A0A087X1L6_HUMAN Loading...

Eukaryotic translation initiation factor 2D

AlphaFold DB , UniProt , Accession A0A087X1L6, Species HUMAN (Homo sapiens, Human), Gene EIF2D, Length 62 aa.

						>A0A087X1L6_HUMAN|A0A087X1L6|EIF2D
DSLLTRCLEKLQPAYQVTLPGQEPIVKKGRICPIDITLAQRASNKKITKLRLSLRNMPVVPC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	D	66.8	Low	90.5	Very high	165 Å²	165	121.5 Å²	121.5	88%	0.882	63%	0.63	S	S	*	*				0	44.9	0	-68.5	-89.9	0	0	0	115.4	T5	D1-T5 PolarHBondContact O-OG1 3.48Å; D1-T5 VanDerWaalsContact O-OG1 3.07Å
2	S	85.9	Confident	90.6	Very high	107 Å²	107	124.2 Å²	124.2	75%	0.748	64%	0.637	S	S	*	*	H	α-helix	trans	-82.8	-31.4	-177.1	53.4	0	0	0	0	114.5	R6	S2-R6 WeakPolarHBondContact O-CB 3.47Å; S2-R6 PolarHBondContact O-N 3.01Å
3	L	93.7	Very high	90.6	Very high	127 Å²	127	119.9 Å²	119.9	67%	0.665	62%	0.623	S	S	*	*	H	α-helix	trans	-67.7	-48.8	-178.4	-171.4	95.1	0	0	0	111.7	R6 C7	L3-R6 PolarHBondContact O-N 3.43Å; L3-C7 PolarHBondContact O-N 3.19Å; L3-C7 PolarHBondContact O-SG 3.25Å
4	L	94	Very high	90.6	Very high	108 Å²	108	116.1 Å²	116.1	57%	0.565	62%	0.618	S	S	*	*	H	α-helix	trans	-63.6	-45.7	-176.6	-71	169.4	0	0	0	111.4	R6 C7 L8	L4-R6 VanDerWaalsContact C-N 3.35Å; L4-R6 PolarHBondContact O-N 3.17Å; L4-C7 WeakPolarHBondContact O-CB 3.01Å; L4-C7 PolarHBondContact O-N 2.98Å; L4-C7 VanDerWaalsContact O-N 3.17Å; L4-L8 WeakPolarHBondContact O-CG 3.49Å; L4-L8 PolarHBondContact O-N 2.91Å
5	T	93.9	Very high	90.5	Very high	69 Å²	69	110.9 Å²	110.9	42%	0.423	59%	0.586	S	S	.	*	H	α-helix	trans	-57.3	-47.4	176	-53.7	0	0	0	0	111.4	D1 C7 L8 E9	D1-T5 PolarHBondContact O-OG1 3.48Å; D1-T5 VanDerWaalsContact O-OG1 3.07Å; T5-C7 VanDerWaalsContact C-N 3.31Å; T5-C7 PolarHBondContact O-N 2.85Å; T5-L8 PolarHBondContact O-N 3.25Å; T5-E9 HydrophobicContact CG2-CG 4.38Å; T5-E9 WeakPolarHBondContact O-CB 3.26Å; T5-E9 VanDerWaalsContact O-CG 3.29Å; T5-E9 WeakPolarHBondContact O-CG 3.35Å; T5-E9 PolarHBondContact O-N 2.97Å
6	R	94.1	Very high	90.4	Very high	155 Å²	155	111.7 Å²	111.7	59%	0.585	59%	0.586	S	S	*	*	H	α-helix	trans	-64.1	-34.4	178.3	-175.7	175.1	179.7	-118.9	7	112.9	S2 L3 L4 K10	S2-R6 WeakPolarHBondContact O-CB 3.47Å; S2-R6 PolarHBondContact O-N 3.01Å; L3-R6 PolarHBondContact O-N 3.43Å; L4-R6 VanDerWaalsContact C-N 3.35Å; L4-R6 PolarHBondContact O-N 3.17Å; R6-K10 WeakPolarHBondContact O-CG 3.38Å; R6-K10 PolarHBondContact O-N 2.81Å
7	C	94.3	Very high	90.2	Very high	69 Å²	69	106.5 Å²	106.5	47%	0.466	56%	0.559	S	S	.	*	H	α-helix	trans	-67	-47.2	174.2	-69.6	0	0	0	0	110.9	L3 L4 T5 K10 L11	L3-C7 PolarHBondContact O-N 3.19Å; L3-C7 PolarHBondContact O-SG 3.25Å; L4-C7 WeakPolarHBondContact O-CB 3.01Å; L4-C7 PolarHBondContact O-N 2.98Å; L4-C7 VanDerWaalsContact O-N 3.17Å; T5-C7 VanDerWaalsContact C-N 3.31Å; T5-C7 PolarHBondContact O-N 2.85Å; C7-K10 PolarHBondContact O-N 3.35Å; C7-L11 PolarHBondContact O-N 2.8Å
8	L	92.4	Very high	90.1	Very high	123 Å²	123	105.2 Å²	105.2	64%	0.644	56%	0.557	S	S	*	*	H	α-helix	trans	-65.2	-38.7	-179.3	-70	175.7	0	0	0	112.7	L4 T5 K10 L11	L4-L8 WeakPolarHBondContact O-CG 3.49Å; L4-L8 PolarHBondContact O-N 2.91Å; T5-L8 PolarHBondContact O-N 3.25Å; L8-K10 VanDerWaalsContact C-N 3.26Å; L8-K10 PolarHBondContact O-N 2.83Å; L8-L11 HydrophobicContact CD2-CD1 4.15Å; L8-L11 PolarHBondContact O-N 3.14Å
9	E	92.1	Very high	89.9	Confident	150 Å²	150	102 Å²	102	70%	0.701	54%	0.54	S	S	*	.	H	α-helix	trans	-66.8	-26	177.3	-74.3	174.2	165.8	0	0	113.5	T5	T5-E9 HydrophobicContact CG2-CG 4.38Å; T5-E9 WeakPolarHBondContact O-CB 3.26Å; T5-E9 VanDerWaalsContact O-CG 3.29Å; T5-E9 WeakPolarHBondContact O-CG 3.35Å; T5-E9 PolarHBondContact O-N 2.97Å
10	K	94	Very high	89.9	Confident	149 Å²	149	103.4 Å²	103.4	65%	0.648	56%	0.555	S	S	*	*	H	α-helix	trans	-80.7	-17.4	176.4	-75.6	-176.5	176	-165.3	0	113.4	R6 C7 L8	R6-K10 WeakPolarHBondContact O-CG 3.38Å; R6-K10 PolarHBondContact O-N 2.81Å; C7-K10 PolarHBondContact O-N 3.35Å; L8-K10 VanDerWaalsContact C-N 3.26Å; L8-K10 PolarHBondContact O-N 2.83Å
11	L	93.9	Very high	89.8	Confident	114 Å²	114	102.8 Å²	102.8	60%	0.597	57%	0.573	S	S	*	*	S	Bend	trans	-75.1	149.1	177.1	-64.2	173.5	0	0	0	110.5	C7 L8	C7-L11 PolarHBondContact O-N 2.8Å; L8-L11 HydrophobicContact CD2-CD1 4.15Å; L8-L11 PolarHBondContact O-N 3.14Å
12	Q	91.8	Very high	90.6	Very high	154 Å²	154	97.8 Å²	97.8	72%	0.72	54%	0.544	S	S	*	.	P	Polyproline II helix	trans	-68.7	127.4	171.7	-68.7	-173.9	-1.8	0	0	109.2
13	P	90.8	Very high	90.7	Very high	69 Å²	69	100.6 Å²	100.6	45%	0.448	55%	0.546	S	S	.	.	P	Polyproline II helix	trans	-64.2	142.3	178.2	26	-33.2	0	0	0	110.1	G29 R30	P13-G29 CarbonylContact C-O 3.52Å; P13-G29 PolarHBondContact O-N 3Å; P13-R30 HydrophobicContact CB-CG 4.15Å; P13-R30 HydrophobicContact CG-CG 4.32Å
14	A	90.6	Very high	90.5	Very high	67 Å²	67	98 Å²	98	55%	0.554	54%	0.537	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-148.7	159.9	174.7	0	0	0	0	0	109.7	K27	A14-K27 CarbonylContact C-O 3.44Å; A14-K27 WeakPolarHBondContact CA-O 3.47Å; A14-K27 WeakPolarHBondContact CB-O 3.39Å
15	Y	88.9	Confident	90.2	Very high	38 Å²	38	95.1 Å²	95.1	15%	0.149	52%	0.521	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.9	155.2	174.2	63.8	-86.5	0	0	0	110.6	V17 K27 G29 I31	Y15-V17 HydrophobicContact CD2-CG2 3.64Å; Y15-V17 HydrophobicContact CE2-CG2 3.64Å; Y15-K27 HydrophobicContact CD1-CB 4.13Å; Y15-K27 HydrophobicContact CD2-CB 4.23Å; Y15-K27 HydrophobicContact CE1-CB 3.59Å; Y15-K27 HydrophobicContact CE2-CB 3.69Å; Y15-K27 HydrophobicContact CE2-CG 3.95Å; Y15-K27 HydrophobicContact CG-CB 4.43Å; Y15-K27 PolarHBondContact N-O 3.32Å; Y15-K27 PolarHBondContact O-N 3.34Å; Y15-G29 WeakPolarHBondContact CD1-O 3.47Å; Y15-I31 HydrophobicContact CD1-CB 4.33Å; Y15-I31 HydrophobicContact CD2-CD1 4.44Å; Y15-I31 HydrophobicContact CD2-CG1 4.48Å; Y15-I31 HydrophobicContact CG-CB 4.31Å
16	Q	89.2	Confident	90	Very high	123 Å²	123	96.6 Å²	96.6	58%	0.575	53%	0.53	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-115.2	136.5	173.7	-177.9	-179.9	-61.3	0	0	109	P24 I25 V26	Q16-P24 HydrophobicContact CG-CB 3.81Å; Q16-I25 WeakPolarHBondContact CA-O 3.2Å; Q16-V26 HydrophobicContact CG-CG2 4.41Å
17	V	87.3	Confident	89.6	Confident	23 Å²	23	91.7 Å²	91.7	14%	0.139	51%	0.513	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.8	126.9	173.3	-175.5	0	0	0	0	108.2	Y15 L19 I25 M57	Y15-V17 HydrophobicContact CD2-CG2 3.64Å; Y15-V17 HydrophobicContact CE2-CG2 3.64Å; V17-L19 HydrophobicContact CG1-CD2 4.07Å; V17-L19 HydrophobicContact CG1-CG 4.28Å; V17-I25 PolarHBondContact N-O 3.42Å; V17-I25 PolarHBondContact O-N 2.79Å; V17-M57 HydrophobicContact CG2-CE 3.93Å
18	T	89.1	Confident	89.2	Confident	83 Å²	83	96.6 Å²	96.6	51%	0.509	53%	0.526	S	S	.	.			trans	-116.2	115	171.8	-56.7	0	0	0	0	107.5	P24	T18-P24 HydrophobicContact CG2-CG 4.38Å; T18-P24 WeakPolarHBondContact OG1-CB 3.39Å
19	L	85.5	Confident	89	Confident	45 Å²	45	92.1 Å²	92.1	24%	0.236	51%	0.509	C	S	.	.			trans	-92.1	146.3	172.5	-62.6	-178.3	0	0	0	109.2	V17 G21 Q22 P58 V60	V17-L19 HydrophobicContact CG1-CD2 4.07Å; V17-L19 HydrophobicContact CG1-CG 4.28Å; L19-G21 PolarHBondContact O-N 3.36Å; L19-Q22 HydrophobicContact CB-CB 4.29Å; L19-Q22 HydrophobicContact CB-CG 4.48Å; L19-Q22 PolarHBondContact O-N 3.17Å; L19-P58 HydrophobicContact CD1-CG 3.8Å; L19-V60 HydrophobicContact CD1-CG2 3.55Å
20	P	89.1	Confident	88.6	Confident	129 Å²	129	94.9 Å²	94.9	84%	0.838	51%	0.513	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.1	126.4	174.7	-25.6	34.5	0	0	0	110.9	Q22	P20-Q22 VanDerWaalsContact C-N 3.34Å; P20-Q22 PolarHBondContact O-N 2.91Å
21	G	88	Confident	88.2	Confident	91 Å²	91	93.1 Å²	93.1	94%	0.938	51%	0.51	S	S	*	.	T	Hydrogen-bonded Turn	trans	77.7	9.2	179.9	0	0	0	0	0	115.9	L19	L19-G21 PolarHBondContact O-N 3.36Å
22	Q	83.8	Confident	87.6	Confident	60 Å²	60	90.4 Å²	90.4	28%	0.28	50%	0.5	S	S	.	.	S	Bend	trans	-124.1	156.2	175.5	-66.7	-173.7	30.9	0	0	112.7	L19 P20	L19-Q22 HydrophobicContact CB-CB 4.29Å; L19-Q22 HydrophobicContact CB-CG 4.48Å; L19-Q22 PolarHBondContact O-N 3.17Å; P20-Q22 VanDerWaalsContact C-N 3.34Å; P20-Q22 PolarHBondContact O-N 2.91Å
23	E	87.7	Confident	87	Confident	167 Å²	167	88.2 Å²	88.2	78%	0.78	50%	0.499	S	S	*	.			trans	-66.5	147.4	170.7	-65.1	-164.3	139.6	0	0	111.2	I25	E23-I25 PolarHBondContact O-N 2.85Å
24	P	89.7	Confident	86.5	Confident	73 Å²	73	89.6 Å²	89.6	47%	0.474	50%	0.502	S	S	.	.			trans	-60.8	134.3	176.6	-20	31.1	0	0	0	112.3	Q16 T18	Q16-P24 HydrophobicContact CG-CB 3.81Å; T18-P24 HydrophobicContact CG2-CG 4.38Å; T18-P24 WeakPolarHBondContact OG1-CB 3.39Å
25	I	87.7	Confident	86	Confident	47 Å²	47	89.7 Å²	89.7	24%	0.241	49%	0.493	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	122.1	-179.5	-69.2	157.4	0	0	0	109.5	Q16 V17 E23 K27 P58	Q16-I25 WeakPolarHBondContact CA-O 3.2Å; V17-I25 PolarHBondContact N-O 3.42Å; V17-I25 PolarHBondContact O-N 2.79Å; E23-I25 PolarHBondContact O-N 2.85Å; I25-K27 HydrophobicContact CG2-CD 4.28Å; I25-K27 HydrophobicContact CG2-CG 4.28Å; I25-P58 HydrophobicContact CD1-CB 3.83Å; I25-P58 HydrophobicContact CD1-CG 3.52Å
26	V	89.3	Confident	85.5	Confident	100 Å²	100	93.1 Å²	93.1	61%	0.606	51%	0.513	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93	133.1	177.5	-176.5	0	0	0	0	110.3	Q16	Q16-V26 HydrophobicContact CG-CG2 4.41Å
27	K	85.7	Confident	85	Confident	52 Å²	52	90.2 Å²	90.2	23%	0.226	50%	0.503	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130	141.5	178	-64.4	-65.8	177.5	174.5	0	110.6	A14 Y15 I25 N56	A14-K27 CarbonylContact C-O 3.44Å; A14-K27 WeakPolarHBondContact CA-O 3.47Å; A14-K27 WeakPolarHBondContact CB-O 3.39Å; Y15-K27 HydrophobicContact CD1-CB 4.13Å; Y15-K27 HydrophobicContact CD2-CB 4.23Å; Y15-K27 HydrophobicContact CE1-CB 3.59Å; Y15-K27 HydrophobicContact CE2-CB 3.69Å; Y15-K27 HydrophobicContact CE2-CG 3.95Å; Y15-K27 HydrophobicContact CG-CB 4.43Å; Y15-K27 PolarHBondContact N-O 3.32Å; Y15-K27 PolarHBondContact O-N 3.34Å; I25-K27 HydrophobicContact CG2-CD 4.28Å; I25-K27 HydrophobicContact CG2-CG 4.28Å; K27-N56 HydrophobicContact CD-CB 4.07Å; K27-N56 WeakPolarHBondContact CE-O 3.48Å; K27-N56 PolarHBondContact NZ-O 3.29Å; K27-N56 VanDerWaalsContact NZ-O 3.14Å
28	K	87.6	Confident	84.5	Confident	172 Å²	172	94.6 Å²	94.6	75%	0.748	53%	0.525	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.6	152.1	172.6	-60.6	-175.1	-179.2	-174.9	0	110.1
29	G	87.2	Confident	84	Confident	28 Å²	28	91.5 Å²	91.5	29%	0.289	51%	0.508	S	S	.	.	S	Bend	trans	95.3	-174.4	-178	0	0	0	0	0	112.9	P13 Y15	P13-G29 CarbonylContact C-O 3.52Å; P13-G29 PolarHBondContact O-N 3Å; Y15-G29 WeakPolarHBondContact CD1-O 3.47Å
30	R	84.8	Confident	83.4	Confident	209 Å²	209	95.1 Å²	95.1	79%	0.789	52%	0.524	S	S	*	.	P	Polyproline II helix	trans	-87.5	150.9	175.1	-63.6	-178.4	180	-177.4	-0.8	109.8	P13 C32	P13-R30 HydrophobicContact CB-CG 4.15Å; P13-R30 HydrophobicContact CG-CG 4.32Å; R30-C32 PolarHBondContact O-N 2.88Å
31	I	85.1	Confident	82.5	Confident	112 Å²	112	97.7 Å²	97.7	57%	0.574	52%	0.517	S	S	*	.	P	Polyproline II helix	trans	-66.5	131.9	172.2	-164.4	164.5	0	0	0	109.4	Y15 M57	Y15-I31 HydrophobicContact CD1-CB 4.33Å; Y15-I31 HydrophobicContact CD2-CD1 4.44Å; Y15-I31 HydrophobicContact CD2-CG1 4.48Å; Y15-I31 HydrophobicContact CG-CB 4.31Å; I31-M57 HydrophobicContact CD1-CE 4.32Å; I31-M57 HydrophobicContact CG1-CE 4.48Å
32	C	80.1	Confident	81.6	Confident	57 Å²	57	96.4 Å²	96.4	39%	0.385	50%	0.497	S	S	.	.	P	Polyproline II helix	trans	-100.7	137.4	174.1	-63.5	0	0	0	0	109	R30 S53	R30-C32 PolarHBondContact O-N 2.88Å; C32-S53 WeakPolarHBondContact CB-OG 3.29Å
33	P	80.2	Confident	80.3	Confident	108 Å²	108	98.9 Å²	98.9	70%	0.701	52%	0.521	S	S	*	.	P	Polyproline II helix	trans	-64.7	154.4	176	28.7	-34.4	0	0	0	111	D35	P33-D35 PolarHBondContact O-N 3.47Å
34	I	81.2	Confident	79.5	Confident	98 Å²	98	97.7 Å²	97.7	50%	0.503	52%	0.52	S	S	.	.	P	Polyproline II helix	trans	-75.9	119.1	170.4	-60.8	172.4	0	0	0	107.4	I36 L52 L54	I34-I36 HydrophobicContact CG2-CG1 4.17Å; I34-L52 HydrophobicContact CG1-CD2 4.32Å; I34-L52 HydrophobicContact CG2-CD2 4.18Å; I34-L54 HydrophobicContact CG1-CD1 4.44Å
35	D	78.4	Confident	78.7	Confident	69 Å²	69	101.6 Å²	101.6	37%	0.369	53%	0.53	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.5	112.9	-179.9	-173.7	7.7	0	0	0	109.8	P33 T37 R51	P33-D35 PolarHBondContact O-N 3.47Å; D35-T37 PolarHBondContact OD1-OG1 2.96Å; D35-R51 HydrophobicContact CB-CB 4.29Å; D35-R51 PolarHBondContact N-O 3.17Å; D35-R51 PolarHBondContact O-N 3.47Å
36	I	78.4	Confident	78.1	Confident	110 Å²	110	107 Å²	107	56%	0.564	55%	0.551	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-107.1	102.4	177.8	-52.9	-177.2	0	0	0	107.2	I34 T48 L50	I34-I36 HydrophobicContact CG2-CG1 4.17Å; I36-T48 HydrophobicContact CG2-CG2 3.99Å; I36-L50 HydrophobicContact CB-CD2 4.21Å; I36-L50 HydrophobicContact CD1-CD2 4.17Å; I36-L50 HydrophobicContact CG1-CD2 3.71Å; I36-L50 HydrophobicContact CG2-CD2 3.92Å
37	T	80.1	Confident	77.5	Confident	61 Å²	61	104.7 Å²	104.7	37%	0.374	54%	0.536	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.9	129	-177.5	-33.6	0	0	0	0	110.6	D35 K49	D35-T37 PolarHBondContact OD1-OG1 2.96Å; T37-K49 PolarHBondContact N-O 3.28Å; T37-K49 WeakPolarHBondContact O-CA 3.45Å; T37-K49 WeakPolarHBondContact O-CB 3.34Å; T37-K49 PolarHBondContact O-N 2.99Å; T37-K49 VanDerWaalsContact O-O 3.11Å
38	L	76.8	Confident	77.1	Confident	115 Å²	115	106.5 Å²	106.5	60%	0.602	55%	0.551	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-83.1	120.3	168.5	-67.6	173.3	0	0	0	109	T48	L38-T48 HydrophobicContact CD2-CG2 4.47Å
39	A	77.8	Confident	76.4	Confident	19 Å²	19	103.3 Å²	103.3	16%	0.157	54%	0.537	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.2	137.3	175.3	0	0	0	0	0	110.7	I47 K49	A39-I47 PolarHBondContact N-O 3.26Å; A39-I47 PolarHBondContact O-N 2.89Å; A39-K49 HydrophobicContact CB-CD 3.54Å; A39-K49 HydrophobicContact CB-CG 3.97Å
40	Q	72.6	Confident	75.6	Confident	120 Å²	120	107.7 Å²	107.7	56%	0.561	55%	0.553	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-97.2	124.6	174.2	-171.6	170.9	-1.4	0	0	108.9
41	R	70.1	Confident	74.8	Confident	183 Å²	183	105.8 Å²	105.8	69%	0.691	55%	0.546	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.8	-35.2	-179.1	-83.9	-163.3	-129.1	-168.2	12.5	113.9	K45 I47	R41-K45 PolarHBondContact N-O 3.36Å; R41-I47 HydrophobicContact CB-CD1 3.88Å; R41-I47 HydrophobicContact CG-CD1 3.67Å
42	A	69.2	Low	73.5	Confident	64 Å²	64	104.6 Å²	104.6	53%	0.529	54%	0.54	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-174.3	154.4	173.8	0	0	0	0	0	110.4	N44 K45	A42-N44 PolarHBondContact O-N 2.99Å; A42-K45 WeakPolarHBondContact O-CB 3.48Å; A42-K45 PolarHBondContact O-N 3.21Å
43	S	57.8	Low	72.3	Confident	112 Å²	112	104.8 Å²	104.8	78%	0.783	54%	0.542	S	S	*	.	T	Hydrogen-bonded Turn	trans	30.4	75.9	171.7	-167.7	0	0	0	0	114.9	K45	S43-K45 PolarHBondContact O-N 2.88Å
44	N	70.1	Confident	70.9	Confident	143 Å²	143	100.5 Å²	100.5	77%	0.765	51%	0.513	S	S	*	.	T	Hydrogen-bonded Turn	trans	49.7	8.7	-179.7	-68.5	-29.4	0	0	0	117.9	A42 K46	A42-N44 PolarHBondContact O-N 2.99Å; N44-K46 PolarHBondContact O-N 3.07Å
45	K	72.1	Confident	69.6	Low	155 Å²	155	107.7 Å²	107.7	67%	0.674	53%	0.534	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-78.9	102.3	173.4	-62.4	-175.7	-178.3	-174.7	0	109.6	R41 A42 S43	R41-K45 PolarHBondContact N-O 3.36Å; A42-K45 WeakPolarHBondContact O-CB 3.48Å; A42-K45 PolarHBondContact O-N 3.21Å; S43-K45 PolarHBondContact O-N 2.88Å
46	K	75.1	Confident	68.4	Low	159 Å²	159	108.6 Å²	108.6	69%	0.691	54%	0.539	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-79.5	139.5	170.9	-69.3	-177.9	-179.7	177.4	0	110.1	N44	N44-K46 PolarHBondContact O-N 3.07Å
47	I	77.6	Confident	67.4	Low	53 Å²	53	105.9 Å²	105.9	27%	0.272	53%	0.525	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129	128.4	176.4	-63.4	172.7	0	0	0	107.3	A39 R41 K49	A39-I47 PolarHBondContact N-O 3.26Å; A39-I47 PolarHBondContact O-N 2.89Å; R41-I47 HydrophobicContact CB-CD1 3.88Å; R41-I47 HydrophobicContact CG-CD1 3.67Å; I47-K49 PolarHBondContact O-N 2.92Å
48	T	76.3	Confident	66.2	Low	89 Å²	89	104.8 Å²	104.8	55%	0.546	52%	0.518	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78	111.9	172.3	-49.7	0	0	0	0	108.3	I36 L38 L50	I36-T48 HydrophobicContact CG2-CG2 3.99Å; L38-T48 HydrophobicContact CD2-CG2 4.47Å; T48-L50 HydrophobicContact CG2-CD2 4.45Å
49	K	73.4	Confident	65.2	Low	105 Å²	105	104.8 Å²	104.8	46%	0.457	52%	0.523	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.4	113.7	169.6	-68.1	-177.3	-178.1	169	0	107.6	T37 A39 I47	T37-K49 PolarHBondContact N-O 3.28Å; T37-K49 WeakPolarHBondContact O-CA 3.45Å; T37-K49 WeakPolarHBondContact O-CB 3.34Å; T37-K49 PolarHBondContact O-N 2.99Å; T37-K49 VanDerWaalsContact O-O 3.11Å; A39-K49 HydrophobicContact CB-CD 3.54Å; A39-K49 HydrophobicContact CB-CG 3.97Å; I47-K49 PolarHBondContact O-N 2.92Å
50	L	70.6	Confident	63.9	Low	120 Å²	120	107.9 Å²	107.9	63%	0.628	54%	0.54	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.1	109.4	167.2	-65.2	172.3	0	0	0	107.2	I36 T48	I36-L50 HydrophobicContact CB-CD2 4.21Å; I36-L50 HydrophobicContact CD1-CD2 4.17Å; I36-L50 HydrophobicContact CG1-CD2 3.71Å; I36-L50 HydrophobicContact CG2-CD2 3.92Å; T48-L50 HydrophobicContact CG2-CD2 4.45Å
51	R	66.9	Low	62.7	Low	169 Å²	169	107.4 Å²	107.4	64%	0.638	55%	0.547	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.8	95.7	168.6	-174	180	-177.1	-173.3	0.3	107.4	D35 S53	D35-R51 HydrophobicContact CB-CB 4.29Å; D35-R51 PolarHBondContact N-O 3.17Å; D35-R51 PolarHBondContact O-N 3.47Å; R51-S53 PolarHBondContact O-N 3.23Å
52	L	59	Low	61.5	Low	87 Å²	87	108.1 Å²	108.1	46%	0.455	58%	0.578	S	S	.	*			trans	-67.1	101.2	159.3	-66	165.8	0	0	0	106.2	I34 L54 V59	I34-L52 HydrophobicContact CG1-CD2 4.32Å; I34-L52 HydrophobicContact CG2-CD2 4.18Å; L52-L54 HydrophobicContact CB-CB 4.44Å; L52-L54 HydrophobicContact CD2-CD1 4.36Å; L52-L54 PolarHBondContact O-N 3.37Å; L52-V59 HydrophobicContact CD1-CG1 4.4Å
53	S	54.6	Low	61.1	Low	61 Å²	61	110.3 Å²	110.3	43%	0.427	58%	0.58	S	S	.	*			trans	-66.4	6.3	167.4	66	0	0	0	0	112.2	C32 R51	C32-S53 WeakPolarHBondContact CB-OG 3.29Å; R51-S53 PolarHBondContact O-N 3.23Å
54	L	51.8	Low	61.3	Low	18 Å²	18	110.2 Å²	110.2	9%	0.094	57%	0.569	C	S	.	*			trans	-97.3	93.4	-179.3	-67.6	151.3	0	0	0	107.8	I34 L52 N56 M57	I34-L54 HydrophobicContact CG1-CD1 4.44Å; L52-L54 HydrophobicContact CB-CB 4.44Å; L52-L54 HydrophobicContact CD2-CD1 4.36Å; L52-L54 PolarHBondContact O-N 3.37Å; L54-N56 PolarHBondContact O-N 2.77Å; L54-M57 HydrophobicContact CB-CB 3.87Å; L54-M57 HydrophobicContact CB-CG 4.11Å; L54-M57 HydrophobicContact CD1-CB 3.8Å; L54-M57 HydrophobicContact CD1-CE 3.97Å; L54-M57 HydrophobicContact CD1-CG 3.4Å; L54-M57 HydrophobicContact CD1-SD 3.81Å; L54-M57 HydrophobicContact CD2-CB 4.38Å; L54-M57 HydrophobicContact CD2-CE 4.38Å; L54-M57 HydrophobicContact CD2-CG 3.69Å; L54-M57 HydrophobicContact CG-CB 4.18Å; L54-M57 HydrophobicContact CG-CG 3.87Å
55	R	53.4	Low	60.8	Low	250 Å²	250	108.4 Å²	108.4	94%	0.943	56%	0.559	S	S	*	*	S	Bend	trans	-56.2	-7.4	155	-85.4	-175.1	-174.1	167.9	2.2	112.4
56	N	53	Low	60.1	Low	88 Å²	88	105.6 Å²	105.6	47%	0.471	55%	0.552	S	S	.	*	S	Bend	trans	-136.7	-0.7	-161.8	-74.7	54.4	0	0	0	116	K27 L54	K27-N56 HydrophobicContact CD-CB 4.07Å; K27-N56 WeakPolarHBondContact CE-O 3.48Å; K27-N56 PolarHBondContact NZ-O 3.29Å; K27-N56 VanDerWaalsContact NZ-O 3.14Å; L54-N56 PolarHBondContact O-N 2.77Å
57	M	56.4	Low	59.2	Low	53 Å²	53	102.3 Å²	102.3	26%	0.261	54%	0.543	S	S	.	.	S	Bend	trans	-76.1	129.5	167.8	-88.6	-143.7	-167.7	0	0	108.3	V17 I31 L54 V59	V17-M57 HydrophobicContact CG2-CE 3.93Å; I31-M57 HydrophobicContact CD1-CE 4.32Å; I31-M57 HydrophobicContact CG1-CE 4.48Å; L54-M57 HydrophobicContact CB-CB 3.87Å; L54-M57 HydrophobicContact CB-CG 4.11Å; L54-M57 HydrophobicContact CD1-CB 3.8Å; L54-M57 HydrophobicContact CD1-CE 3.97Å; L54-M57 HydrophobicContact CD1-CG 3.4Å; L54-M57 HydrophobicContact CD1-SD 3.81Å; L54-M57 HydrophobicContact CD2-CB 4.38Å; L54-M57 HydrophobicContact CD2-CE 4.38Å; L54-M57 HydrophobicContact CD2-CG 3.69Å; L54-M57 HydrophobicContact CG-CB 4.18Å; L54-M57 HydrophobicContact CG-CG 3.87Å; M57-V59 PolarHBondContact O-N 3.42Å
58	P	55.9	Low	58	Low	37 Å²	37	105.6 Å²	105.6	24%	0.24	56%	0.561	C	S	.	*			trans	-59.5	110.8	176.7	29.3	-37.3	0	0	0	107.7	L19 I25 V60	L19-P58 HydrophobicContact CD1-CG 3.8Å; I25-P58 HydrophobicContact CD1-CB 3.83Å; I25-P58 HydrophobicContact CD1-CG 3.52Å; P58-V60 PolarHBondContact O-N 3.33Å
59	V	55.6	Low	56.7	Low	116 Å²	116	106.8 Å²	106.8	70%	0.703	56%	0.562	S	S	*	*	P	Polyproline II helix	trans	-64.5	118.1	159.9	-88.9	0	0	0	0	105.7	L52 M57 P61	L52-V59 HydrophobicContact CD1-CG1 4.4Å; M57-V59 PolarHBondContact O-N 3.42Å; V59-P61 VanDerWaalsContact O-CD 3.26Å; V59-P61 WeakPolarHBondContact O-CD 3.33Å
60	V	50.8	Low	55.4	Low	83 Å²	83	106.9 Å²	106.9	50%	0.503	57%	0.57	S	S	.	*	P	Polyproline II helix	trans	-64.5	118.9	171.7	-170.9	0	0	0	0	106.7	L19 P58 C62	L19-V60 HydrophobicContact CD1-CG2 3.55Å; P58-V60 PolarHBondContact O-N 3.33Å; V60-C62 PolarHBondContact O-N 3.44Å
61	P	47.5	Very low	54.1	Low	111 Å²	111	105.8 Å²	105.8	72%	0.721	57%	0.566	S	S	*	*	P	Polyproline II helix	trans	-65.8	118.7	162.2	27.1	-28.2	0	0	0	106.5	V59	V59-P61 VanDerWaalsContact O-CD 3.26Å; V59-P61 WeakPolarHBondContact O-CD 3.33Å
62	C	44.2	Very low	52.9	Low	197 Å²	197	100.1 Å²	100.1	100%	1.331	56%	0.559	S	S	*	*			trans	-61	0	166.3	-60.2	0	0	0	0	110.1	V60	V60-C62 PolarHBondContact O-N 3.44Å

Retrieved 62 of 62 residues in 31.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).