A0A087X1M7_HUMAN Loading...

Fragile X messenger ribonucleoprotein 1

AlphaFold DB , UniProt , Accession A0A087X1M7, Species HUMAN (Homo sapiens, Human), Gene FMR1, Length 31 aa.

						>A0A087X1M7_HUMAN|A0A087X1M7|FMR1
MEELVVEVRGSNGAFYKHWDFGELHCSGRGL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.8	Low	68.2	Low	192 Å²	192	118.4 Å²	118.4	95%	0.946	62%	0.616	S	S	*	*				0	113.6	0	-162.2	174.9	-150.2	0	0	105.1	L24	M1-L24 HydrophobicContact CE-CD1 3.52Å
2	E	54.4	Low	69.9	Low	195 Å²	195	117.5 Å²	117.5	91%	0.911	61%	0.612	S	S	*	*			trans	-95.6	131.1	-174.5	-68.2	-178.9	173.5	0	0	109.2
3	E	54.5	Low	70.8	Confident	135 Å²	135	110.5 Å²	110.5	63%	0.631	59%	0.586	S	S	*	*			trans	-77.2	122.5	-179.7	-66.6	176.2	167	0	0	110.1	W19	E3-W19 HydrophobicContact CB-CE3 4.47Å; E3-W19 WeakPolarHBondContact OE2-CZ3 3.25Å; E3-W19 VanDerWaalsContact OE2-CZ3 3.25Å; E3-W19 HydrophobicContact CG-CZ3 4.45Å; E3-W19 HydrophobicContact CB-CZ3 4.18Å
4	L	63.5	Low	71.7	Confident	115 Å²	115	105.4 Å²	105.4	60%	0.602	57%	0.568	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-96	101.9	172.3	-172.9	69.7	0	0	0	109.1	V6	L4-V6 HydrophobicContact CD2-CG1 4.18Å; L4-V6 HydrophobicContact CG-CG1 4.14Å; L4-V6 PolarHBondContact O-N 2.82Å
5	V	61.6	Low	72.1	Confident	77 Å²	77	106.9 Å²	106.9	47%	0.467	57%	0.567	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-76.8	113.8	175.9	-175.6	0	0	0	0	108.7	W19	V5-W19 HydrophobicContact CG2-CE3 4.28Å; V5-W19 HydrophobicContact CG2-CH2 4.18Å; V5-W19 HydrophobicContact CG2-CZ3 3.73Å
6	V	72.2	Confident	72.5	Confident	47 Å²	47	107.8 Å²	107.8	29%	0.285	56%	0.561	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-111.5	143.1	174.6	-71.6	0	0	0	0	110.6	L4 H18 D20	L4-V6 HydrophobicContact CD2-CG1 4.18Å; L4-V6 HydrophobicContact CG-CG1 4.14Å; L4-V6 PolarHBondContact O-N 2.82Å; V6-H18 HydrophobicContact CG2-CB 4.22Å; V6-H18 WeakPolarHBondContact CG2-O 3.35Å; V6-H18 PolarHBondContact N-O 2.83Å; V6-H18 PolarHBondContact O-N 3.29Å; V6-D20 HydrophobicContact CG2-CB 4.06Å
7	E	71.1	Confident	72.5	Confident	136 Å²	136	110.8 Å²	110.8	64%	0.636	57%	0.569	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-96	123.1	173.2	-67.4	-170.4	146.1	0	0	109.7	F15 Y16	E7-F15 HydrophobicContact CB-CB 4.5Å; E7-F15 HydrophobicContact CB-CD1 4.17Å; E7-Y16 WeakPolarHBondContact CA-O 3.46Å
8	V	77.1	Confident	72.5	Confident	71 Å²	71	110.1 Å²	110.1	43%	0.43	56%	0.563	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-107.6	131.7	178.8	178.9	0	0	0	0	109.4	F15 Y16 H18	V8-F15 CarbonylContact O-C 3.51Å; V8-F15 WeakPolarHBondContact O-CA 3.44Å; V8-Y16 PolarHBondContact N-O 2.88Å; V8-Y16 PolarHBondContact O-N 2.81Å; V8-H18 HydrophobicContact CB-CB 4.31Å; V8-H18 HydrophobicContact CG2-CB 3.53Å
9	R	79.4	Confident	72.3	Confident	170 Å²	170	111 Å²	111	64%	0.642	56%	0.558	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-85.3	119.7	177.8	-166.4	176.7	-177.3	-162.6	-4.8	111	G13 A14 F15	R9-G13 PolarHBondContact NE-O 2.83Å; R9-A14 CarbonylContact C-O 3.6Å; R9-A14 WeakPolarHBondContact CA-O 3.46Å; R9-F15 HydrophobicContact CB-CD1 4.08Å; R9-F15 HydrophobicContact CG-CZ 4.23Å; R9-F15 HydrophobicContact CG-CE1 4.22Å; R9-F15 HydrophobicContact CB-CE1 3.85Å; R9-F15 HydrophobicContact CB-CZ 4.34Å
10	G	82.1	Confident	71.9	Confident	23 Å²	23	109.4 Å²	109.4	24%	0.237	55%	0.551	C	S	.	*			trans	-72.1	165.7	173.7	0	0	0	0	0	113	N12 G13 A14	G10-N12 PolarHBondContact O-N 3.31Å; G10-G13 WeakPolarHBondContact O-CA 3.38Å; G10-G13 PolarHBondContact O-N 3.48Å; G10-A14 PolarHBondContact N-O 2.87Å
11	S	77.9	Confident	71.4	Confident	141 Å²	141	110.8 Å²	110.8	99%	0.986	55%	0.554	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.3	-23.2	179.2	54.4	0	0	0	0	113.8	G13	S11-G13 PolarHBondContact O-N 2.85Å
12	N	88.2	Confident	71.5	Confident	108 Å²	108	103.6 Å²	103.6	58%	0.578	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80	-0.9	171.1	62.8	-0.5	0	0	0	113.3	G10 A14 Y16	G10-N12 PolarHBondContact O-N 3.31Å; N12-A14 WeakPolarHBondContact OD1-CB 3.45Å; N12-A14 PolarHBondContact OD1-N 2.76Å; N12-A14 VanDerWaalsContact OD1-N 3.09Å; N12-Y16 PolarHBondContact ND2-OH 2.74Å
13	G	81.7	Confident	71.9	Confident	26 Å²	26	102.6 Å²	102.6	27%	0.268	53%	0.525	S	S	.	.	S	Bend	trans	85.9	-2.4	179.3	0	0	0	0	0	115.6	R9 G10 S11	R9-G13 PolarHBondContact NE-O 2.83Å; G10-G13 WeakPolarHBondContact O-CA 3.38Å; G10-G13 PolarHBondContact O-N 3.48Å; S11-G13 PolarHBondContact O-N 2.85Å
14	A	84.2	Confident	72	Confident	40 Å²	40	101.8 Å²	101.8	33%	0.331	52%	0.524	S	S	.	.			trans	-80.3	152.3	178.5	0	0	0	0	0	112.2	R9 G10 N12 Y16	R9-A14 CarbonylContact C-O 3.6Å; R9-A14 WeakPolarHBondContact CA-O 3.46Å; G10-A14 PolarHBondContact N-O 2.87Å; N12-A14 WeakPolarHBondContact OD1-CB 3.45Å; N12-A14 PolarHBondContact OD1-N 2.76Å; N12-A14 VanDerWaalsContact OD1-N 3.09Å; A14-Y16 HydrophobicContact CB-CE2 3.87Å
15	F	77.4	Confident	71.4	Confident	128 Å²	128	103.6 Å²	103.6	56%	0.561	53%	0.529	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-97	133.5	175.7	-69.7	-88.7	0	0	0	111	E7 V8 R9	E7-F15 HydrophobicContact CB-CB 4.5Å; E7-F15 HydrophobicContact CB-CD1 4.17Å; V8-F15 CarbonylContact O-C 3.51Å; V8-F15 WeakPolarHBondContact O-CA 3.44Å; R9-F15 HydrophobicContact CB-CD1 4.08Å; R9-F15 HydrophobicContact CG-CZ 4.23Å; R9-F15 HydrophobicContact CG-CE1 4.22Å; R9-F15 HydrophobicContact CB-CE1 3.85Å; R9-F15 HydrophobicContact CB-CZ 4.34Å
16	Y	77.4	Confident	71	Confident	120 Å²	120	104.9 Å²	104.9	47%	0.471	54%	0.54	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.6	139.2	179.1	-61.1	-87.6	0	0	0	109.6	E7 V8 N12 A14 H18	E7-Y16 WeakPolarHBondContact CA-O 3.46Å; V8-Y16 PolarHBondContact N-O 2.88Å; V8-Y16 PolarHBondContact O-N 2.81Å; N12-Y16 PolarHBondContact ND2-OH 2.74Å; A14-Y16 HydrophobicContact CB-CE2 3.87Å; Y16-H18 PolarHBondContact O-N 3.49Å
17	K	74	Confident	70.5	Confident	159 Å²	159	107.7 Å²	107.7	69%	0.691	56%	0.562	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-67.5	121.6	170.5	-66.3	-175.8	178.1	-175.1	0	108.5
18	H	72.1	Confident	69.7	Low	98 Å²	98	104.9 Å²	104.9	45%	0.454	57%	0.569	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-116.6	133.2	173.7	-176	72.7	0	0	0	108.7	V6 V8 Y16	V6-H18 HydrophobicContact CG2-CB 4.22Å; V6-H18 WeakPolarHBondContact CG2-O 3.35Å; V6-H18 PolarHBondContact N-O 2.83Å; V6-H18 PolarHBondContact O-N 3.29Å; V8-H18 HydrophobicContact CB-CB 4.31Å; V8-H18 HydrophobicContact CG2-CB 3.53Å; Y16-H18 PolarHBondContact O-N 3.49Å
19	W	68	Low	68.8	Low	128 Å²	128	113.3 Å²	113.3	49%	0.485	59%	0.593	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-93.5	102.9	175	-59.4	96.7	0	0	0	107.1	E3 V5 F21	E3-W19 HydrophobicContact CB-CE3 4.47Å; E3-W19 WeakPolarHBondContact OE2-CZ3 3.25Å; E3-W19 VanDerWaalsContact OE2-CZ3 3.25Å; E3-W19 HydrophobicContact CG-CZ3 4.45Å; E3-W19 HydrophobicContact CB-CZ3 4.18Å; V5-W19 HydrophobicContact CG2-CE3 4.28Å; V5-W19 HydrophobicContact CG2-CH2 4.18Å; V5-W19 HydrophobicContact CG2-CZ3 3.73Å; W19-F21 HydrophobicContact CB-CE2 3.86Å; W19-F21 HydrophobicContact CB-CZ 4.35Å
20	D	64.2	Low	67.4	Low	78 Å²	78	108.3 Å²	108.3	42%	0.417	60%	0.595	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-92.9	115.6	170.4	-170.9	1.7	0	0	0	108.1	V6 G22	V6-D20 HydrophobicContact CG2-CB 4.06Å; D20-G22 PolarHBondContact O-N 2.87Å; D20-G22 WeakPolarHBondContact OD1-CA 3.47Å; D20-G22 PolarHBondContact OD1-N 3.3Å
21	F	62.4	Low	65.6	Low	140 Å²	140	119.5 Å²	119.5	61%	0.614	65%	0.648	S	S	*	*			trans	-84.8	4.4	175.1	-70.3	-84.5	0	0	0	112	W19	W19-F21 HydrophobicContact CB-CE2 3.86Å; W19-F21 HydrophobicContact CB-CZ 4.35Å
22	G	58.6	Low	64.9	Low	41 Å²	41	118.4 Å²	118.4	42%	0.423	63%	0.631	S	S	.	*			trans	66.2	145.1	-164.3	0	0	0	0	0	109.4	D20 L24	D20-G22 PolarHBondContact O-N 2.87Å; D20-G22 WeakPolarHBondContact OD1-CA 3.47Å; D20-G22 PolarHBondContact OD1-N 3.3Å; G22-L24 PolarHBondContact O-N 2.99Å
23	E	61.5	Low	63.7	Low	173 Å²	173	118.9 Å²	118.9	81%	0.808	63%	0.634	S	S	*	*			trans	-54.5	108.6	165.6	-83.8	-175.8	161.3	0	0	108.5	H25	E23-H25 PolarHBondContact O-N 3.25Å
24	L	57.8	Low	62.7	Low	118 Å²	118	124.1 Å²	124.1	62%	0.618	65%	0.654	S	S	*	*			trans	-74.3	63.8	174.3	-151.5	129	0	0	0	108.1	M1 G22 C26	M1-L24 HydrophobicContact CE-CD1 3.52Å; G22-L24 PolarHBondContact O-N 2.99Å; L24-C26 WeakPolarHBondContact CD2-SG 3.4Å; L24-C26 PolarHBondContact O-N 3.09Å
25	H	51.5	Low	61.5	Low	153 Å²	153	129.1 Å²	129.1	71%	0.708	67%	0.673	S	S	*	*			trans	-67.8	83.6	159.8	-89.7	-122.7	0	0	0	106.5	E23 S27	E23-H25 PolarHBondContact O-N 3.25Å; H25-S27 PolarHBondContact O-N 3.49Å
26	C	52	Low	60.5	Low	104 Å²	104	129.1 Å²	129.1	70%	0.703	68%	0.68	S	S	*	*			trans	-59.4	88.8	149.7	-73.4	0	0	0	0	105.8	L24 G28	L24-C26 WeakPolarHBondContact CD2-SG 3.4Å; L24-C26 PolarHBondContact O-N 3.09Å; C26-G28 PolarHBondContact O-N 2.84Å
27	S	62.1	Low	59.3	Low	107 Å²	107	129.7 Å²	129.7	75%	0.748	69%	0.694	S	S	*	*			trans	-65.1	79.4	159.7	59.4	0	0	0	0	106.8	H25 R29	H25-S27 PolarHBondContact O-N 3.49Å; S27-R29 PolarHBondContact O-N 2.75Å
28	G	53.9	Low	58.3	Low	76 Å²	76	127.6 Å²	127.6	78%	0.784	70%	0.695	S	S	*	*			trans	-68.9	67.1	164.8	0	0	0	0	0	108.9	C26 G30	C26-G28 PolarHBondContact O-N 2.84Å; G28-G30 PolarHBondContact O-N 3.22Å
29	R	59	Low	57.2	Low	248 Å²	248	129.9 Å²	129.9	94%	0.936	71%	0.713	S	S	*	*			trans	-80.3	100.3	151	-110.5	-176.7	165.8	-170.3	-3.7	105.5	S27	S27-R29 PolarHBondContact O-N 2.75Å
30	G	49.7	Very low	56.3	Low	66 Å²	66	130.1 Å²	130.1	68%	0.68	73%	0.732	S	S	*	*			trans	175.2	83.6	174.8	0	0	0	0	0	113	G28	G28-G30 PolarHBondContact O-N 3.22Å
31	L	43.2	Very low	55.6	Low	257 Å²	257	134.8 Å²	134.8	100%	1.346	76%	0.761	S	S	*	*			trans	76.4	0	166.8	-55.3	174.5	0	0	0	117.8

Retrieved 31 of 31 residues in 41.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).