Å²	111.9	78%	0.779	65%	0.65	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79	107.3	177.5	31.2	-29.2	0	0	0	107.5	P19	P19-P21 WeakPolarHBondContact O-CD 3.21Å
22	G	59.4	Low	62.3	Low	64 Å²	64	111 Å²	111	66%	0.66	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	174.1	-35.6	172	0	0	0	0	0	115.6	L20	L20-G22 PolarHBondContact O-N 3.44Å
23	A	55.9	Low	60.8	Low	87 Å²	87	110.7 Å²	110.7	72%	0.719	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	-129.6	-24.1	-177.2	0	0	0	0	0	114.5
24	R	54.4	Low	59.2	Low	213 Å²	213	111 Å²	111	80%	0.804	67%	0.667	S	S	*	*	S	Bend	trans	-101.2	-18.8	175.8	-72.7	-172.4	172.7	168.6	-1.2	114.2	Q26 S27 A28	R24-Q26 PolarHBondContact O-N 2.82Å; R24-S27 PolarHBondContact O-N 3.28Å; R24-A28 PolarHBondContact O-N 3.37Å
25	A	53.3	Low	58.5	Low	51 Å²	51	108 Å²	108	42%	0.421	67%	0.666	S	S	.	*	H	α-helix	trans	-65.8	-26.5	174.4	0	0	0	0	0	112.2	A29	A25-A29 WeakPolarHBondContact O-CA 3.29Å; A25-A29 WeakPolarHBondContact O-CB 3.42Å; A25-A29 PolarHBondContact O-N 3.3Å
26	Q	54.8	Low	57.7	Low	167 Å²	167	110.5 Å²	110.5	78%	0.78	68%	0.676	S	S	*	*	H	α-helix	trans	-74.4	-32.3	172.9	-118.8	160	12.8	0	0	112.6	R24 G30	R24-Q26 PolarHBondContact O-N 2.82Å; Q26-G30 PolarHBondContact O-N 2.89Å
27	S	54.6	Low	56.8	Low	86 Å²	86	107.1 Å²	107.1	60%	0.601	67%	0.669	S	S	*	*	H	α-helix	trans	-79	-24.6	173.9	-170.9	0	0	0	0	113.2	R24 V31	R24-S27 PolarHBondContact O-N 3.28Å; S27-V31 WeakPolarHBondContact O-CG2 3.4Å
28	A	54.3	Low	56.1	Low	66 Å²	66	106.9 Å²	106.9	55%	0.545	67%	0.673	S	S	.	*	H	α-helix	trans	-90.3	-33.3	174.6	0	0	0	0	0	112.6	R24 V31 A32	R24-A28 PolarHBondContact O-N 3.37Å; A28-V31 CarbonylContact O-C 3.33Å; A28-V31 PolarHBondContact O-N 3.43Å; A28-A32 PolarHBondContact O-N 3.45Å
29	A	51.5	Low	56	Low	83 Å²	83	106.7 Å²	106.7	69%	0.686	67%	0.67	S	S	*	*	H	α-helix	trans	-80	-19.9	174.8	0	0	0	0	0	113	A25 V31	A25-A29 WeakPolarHBondContact O-CA 3.29Å; A25-A29 WeakPolarHBondContact O-CB 3.42Å; A25-A29 PolarHBondContact O-N 3.3Å; A29-V31 VanDerWaalsContact C-N 3.3Å
30	G	49.4	Very low	55.7	Low	52 Å²	52	103.4 Å²	103.4	54%	0.536	65%	0.653	S	S	.	*	T	Hydrogen-bonded Turn	trans	-81.1	-7.6	164.9	0	0	0	0	0	114	Q26	Q26-G30 PolarHBondContact O-N 2.89Å
31	V	50.3	Low	55.5	Low	103 Å²	103	100.5 Å²	100.5	62%	0.624	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	-121.7	40.9	177.5	-169.8	0	0	0	0	109.7	S27 A28 A29	S27-V31 WeakPolarHBondContact O-CG2 3.4Å; A28-V31 CarbonylContact O-C 3.33Å; A28-V31 PolarHBondContact O-N 3.43Å; A29-V31 VanDerWaalsContact C-N 3.3Å
32	A	52	Low	55.7	Low	84 Å²	84	99.2 Å²	99.2	69%	0.694	63%	0.631	S	S	*	*			trans	-95.4	49.5	144	0	0	0	0	0	107.8	A28 P34	A28-A32 PolarHBondContact O-N 3.45Å; A32-P34 WeakPolarHBondContact O-CD 3.42Å
33	V	53.7	Low	55.9	Low	88 Å²	88	100.1 Å²	100.1	53%	0.533	62%	0.624	S	S	.	*			trans	-66.6	121.6	163.9	174.9	0	0	0	0	105.4	L35	V33-L35 VanDerWaalsContact C-N 3.31Å; V33-L35 PolarHBondContact O-N 2.86Å
34	P	50	Low	56.3	Low	111 Å²	111	101.8 Å²	101.8	72%	0.721	62%	0.619	S	S	*	*			trans	-63	99.8	168.9	26	-30.7	0	0	0	107.3	A32 M36	A32-P34 WeakPolarHBondContact O-CD 3.42Å; P34-M36 PolarHBondContact O-N 2.86Å
35	L	60.4	Low	56.8	Low	135 Å²	135	97.1 Å²	97.1	71%	0.707	61%	0.614	S	S	*	*			trans	-70.1	36.2	173.4	-83.5	160.9	0	0	0	111.7	V33	V33-L35 VanDerWaalsContact C-N 3.31Å; V33-L35 PolarHBondContact O-N 2.86Å
36	M	60.5	Low	57	Low	181 Å²	181	105.2 Å²	105.2	89%	0.892	63%	0.634	S	S	*	*			trans	-130.3	58.8	-170.3	-139.8	150.1	144.2	0	0	109.3	P34	P34-M36 PolarHBondContact O-N 2.86Å
37	S	56.1	Low	57.5	Low	84 Å²	84	106.4 Å²	106.4	59%	0.587	64%	0.644	S	S	*	*	S	Bend	trans	-154.8	-48.9	162.4	-163.2	0	0	0	0	111.8	A40 T41	S37-A40 PolarHBondContact O-N 3.46Å; S37-T41 VanDerWaalsContact O-OG1 3.11Å; S37-T41 PolarHBondContact O-OG1 3.42Å
38	T	59.3	Low	57.6	Low	104 Å²	104	107.4 Å²	107.4	64%	0.638	65%	0.646	S	S	*	*	H	α-helix	trans	-74.1	-34.7	-173	31.5	0	0	0	0	114.6	A40 T41	T38-A40 VanDerWaalsContact C-N 3.29Å; T38-A40 PolarHBondContact O-N 3.11Å; T38-T41 PolarHBondContact O-N 3.47Å
39	T	59.4	Low	57.8	Low	97 Å²	97	109.6 Å²	109.6	60%	0.595	65%	0.652	S	S	*	*	H	α-helix	trans	-69	-29.7	178.7	-38.6	0	0	0	0	112.1
40	A	60.2	Low	58.1	Low	54 Å²	54	111.1 Å²	111.1	45%	0.446	65%	0.65	S	S	.	*	H	α-helix	trans	-73.7	-36.1	179	0	0	0	0	0	112.2	S37 T38 V42 V43 I44	S37-A40 PolarHBondContact O-N 3.46Å; T38-A40 VanDerWaalsContact C-N 3.29Å; T38-A40 PolarHBondContact O-N 3.11Å; A40-V42 VanDerWaalsContact C-N 3.3Å; A40-V42 PolarHBondContact O-N 3.24Å; A40-V43 PolarHBondContact O-N 3.24Å; A40-I44 WeakPolarHBondContact O-CD1 3.44Å; A40-I44 WeakPolarHBondContact O-CG1 3.46Å; A40-I44 PolarHBondContact O-N 3.37Å; A40-I44 VanDerWaalsContact O-N 3.16Å
41	T	57.5	Low	58.6	Low	81 Å²	81	114.5 Å²	114.5	50%	0.497	66%	0.656	S	S	.	*	H	α-helix	trans	-64	-35.3	-179.4	-41.2	0	0	0	0	112.4	S37 T38 V43 I44 V45	S37-T41 VanDerWaalsContact O-OG1 3.11Å; S37-T41 PolarHBondContact O-OG1 3.42Å; T38-T41 PolarHBondContact O-N 3.47Å; T41-V43 VanDerWaalsContact C-N 3.34Å; T41-I44 PolarHBondContact O-N 3.38Å; T41-V45 WeakPolarHBondContact O-CG2 3.36Å; T41-V45 PolarHBondContact O-N 3.16Å
42	V	62.8	Low	59.2	Low	93 Å²	93	115.3 Å²	115.3	56%	0.564	66%	0.658	S	S	*	*	H	α-helix	trans	-66.4	-38	177.8	-179.6	0	0	0	0	111.5	A40 W46	A40-V42 VanDerWaalsContact C-N 3.3Å; A40-V42 PolarHBondContact O-N 3.24Å; V42-W46 PolarHBondContact O-N 3.46Å
43	V	63	Low	59.6	Low	83 Å²	83	117.3 Å²	117.3	50%	0.503	66%	0.656	S	S	.	*	H	α-helix	trans	-71	-36.7	179.7	178.8	0	0	0	0	111.4	A40 T41 W46 L47	A40-V43 PolarHBondContact O-N 3.24Å; T41-V43 VanDerWaalsContact C-N 3.34Å; V43-W46 PolarHBondContact O-N 3.36Å; V43-L47 HydrophobicContact CG1-CD1 3.94Å; V43-L47 HydrophobicContact CG1-CG 4.44Å; V43-L47 WeakPolarHBondContact O-CG 3.42Å; V43-L47 PolarHBondContact O-N 3.15Å; V43-L47 VanDerWaalsContact O-N 3.15Å
44	I	65.1	Low	60.1	Low	121 Å²	121	119.4 Å²	119.4	62%	0.621	67%	0.665	S	S	*	*	H	α-helix	trans	-71.9	-30.9	-179.7	-63.4	159.4	0	0	0	112.2	A40 T41 W46	A40-I44 WeakPolarHBondContact O-CD1 3.44Å; A40-I44 WeakPolarHBondContact O-CG1 3.46Å; A40-I44 PolarHBondContact O-N 3.37Å; A40-I44 VanDerWaalsContact O-N 3.16Å; T41-I44 PolarHBondContact O-N 3.38Å; I44-W46 VanDerWaalsContact C-N 3.33Å
45	V	65.6	Low	60.8	Low	115 Å²	115	120.1 Å²	120.1	70%	0.697	66%	0.661	S	S	*	*	H	α-helix	trans	-75.3	-24.5	175.7	169.3	0	0	0	0	112.3	T41	T41-V45 WeakPolarHBondContact O-CG2 3.36Å; T41-V45 PolarHBondContact O-N 3.16Å
46	W	57.1	Low	60.9	Low	222 Å²	222	118.8 Å²	118.8	84%	0.841	66%	0.657	S	S	*	*	H	α-helix	trans	-96.1	-8.2	-179	-92.5	84	0	0	0	114.6	V42 V43 I44	V42-W46 PolarHBondContact O-N 3.46Å; V43-W46 PolarHBondContact O-N 3.36Å; I44-W46 VanDerWaalsContact C-N 3.33Å
47	L	63.9	Low	60.9	Low	191 Å²	191	113.2 Å²	113.2	100%	1	64%	0.635	S	S	*	*			trans	-90.9	0	169.8	-78	169.3	0	0	0	110.2	V43	V43-L47 HydrophobicContact CG1-CD1 3.94Å; V43-L47 HydrophobicContact CG1-CG 4.44Å; V43-L47 WeakPolarHBondContact O-CG 3.42Å; V43-L47 PolarHBondContact O-N 3.15Å; V43-L47 VanDerWaalsContact O-N 3.15Å

Retrieved 47 of 47 residues in 38.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).