A0A087X1N6_HUMAN Loading...

Biogenesis of lysosomal organelles complex 1 subunit 2

AlphaFold DB , UniProt , Accession A0A087X1N6, Species HUMAN (Homo sapiens, Human), Gene BLOC1S2, Length 95 aa.

						>A0A087X1N6_HUMAN|A0A087X1N6|BLOC1S2
MRLPRKSLEVATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.7	Very low	64.6	Low	246 Å²	246	139.4 Å²	139.4	100%	1.212	68%	0.676	S	S	*	*				0	108.8	0	-121.9	171.7	173.3	0	0	107.8
2	R	52	Low	66.3	Low	249 Å²	249	132.8 Å²	132.8	94%	0.94	65%	0.651	S	S	*	*	P	Polyproline II helix	trans	-85.6	122.1	174	-81.6	-176.2	178.3	-177.9	-0.6	108
3	L	56.7	Low	68.1	Low	146 Å²	146	126.9 Å²	126.9	76%	0.764	63%	0.631	S	S	*	*	P	Polyproline II helix	trans	-60.4	139.9	172.2	-74.1	161.1	0	0	0	109.6	R5	L3-R5 PolarHBondContact O-N 3.01Å
4	P	64.9	Low	70	Confident	86 Å²	86	126.3 Å²	126.3	56%	0.558	63%	0.625	S	S	*	*	P	Polyproline II helix	trans	-65.5	134.4	-177.5	25.4	-31.2	0	0	0	110.6	K6 S7	P4-K6 PolarHBondContact O-N 3.22Å; P4-S7 PolarHBondContact O-N 3.12Å; P4-S7 PolarHBondContact O-OG 3.23Å
5	R	63.8	Low	71.5	Confident	217 Å²	217	125.1 Å²	125.1	82%	0.819	62%	0.623	S	S	*	*	H	α-helix	trans	-49.3	-35.5	-175.1	-75.1	-177.8	174.7	174.8	-2.9	114.4	L3 S7 L8 E9	L3-R5 PolarHBondContact O-N 3.01Å; R5-S7 PolarHBondContact O-N 3.18Å; R5-L8 PolarHBondContact O-N 3.19Å; R5-E9 PolarHBondContact O-N 3.03Å; R5-E9 VanDerWaalsContact O-N 3.12Å
6	K	61	Low	72.9	Confident	167 Å²	167	127.5 Å²	127.5	73%	0.726	62%	0.624	S	S	*	*	H	α-helix	trans	-61.6	-34.9	175.8	-83.5	-176.5	173.1	-179.2	0	114.1	P4 L8 V10	P4-K6 PolarHBondContact O-N 3.22Å; K6-L8 VanDerWaalsContact C-N 3.33Å; K6-V10 WeakPolarHBondContact O-CG2 3.49Å; K6-V10 PolarHBondContact O-N 3.37Å
7	S	65.1	Low	74.3	Confident	53 Å²	53	127.3 Å²	127.3	37%	0.371	62%	0.619	S	S	.	*	H	α-helix	trans	-74.1	-28.1	178.2	65.7	0	0	0	0	112	P4 R5 A11	P4-S7 PolarHBondContact O-N 3.12Å; P4-S7 PolarHBondContact O-OG 3.23Å; R5-S7 PolarHBondContact O-N 3.18Å; S7-A11 WeakPolarHBondContact O-CB 3.49Å; S7-A11 PolarHBondContact O-N 2.94Å
8	L	72.6	Confident	75.5	Confident	114 Å²	114	125.8 Å²	125.8	60%	0.597	61%	0.613	S	S	*	*	H	α-helix	trans	-72.6	-42.5	175.4	-171.8	66.7	0	0	0	111.4	R5 K6 V10 A11 T12	R5-L8 PolarHBondContact O-N 3.19Å; K6-L8 VanDerWaalsContact C-N 3.33Å; L8-V10 VanDerWaalsContact C-N 3.34Å; L8-V10 PolarHBondContact O-N 3.29Å; L8-A11 PolarHBondContact O-N 3.14Å; L8-T12 WeakPolarHBondContact O-CB 3.49Å; L8-T12 PolarHBondContact O-N 3.35Å; L8-T12 PolarHBondContact O-OG1 3.29Å
9	E	72.3	Confident	76.6	Confident	133 Å²	133	123.8 Å²	123.8	62%	0.621	61%	0.605	S	S	*	*	H	α-helix	trans	-61.5	-39.8	176.4	-73.4	172.3	174.3	0	0	112.6	R5 S13	R5-E9 PolarHBondContact O-N 3.03Å; R5-E9 VanDerWaalsContact O-N 3.12Å; E9-S13 WeakPolarHBondContact O-CB 3.33Å; E9-S13 PolarHBondContact O-N 2.9Å
10	V	74.9	Confident	77.6	Confident	81 Å²	81	122.6 Å²	122.6	49%	0.491	60%	0.598	S	S	.	*	H	α-helix	trans	-66	-48	176	173.9	0	0	0	0	111	K6 L8 T12 S13 E14	K6-V10 WeakPolarHBondContact O-CG2 3.49Å; K6-V10 PolarHBondContact O-N 3.37Å; L8-V10 VanDerWaalsContact C-N 3.34Å; L8-V10 PolarHBondContact O-N 3.29Å; V10-T12 VanDerWaalsContact C-N 3.34Å; V10-T12 PolarHBondContact O-N 3.49Å; V10-S13 PolarHBondContact O-N 3.47Å; V10-S13 VanDerWaalsContact O-N 3.16Å; V10-E14 WeakPolarHBondContact O-CG 3.21Å; V10-E14 PolarHBondContact O-N 3.27Å
11	A	77.8	Confident	78.6	Confident	41 Å²	41	121.2 Å²	121.2	34%	0.339	59%	0.594	S	S	.	*	H	α-helix	trans	-58.6	-44.7	176.9	0	0	0	0	0	111.8	S7 L8 S13 E14 D15	S7-A11 WeakPolarHBondContact O-CB 3.49Å; S7-A11 PolarHBondContact O-N 2.94Å; L8-A11 PolarHBondContact O-N 3.14Å; A11-S13 PolarHBondContact O-N 2.94Å; A11-E14 PolarHBondContact O-N 3.24Å; A11-D15 PolarHBondContact O-N 3.42Å
12	T	84.3	Confident	80.8	Confident	61 Å²	61	114.5 Å²	114.5	37%	0.374	56%	0.561	S	S	.	*	H	α-helix	trans	-63.7	-39.7	176.1	-58.1	0	0	0	0	112.2	L8 V10 E14 D15 Y16	L8-T12 WeakPolarHBondContact O-CB 3.49Å; L8-T12 PolarHBondContact O-N 3.35Å; L8-T12 PolarHBondContact O-OG1 3.29Å; V10-T12 VanDerWaalsContact C-N 3.34Å; V10-T12 PolarHBondContact O-N 3.49Å; T12-E14 VanDerWaalsContact C-N 3.33Å; T12-E14 PolarHBondContact O-N 3.27Å; T12-D15 PolarHBondContact O-N 2.95Å; T12-Y16 HydrophobicContact CG2-CD2 3.86Å; T12-Y16 HydrophobicContact CG2-CE2 3.61Å; T12-Y16 WeakPolarHBondContact O-CD2 3.49Å; T12-Y16 PolarHBondContact O-N 3.15Å; T12-Y16 VanDerWaalsContact O-N 3.12Å
13	S	90.9	Very high	83	Confident	56 Å²	56	107.3 Å²	107.3	39%	0.392	54%	0.541	S	S	.	.	H	α-helix	trans	-65.8	-34.7	176.5	-179.9	0	0	0	0	112.9	E9 V10 A11 K17	E9-S13 WeakPolarHBondContact O-CB 3.33Å; E9-S13 PolarHBondContact O-N 2.9Å; V10-S13 PolarHBondContact O-N 3.47Å; V10-S13 VanDerWaalsContact O-N 3.16Å; A11-S13 PolarHBondContact O-N 2.94Å; S13-K17 WeakPolarHBondContact O-CG 3.42Å; S13-K17 PolarHBondContact O-N 3.22Å
14	E	93.8	Very high	85	Confident	118 Å²	118	106 Å²	106	55%	0.551	53%	0.529	S	S	*	.	H	α-helix	trans	-69.1	-42.2	176.8	-72.6	172.7	176	0	0	111.3	V10 A11 T12 Y16 K17 L18	V10-E14 WeakPolarHBondContact O-CG 3.21Å; V10-E14 PolarHBondContact O-N 3.27Å; A11-E14 PolarHBondContact O-N 3.24Å; T12-E14 VanDerWaalsContact C-N 3.33Å; T12-E14 PolarHBondContact O-N 3.27Å; E14-Y16 VanDerWaalsContact C-N 3.34Å; E14-Y16 PolarHBondContact O-N 2.93Å; E14-K17 PolarHBondContact O-N 3.43Å; E14-L18 PolarHBondContact O-N 3.03Å
15	D	92.4	Very high	86.6	Confident	109 Å²	109	106.9 Å²	106.9	58%	0.583	53%	0.528	S	S	*	.	H	α-helix	trans	-60.2	-41.9	174.7	-71	-25.2	0	0	0	112	A11 T12 L18 L19	A11-D15 PolarHBondContact O-N 3.42Å; T12-D15 PolarHBondContact O-N 2.95Å; D15-L18 PolarHBondContact O-N 2.95Å; D15-L19 WeakPolarHBondContact O-CB 3.33Å; D15-L19 PolarHBondContact O-N 3.27Å
16	Y	95	Very high	88.2	Confident	163 Å²	163	99.8 Å²	99.8	64%	0.639	51%	0.509	S	S	*	.	H	α-helix	trans	-64.3	-41	175.7	-85	-67.2	0	0	0	112.8	T12 E14 L18 L19 E20	T12-Y16 HydrophobicContact CG2-CD2 3.86Å; T12-Y16 HydrophobicContact CG2-CE2 3.61Å; T12-Y16 WeakPolarHBondContact O-CD2 3.49Å; T12-Y16 PolarHBondContact O-N 3.15Å; T12-Y16 VanDerWaalsContact O-N 3.12Å; E14-Y16 VanDerWaalsContact C-N 3.34Å; E14-Y16 PolarHBondContact O-N 2.93Å; Y16-L18 VanDerWaalsContact C-N 3.33Å; Y16-L19 PolarHBondContact O-N 3.39Å; Y16-E20 WeakPolarHBondContact O-CB 3.34Å; Y16-E20 PolarHBondContact O-N 3.1Å
17	K	95.3	Very high	90	Very high	124 Å²	124	95.2 Å²	95.2	54%	0.539	50%	0.498	S	S	.	.	H	α-helix	trans	-63.4	-40.7	175.5	-74.6	173	-178.3	174.4	0	111.4	S13 E14 E20 N21	S13-K17 WeakPolarHBondContact O-CG 3.42Å; S13-K17 PolarHBondContact O-N 3.22Å; E14-K17 PolarHBondContact O-N 3.43Å; K17-E20 PolarHBondContact O-N 3.38Å; K17-N21 WeakPolarHBondContact O-CB 3.49Å; K17-N21 VanDerWaalsContact O-CG 3.28Å; K17-N21 PolarHBondContact O-N 3.01Å; K17-N21 PolarHBondContact O-ND2 2.92Å
18	L	96.1	Very high	91.5	Very high	100 Å²	100	97 Å²	97	52%	0.524	50%	0.503	S	S	.	.	H	α-helix	trans	-61.8	-47.8	175	178.2	61.4	0	0	0	110.7	E14 D15 Y16 E20 N21 M22	E14-L18 PolarHBondContact O-N 3.03Å; D15-L18 PolarHBondContact O-N 2.95Å; Y16-L18 VanDerWaalsContact C-N 3.33Å; L18-E20 VanDerWaalsContact C-N 3.33Å; L18-E20 PolarHBondContact O-N 3.01Å; L18-N21 PolarHBondContact O-N 3.46Å; L18-N21 VanDerWaalsContact O-N 3.17Å; L18-M22 HydrophobicContact CD1-CG 4.3Å; L18-M22 HydrophobicContact CG-CG 4.48Å; L18-M22 HydrophobicContact CG-SD 4.31Å; L18-M22 WeakPolarHBondContact O-CG 3.4Å; L18-M22 PolarHBondContact O-N 3.26Å
19	L	96.4	Very high	92.8	Very high	88 Å²	88	96.6 Å²	96.6	46%	0.461	50%	0.497	S	S	.	.	H	α-helix	trans	-61.6	-41.1	179.1	-170.2	67.6	0	0	0	112	D15 Y16 N21 M22 N23	D15-L19 WeakPolarHBondContact O-CB 3.33Å; D15-L19 PolarHBondContact O-N 3.27Å; Y16-L19 PolarHBondContact O-N 3.39Å; L19-N21 VanDerWaalsContact C-N 3.35Å; L19-N21 PolarHBondContact O-N 3.48Å; L19-M22 PolarHBondContact O-N 2.91Å; L19-N23 WeakPolarHBondContact O-CB 3.47Å; L19-N23 VanDerWaalsContact O-CG 3.28Å; L19-N23 PolarHBondContact O-N 3.46Å; L19-N23 PolarHBondContact O-ND2 3.05Å
20	E	97.1	Very high	94	Very high	99 Å²	99	97.9 Å²	97.9	46%	0.463	50%	0.497	S	S	.	.	H	α-helix	trans	-60	-45.2	174.4	-169.5	-169.2	171.3	0	0	111.4	Y16 K17 L18 N23 K24	Y16-E20 WeakPolarHBondContact O-CB 3.34Å; Y16-E20 PolarHBondContact O-N 3.1Å; K17-E20 PolarHBondContact O-N 3.38Å; L18-E20 VanDerWaalsContact C-N 3.33Å; L18-E20 PolarHBondContact O-N 3.01Å; E20-N23 PolarHBondContact O-N 3.33Å; E20-K24 VanDerWaalsContact CD-NZ 3.35Å; E20-K24 HydrophobicContact CG-CD 4.5Å; E20-K24 WeakPolarHBondContact O-CG 3.48Å; E20-K24 PolarHBondContact O-N 3.49Å; E20-K24 WeakPolarHBondContact OE1-CE 3.4Å; E20-K24 IonicContact OE1-NZ 2.68Å; E20-K24 PolarHBondContact OE1-NZ 3.44Å
21	N	97.6	Very high	95.1	Very high	94 Å²	94	98.5 Å²	98.5	50%	0.503	50%	0.497	S	S	.	.	H	α-helix	trans	-65.5	-41.1	177.6	-72.3	-22.2	0	0	0	112.1	K17 L18 L19 K24 L25	K17-N21 WeakPolarHBondContact O-CB 3.49Å; K17-N21 VanDerWaalsContact O-CG 3.28Å; K17-N21 PolarHBondContact O-N 3.01Å; K17-N21 PolarHBondContact O-ND2 2.92Å; L18-N21 PolarHBondContact O-N 3.46Å; L18-N21 VanDerWaalsContact O-N 3.17Å; L19-N21 VanDerWaalsContact C-N 3.35Å; L19-N21 PolarHBondContact O-N 3.48Å; N21-K24 PolarHBondContact O-N 2.91Å; N21-L25 WeakPolarHBondContact O-CB 3.49Å; N21-L25 PolarHBondContact O-N 2.95Å
22	M	97.6	Very high	96.1	Very high	106 Å²	106	100.4 Å²	100.4	52%	0.522	50%	0.499	S	S	.	.	H	α-helix	trans	-61.4	-45.8	174.7	-71.6	-173.3	77.2	0	0	110.8	L18 L19 K24 L25 T26	L18-M22 HydrophobicContact CD1-CG 4.3Å; L18-M22 HydrophobicContact CG-CG 4.48Å; L18-M22 HydrophobicContact CG-SD 4.31Å; L18-M22 WeakPolarHBondContact O-CG 3.4Å; L18-M22 PolarHBondContact O-N 3.26Å; L19-M22 PolarHBondContact O-N 2.91Å; M22-K24 PolarHBondContact O-N 3.46Å; M22-L25 PolarHBondContact O-N 2.65Å; M22-T26 WeakPolarHBondContact O-CB 3.42Å; M22-T26 PolarHBondContact O-N 3.07Å; M22-T26 PolarHBondContact O-OG1 3.42Å; M22-T26 VanDerWaalsContact O-OG1 3.05Å
23	N	98.1	Very high	96.7	Very high	98 Å²	98	103.1 Å²	103.1	52%	0.524	51%	0.509	S	S	.	.	H	α-helix	trans	-61.6	-41.8	177.6	-75	-18.9	0	0	0	112.3	L19 E20 T26 S27	L19-N23 WeakPolarHBondContact O-CB 3.47Å; L19-N23 VanDerWaalsContact O-CG 3.28Å; L19-N23 PolarHBondContact O-N 3.46Å; L19-N23 PolarHBondContact O-ND2 3.05Å; E20-N23 PolarHBondContact O-N 3.33Å; N23-T26 PolarHBondContact O-N 3.29Å; N23-S27 WeakPolarHBondContact O-CB 3.41Å; N23-S27 PolarHBondContact O-N 2.94Å
24	K	98	Very high	97.1	Very high	119 Å²	119	106.5 Å²	106.5	52%	0.517	52%	0.516	S	S	.	.	H	α-helix	trans	-60.2	-47.2	174.3	-74.3	171.3	-176.4	166.3	0	111.4	E20 N21 M22 S27 L28	E20-K24 VanDerWaalsContact CD-NZ 3.35Å; E20-K24 HydrophobicContact CG-CD 4.5Å; E20-K24 WeakPolarHBondContact O-CG 3.48Å; E20-K24 PolarHBondContact O-N 3.49Å; E20-K24 WeakPolarHBondContact OE1-CE 3.4Å; E20-K24 IonicContact OE1-NZ 2.68Å; E20-K24 PolarHBondContact OE1-NZ 3.44Å; N21-K24 PolarHBondContact O-N 2.91Å; M22-K24 PolarHBondContact O-N 3.46Å; K24-S27 PolarHBondContact O-N 3.15Å; K24-L28 PolarHBondContact O-N 3.31Å
25	L	98.1	Very high	97.3	Very high	103 Å²	103	105.9 Å²	105.9	54%	0.539	52%	0.517	S	S	.	.	H	α-helix	trans	-63.5	-43.5	178.4	-179.1	62.7	0	0	0	111.9	N21 M22 L28 K29	N21-L25 WeakPolarHBondContact O-CB 3.49Å; N21-L25 PolarHBondContact O-N 2.95Å; M22-L25 PolarHBondContact O-N 2.65Å; L25-L28 WeakPolarHBondContact O-CB 3.31Å; L25-L28 PolarHBondContact O-N 3.46Å; L25-K29 WeakPolarHBondContact O-CG 3.49Å; L25-K29 PolarHBondContact O-N 3.19Å
26	T	98.1	Very high	97.6	Very high	69 Å²	69	105.6 Å²	105.6	42%	0.423	51%	0.514	S	S	.	.	H	α-helix	trans	-62.9	-42.6	176.7	-64.1	0	0	0	0	111.2	M22 N23 L28 K29 Y30	M22-T26 WeakPolarHBondContact O-CB 3.42Å; M22-T26 PolarHBondContact O-N 3.07Å; M22-T26 PolarHBondContact O-OG1 3.42Å; M22-T26 VanDerWaalsContact O-OG1 3.05Å; N23-T26 PolarHBondContact O-N 3.29Å; T26-L28 VanDerWaalsContact C-N 3.33Å; T26-L28 PolarHBondContact O-N 2.89Å; T26-K29 PolarHBondContact O-N 3.21Å; T26-Y30 HydrophobicContact CG2-CD2 3.79Å; T26-Y30 HydrophobicContact CG2-CE2 3.6Å; T26-Y30 VanDerWaalsContact O-CD2 3.27Å; T26-Y30 WeakPolarHBondContact O-CD2 3.32Å; T26-Y30 PolarHBondContact O-N 3.46Å
27	S	97.9	Very high	97.7	Very high	70 Å²	70	100.5 Å²	100.5	49%	0.49	51%	0.506	S	S	.	.	H	α-helix	trans	-59.8	-44.1	175.3	-175.9	0	0	0	0	111.7	N23 K24 K29 Y30 L31	N23-S27 WeakPolarHBondContact O-CB 3.41Å; N23-S27 PolarHBondContact O-N 2.94Å; K24-S27 PolarHBondContact O-N 3.15Å; S27-K29 VanDerWaalsContact C-N 3.33Å; S27-K29 PolarHBondContact O-N 2.88Å; S27-Y30 PolarHBondContact O-N 3.34Å; S27-L31 WeakPolarHBondContact O-CG 3.43Å; S27-L31 PolarHBondContact O-N 3.36Å; S27-L31 VanDerWaalsContact O-N 3.08Å
28	L	98.3	Very high	97.9	Very high	90 Å²	90	97.3 Å²	97.3	47%	0.471	49%	0.494	S	S	.	.	H	α-helix	trans	-60.1	-43.3	174.8	-175.7	66.4	0	0	0	111.6	K24 L25 T26 Y30 L31 E32	K24-L28 PolarHBondContact O-N 3.31Å; L25-L28 WeakPolarHBondContact O-CB 3.31Å; L25-L28 PolarHBondContact O-N 3.46Å; T26-L28 VanDerWaalsContact C-N 3.33Å; T26-L28 PolarHBondContact O-N 2.89Å; L28-Y30 VanDerWaalsContact C-N 3.33Å; L28-Y30 PolarHBondContact O-N 3.01Å; L28-L31 WeakPolarHBondContact O-CB 3.49Å; L28-L31 PolarHBondContact O-N 3.12Å; L28-L31 VanDerWaalsContact O-N 3.14Å; L28-E32 PolarHBondContact O-N 3.33Å
29	K	98.3	Very high	98	Very high	107 Å²	107	96.5 Å²	96.5	47%	0.465	49%	0.49	S	S	.	.	H	α-helix	trans	-61.7	-39	176.5	-75	-73.8	161.3	-151.7	0	112.8	L25 T26 S27 L31 E32 M33	L25-K29 WeakPolarHBondContact O-CG 3.49Å; L25-K29 PolarHBondContact O-N 3.19Å; T26-K29 PolarHBondContact O-N 3.21Å; S27-K29 VanDerWaalsContact C-N 3.33Å; S27-K29 PolarHBondContact O-N 2.88Å; K29-L31 VanDerWaalsContact C-N 3.33Å; K29-L31 PolarHBondContact O-N 3.48Å; K29-E32 WeakPolarHBondContact CD-OE2 3.47Å; K29-E32 WeakPolarHBondContact CE-OE2 3.21Å; K29-E32 IonicContact NZ-OE1 3.91Å; K29-E32 IonicContact NZ-OE2 2.7Å; K29-E32 PolarHBondContact NZ-OE2 3.1Å; K29-E32 PolarHBondContact O-N 3.07Å; K29-M33 WeakPolarHBondContact O-CB 3.26Å; K29-M33 VanDerWaalsContact O-CG 3.31Å; K29-M33 WeakPolarHBondContact O-CG 3.38Å; K29-M33 PolarHBondContact O-N 3.46Å
30	Y	98.4	Very high	98.1	Very high	159 Å²	159	96.7 Å²	96.7	62%	0.624	49%	0.491	S	S	*	.	H	α-helix	trans	-65.3	-35.5	174.4	-85.7	-69.3	0	0	0	112.8	T26 S27 L28 K34	T26-Y30 HydrophobicContact CG2-CD2 3.79Å; T26-Y30 HydrophobicContact CG2-CE2 3.6Å; T26-Y30 VanDerWaalsContact O-CD2 3.27Å; T26-Y30 WeakPolarHBondContact O-CD2 3.32Å; T26-Y30 PolarHBondContact O-N 3.46Å; S27-Y30 PolarHBondContact O-N 3.34Å; L28-Y30 VanDerWaalsContact C-N 3.33Å; L28-Y30 PolarHBondContact O-N 3.01Å; Y30-K34 WeakPolarHBondContact O-CB 3.45Å; Y30-K34 PolarHBondContact O-N 3.39Å
31	L	98.1	Very high	98.1	Very high	95 Å²	95	95.7 Å²	95.7	50%	0.497	50%	0.495	S	S	.	.	H	α-helix	trans	-65.8	-46.8	174.5	-68.3	172.7	0	0	0	111.3	S27 L28 K29 M33 K34 D35	S27-L31 WeakPolarHBondContact O-CG 3.43Å; S27-L31 PolarHBondContact O-N 3.36Å; S27-L31 VanDerWaalsContact O-N 3.08Å; L28-L31 WeakPolarHBondContact O-CB 3.49Å; L28-L31 PolarHBondContact O-N 3.12Å; L28-L31 VanDerWaalsContact O-N 3.14Å; K29-L31 VanDerWaalsContact C-N 3.33Å; K29-L31 PolarHBondContact O-N 3.48Å; L31-M33 VanDerWaalsContact C-N 3.34Å; L31-M33 PolarHBondContact O-N 2.98Å; L31-K34 WeakPolarHBondContact O-CB 3.41Å; L31-K34 PolarHBondContact O-N 2.88Å; L31-D35 PolarHBondContact O-N 2.67Å
32	E	97.9	Very high	98.2	Very high	81 Å²	81	98.4 Å²	98.4	38%	0.379	50%	0.498	S	S	.	.	H	α-helix	trans	-58.3	-45.6	174.8	-68.9	175.9	170.1	0	0	111.6	L28 K29 K34 D35 I36	L28-E32 PolarHBondContact O-N 3.33Å; K29-E32 WeakPolarHBondContact CD-OE2 3.47Å; K29-E32 WeakPolarHBondContact CE-OE2 3.21Å; K29-E32 IonicContact NZ-OE1 3.91Å; K29-E32 IonicContact NZ-OE2 2.7Å; K29-E32 PolarHBondContact NZ-OE2 3.1Å; K29-E32 PolarHBondContact O-N 3.07Å; E32-K34 VanDerWaalsContact C-N 3.32Å; E32-K34 PolarHBondContact O-N 3.32Å; E32-D35 PolarHBondContact O-N 3.32Å; E32-I36 WeakPolarHBondContact O-CG1 3.27Å; E32-I36 PolarHBondContact O-N 3.1Å
33	M	98.3	Very high	98.2	Very high	117 Å²	117	97.7 Å²	97.7	58%	0.576	50%	0.496	S	S	*	.	H	α-helix	trans	-62.2	-39.3	177.4	-75.7	175.5	69.1	0	0	112.2	K29 L31 I36 A37	K29-M33 WeakPolarHBondContact O-CB 3.26Å; K29-M33 VanDerWaalsContact O-CG 3.31Å; K29-M33 WeakPolarHBondContact O-CG 3.38Å; K29-M33 PolarHBondContact O-N 3.46Å; L31-M33 VanDerWaalsContact C-N 3.34Å; L31-M33 PolarHBondContact O-N 2.98Å; M33-I36 PolarHBondContact O-N 2.98Å; M33-A37 WeakPolarHBondContact O-CB 3.32Å; M33-A37 PolarHBondContact O-N 3.35Å
34	K	98.1	Very high	98.2	Very high	127 Å²	127	98.1 Å²	98.1	55%	0.552	50%	0.498	S	S	*	.	H	α-helix	trans	-61.6	-44.7	175.7	179.7	-173.4	173.2	-173.9	0	110.9	Y30 L31 E32 I36 A37 I38	Y30-K34 WeakPolarHBondContact O-CB 3.45Å; Y30-K34 PolarHBondContact O-N 3.39Å; L31-K34 WeakPolarHBondContact O-CB 3.41Å; L31-K34 PolarHBondContact O-N 2.88Å; E32-K34 VanDerWaalsContact C-N 3.32Å; E32-K34 PolarHBondContact O-N 3.32Å; K34-I36 VanDerWaalsContact C-N 3.34Å; K34-I36 PolarHBondContact O-N 3.34Å; K34-A37 PolarHBondContact O-N 3.29Å; K34-I38 HydrophobicContact CG-CD1 4Å; K34-I38 VanDerWaalsContact O-CG1 3.29Å; K34-I38 WeakPolarHBondContact O-CG1 3.32Å; K34-I38 PolarHBondContact O-N 3.44Å
35	D	98.2	Very high	98.2	Very high	105 Å²	105	98.9 Å²	98.9	56%	0.561	50%	0.501	S	S	*	.	H	α-helix	trans	-64.6	-40.5	179.4	-71	-20.6	0	0	0	111.7	L31 E32 I38 N39	L31-D35 PolarHBondContact O-N 2.67Å; E32-D35 PolarHBondContact O-N 3.32Å; D35-I38 PolarHBondContact O-N 3.1Å; D35-N39 PolarHBondContact O-N 2.9Å
36	I	98.1	Very high	98.2	Very high	103 Å²	103	97.7 Å²	97.7	53%	0.528	50%	0.495	S	S	.	.	H	α-helix	trans	-60	-48	172.6	-66.9	165.2	0	0	0	110.7	E32 M33 K34 I38 N39 I40	E32-I36 WeakPolarHBondContact O-CG1 3.27Å; E32-I36 PolarHBondContact O-N 3.1Å; M33-I36 PolarHBondContact O-N 2.98Å; K34-I36 VanDerWaalsContact C-N 3.34Å; K34-I36 PolarHBondContact O-N 3.34Å; I36-I38 VanDerWaalsContact C-N 3.33Å; I36-I38 PolarHBondContact O-N 3.47Å; I36-N39 WeakPolarHBondContact O-CB 3.36Å; I36-N39 PolarHBondContact O-N 2.9Å; I36-N39 VanDerWaalsContact O-N 3.12Å; I36-I40 HydrophobicContact CG2-CD1 3.87Å; I36-I40 HydrophobicContact CG2-CG1 4.44Å; I36-I40 WeakPolarHBondContact O-CG1 3.48Å; I36-I40 PolarHBondContact O-N 3.1Å
37	A	98.4	Very high	98.2	Very high	56 Å²	56	98.3 Å²	98.3	46%	0.463	50%	0.496	S	S	.	.	H	α-helix	trans	-61.5	-40.8	179.9	0	0	0	0	0	112.1	M33 K34 N39 I40 S41	M33-A37 WeakPolarHBondContact O-CB 3.32Å; M33-A37 PolarHBondContact O-N 3.35Å; K34-A37 PolarHBondContact O-N 3.29Å; A37-N39 VanDerWaalsContact C-N 3.32Å; A37-N39 PolarHBondContact O-N 3.09Å; A37-I40 PolarHBondContact O-N 3.23Å; A37-S41 WeakPolarHBondContact O-CB 3.41Å; A37-S41 PolarHBondContact O-N 3.17Å
38	I	98.4	Very high	98.2	Very high	58 Å²	58	100.5 Å²	100.5	30%	0.297	50%	0.502	S	S	.	.	H	α-helix	trans	-60.4	-44.6	174	-70.9	166.9	0	0	0	110.3	K34 D35 I36 S41 R42	K34-I38 HydrophobicContact CG-CD1 4Å; K34-I38 VanDerWaalsContact O-CG1 3.29Å; K34-I38 WeakPolarHBondContact O-CG1 3.32Å; K34-I38 PolarHBondContact O-N 3.44Å; D35-I38 PolarHBondContact O-N 3.1Å; I36-I38 VanDerWaalsContact C-N 3.33Å; I36-I38 PolarHBondContact O-N 3.47Å; I38-S41 PolarHBondContact O-N 3.04Å; I38-R42 VanDerWaalsContact CG2-CZ 3.43Å; I38-R42 WeakPolarHBondContact O-CG 3.48Å; I38-R42 PolarHBondContact O-N 2.95Å
39	N	98.1	Very high	98.2	Very high	82 Å²	82	101.7 Å²	101.7	44%	0.439	51%	0.505	S	S	.	.	H	α-helix	trans	-63.9	-43.4	179.4	-165.1	39.7	0	0	0	112.2	D35 I36 A37 S41 R42 N43	D35-N39 PolarHBondContact O-N 2.9Å; I36-N39 WeakPolarHBondContact O-CB 3.36Å; I36-N39 PolarHBondContact O-N 2.9Å; I36-N39 VanDerWaalsContact O-N 3.12Å; A37-N39 VanDerWaalsContact C-N 3.32Å; A37-N39 PolarHBondContact O-N 3.09Å; N39-S41 VanDerWaalsContact C-N 3.32Å; N39-S41 PolarHBondContact O-N 3.19Å; N39-R42 PolarHBondContact O-N 3.29Å; N39-N43 PolarHBondContact O-N 2.96Å
40	I	98.4	Very high	98.1	Very high	92 Å²	92	104 Å²	104	47%	0.472	52%	0.515	S	S	.	.	H	α-helix	trans	-58.9	-45.8	174.3	-68.1	168.7	0	0	0	110.4	I36 A37 R42 N43 L44	I36-I40 HydrophobicContact CG2-CD1 3.87Å; I36-I40 HydrophobicContact CG2-CG1 4.44Å; I36-I40 WeakPolarHBondContact O-CG1 3.48Å; I36-I40 PolarHBondContact O-N 3.1Å; A37-I40 PolarHBondContact O-N 3.23Å; I40-R42 VanDerWaalsContact C-N 3.34Å; I40-R42 PolarHBondContact O-N 3.05Å; I40-N43 PolarHBondContact O-N 2.88Å; I40-L44 HydrophobicContact CG2-CD1 3.95Å; I40-L44 HydrophobicContact CG2-CG 4.37Å; I40-L44 WeakPolarHBondContact O-CB 3.42Å; I40-L44 WeakPolarHBondContact O-CG 3.33Å; I40-L44 PolarHBondContact O-N 2.92Å
41	S	98.3	Very high	98	Very high	78 Å²	78	103.4 Å²	103.4	55%	0.545	51%	0.513	S	S	.	.	H	α-helix	trans	-60.5	-42	178.9	-178.4	0	0	0	0	112.3	A37 I38 N39 L44 K45	A37-S41 WeakPolarHBondContact O-CB 3.41Å; A37-S41 PolarHBondContact O-N 3.17Å; I38-S41 PolarHBondContact O-N 3.04Å; N39-S41 VanDerWaalsContact C-N 3.32Å; N39-S41 PolarHBondContact O-N 3.19Å; S41-L44 PolarHBondContact O-N 3.19Å; S41-K45 PolarHBondContact O-N 3.36Å
42	R	98.4	Very high	98	Very high	152 Å²	152	102.1 Å²	102.1	57%	0.574	52%	0.516	S	S	*	.	H	α-helix	trans	-61.7	-50.2	173.9	-70.6	179.4	-167.4	141.7	0.5	111.4	I38 N39 I40 L44 K45 D46	I38-R42 VanDerWaalsContact CG2-CZ 3.43Å; I38-R42 WeakPolarHBondContact O-CG 3.48Å; I38-R42 PolarHBondContact O-N 2.95Å; N39-R42 PolarHBondContact O-N 3.29Å; I40-R42 VanDerWaalsContact C-N 3.34Å; I40-R42 PolarHBondContact O-N 3.05Å; R42-L44 VanDerWaalsContact C-N 3.28Å; R42-L44 PolarHBondContact O-N 3.4Å; R42-K45 WeakPolarHBondContact O-CB 3.41Å; R42-K45 PolarHBondContact O-N 3.32Å; R42-D46 PolarHBondContact O-N 3.33Å
43	N	98.1	Very high	97.9	Very high	91 Å²	91	100.1 Å²	100.1	49%	0.487	52%	0.517	S	S	.	.	H	α-helix	trans	-59.1	-40	179.6	-70.7	-14.4	0	0	0	112.3	N39 I40 D46 L47	N39-N43 PolarHBondContact O-N 2.96Å; I40-N43 PolarHBondContact O-N 2.88Å; N43-D46 PolarHBondContact O-N 3.19Å; N43-L47 VanDerWaalsContact O-CB 3.3Å; N43-L47 WeakPolarHBondContact O-CB 3.36Å; N43-L47 PolarHBondContact O-N 2.93Å
44	L	98.3	Very high	97.9	Very high	107 Å²	107	99 Å²	99	56%	0.56	51%	0.513	S	S	*	.	H	α-helix	trans	-64.4	-41.6	175.3	-76.8	172.8	0	0	0	112	I40 S41 R42 L47 N48	I40-L44 HydrophobicContact CG2-CD1 3.95Å; I40-L44 HydrophobicContact CG2-CG 4.37Å; I40-L44 WeakPolarHBondContact O-CB 3.42Å; I40-L44 WeakPolarHBondContact O-CG 3.33Å; I40-L44 PolarHBondContact O-N 2.92Å; S41-L44 PolarHBondContact O-N 3.19Å; R42-L44 VanDerWaalsContact C-N 3.28Å; R42-L44 PolarHBondContact O-N 3.4Å; L44-L47 PolarHBondContact O-N 3.38Å; L44-N48 WeakPolarHBondContact O-CB 3.48Å; L44-N48 PolarHBondContact O-N 2.97Å
45	K	98.2	Very high	97.8	Very high	134 Å²	134	97.7 Å²	97.7	58%	0.583	51%	0.509	S	S	*	.	H	α-helix	trans	-62.4	-47.2	176.5	-174.9	-179.7	177.8	-177.3	0	111.2	S41 R42 L47 N48 Q49	S41-K45 PolarHBondContact O-N 3.36Å; R42-K45 WeakPolarHBondContact O-CB 3.41Å; R42-K45 PolarHBondContact O-N 3.32Å; K45-L47 VanDerWaalsContact C-N 3.32Å; K45-L47 PolarHBondContact O-N 3Å; K45-N48 PolarHBondContact O-N 3.21Å; K45-Q49 WeakPolarHBondContact O-CG 3.4Å; K45-Q49 PolarHBondContact O-N 3.02Å
46	D	98	Very high	97.7	Very high	78 Å²	78	95.9 Å²	95.9	42%	0.417	50%	0.502	S	S	.	.	H	α-helix	trans	-63.5	-40.2	179.6	-67.1	-5.1	0	0	0	111.2	R42 N43 Q49 K50	R42-D46 PolarHBondContact O-N 3.33Å; N43-D46 PolarHBondContact O-N 3.19Å; D46-Q49 PolarHBondContact O-N 2.99Å; D46-K50 WeakPolarHBondContact O-CG 3.46Å; D46-K50 PolarHBondContact O-N 3.46Å
47	L	98.1	Very high	97.7	Very high	83 Å²	83	97.9 Å²	97.9	44%	0.435	50%	0.504	S	S	.	.	H	α-helix	trans	-62.6	-46.1	175.4	-176.5	61.4	0	0	0	111.3	N43 L44 K45 Q49 K50 Y51	N43-L47 VanDerWaalsContact O-CB 3.3Å; N43-L47 WeakPolarHBondContact O-CB 3.36Å; N43-L47 PolarHBondContact O-N 2.93Å; L44-L47 PolarHBondContact O-N 3.38Å; K45-L47 VanDerWaalsContact C-N 3.32Å; K45-L47 PolarHBondContact O-N 3Å; L47-Q49 VanDerWaalsContact C-N 3.28Å; L47-Q49 PolarHBondContact O-N 3.16Å; L47-K50 WeakPolarHBondContact O-CB 3.24Å; L47-K50 PolarHBondContact O-N 3.03Å; L47-K50 VanDerWaalsContact O-N 3.16Å; L47-Y51 HydrophobicContact CD1-CD2 4.06Å; L47-Y51 HydrophobicContact CD1-CE2 3.62Å; L47-Y51 HydrophobicContact CD2-CE2 4.12Å; L47-Y51 HydrophobicContact CG-CD2 3.88Å; L47-Y51 HydrophobicContact CG-CE2 3.62Å; L47-Y51 VanDerWaalsContact O-CD2 3.24Å; L47-Y51 WeakPolarHBondContact O-CD2 3.42Å; L47-Y51 PolarHBondContact O-N 2.94Å
48	N	97.8	Very high	97.7	Very high	116 Å²	116	99.5 Å²	99.5	62%	0.62	51%	0.505	S	S	*	.	H	α-helix	trans	-62.4	-37.1	178.2	-163.8	35.4	0	0	0	111.9	L44 K45 Y51 A52	L44-N48 WeakPolarHBondContact O-CB 3.48Å; L44-N48 PolarHBondContact O-N 2.97Å; K45-N48 PolarHBondContact O-N 3.21Å; N48-Y51 PolarHBondContact O-N 3.47Å; N48-A52 PolarHBondContact O-N 3.44Å
49	Q	97.9	Very high	97.7	Very high	115 Å²	115	100.3 Å²	100.3	54%	0.537	51%	0.51	S	S	.	.	H	α-helix	trans	-64.4	-41.4	173.7	-73.9	179.6	-20.8	0	0	112.4	K45 D46 L47 Y51 A52 G53	K45-Q49 WeakPolarHBondContact O-CG 3.4Å; K45-Q49 PolarHBondContact O-N 3.02Å; D46-Q49 PolarHBondContact O-N 2.99Å; L47-Q49 VanDerWaalsContact C-N 3.28Å; L47-Q49 PolarHBondContact O-N 3.16Å; Q49-Y51 VanDerWaalsContact C-N 3.34Å; Q49-A52 PolarHBondContact O-N 3.35Å; Q49-G53 PolarHBondContact O-N 3.26Å
50	K	97.2	Very high	97.7	Very high	154 Å²	154	101.5 Å²	101.5	67%	0.67	51%	0.513	S	S	*	.	H	α-helix	trans	-61.8	-42.6	174.6	-71.4	175.2	-176.9	178.6	0	111.5	D46 L47 G53 L54	D46-K50 WeakPolarHBondContact O-CG 3.46Å; D46-K50 PolarHBondContact O-N 3.46Å; L47-K50 WeakPolarHBondContact O-CB 3.24Å; L47-K50 PolarHBondContact O-N 3.03Å; L47-K50 VanDerWaalsContact O-N 3.16Å; K50-G53 PolarHBondContact O-N 3.29Å; K50-L54 PolarHBondContact O-N 2.97Å
51	Y	96.4	Very high	97.7	Very high	148 Å²	148	101.2 Å²	101.2	58%	0.58	51%	0.511	S	S	*	.	H	α-helix	trans	-61.6	-45.6	174.4	-82.9	-68.6	0	0	0	112.3	L47 N48 Q49 G53 L54	L47-Y51 HydrophobicContact CD1-CD2 4.06Å; L47-Y51 HydrophobicContact CD1-CE2 3.62Å; L47-Y51 HydrophobicContact CD2-CE2 4.12Å; L47-Y51 HydrophobicContact CG-CD2 3.88Å; L47-Y51 HydrophobicContact CG-CE2 3.62Å; L47-Y51 VanDerWaalsContact O-CD2 3.24Å; L47-Y51 WeakPolarHBondContact O-CD2 3.42Å; L47-Y51 PolarHBondContact O-N 2.94Å; N48-Y51 PolarHBondContact O-N 3.47Å; Q49-Y51 VanDerWaalsContact C-N 3.34Å; Y51-G53 PolarHBondContact O-N 3.44Å; Y51-L54 HydrophobicContact CD1-CD1 4.21Å; Y51-L54 WeakPolarHBondContact O-CB 3.49Å; Y51-L54 PolarHBondContact O-N 3.26Å
52	A	96.9	Very high	97.7	Very high	67 Å²	67	101.4 Å²	101.4	55%	0.554	51%	0.506	S	S	*	.	H	α-helix	trans	-60.5	-36.2	174.8	0	0	0	0	0	111.8	N48 Q49 L54 Q55	N48-A52 PolarHBondContact O-N 3.44Å; Q49-A52 PolarHBondContact O-N 3.35Å; A52-L54 PolarHBondContact O-N 2.94Å; A52-Q55 WeakPolarHBondContact O-CB 3.3Å; A52-Q55 PolarHBondContact O-N 3.3Å
53	G	97.1	Very high	97.7	Very high	39 Å²	39	97.6 Å²	97.6	40%	0.402	50%	0.499	S	S	.	.	H	α-helix	trans	-67.3	-13.8	174.1	0	0	0	0	0	114.8	Q49 K50 Y51 P56 Y57	Q49-G53 PolarHBondContact O-N 3.26Å; K50-G53 PolarHBondContact O-N 3.29Å; Y51-G53 PolarHBondContact O-N 3.44Å; G53-P56 WeakPolarHBondContact O-CD 3.29Å; G53-Y57 WeakPolarHBondContact O-CD2 3.46Å
54	L	97.2	Very high	97.7	Very high	94 Å²	94	97.8 Å²	97.8	49%	0.492	50%	0.499	S	S	.	.	H	α-helix	trans	-80.4	-25.4	172.3	-68.3	172	0	0	0	112.7	K50 Y51 A52 P56 Y57 L58	K50-L54 PolarHBondContact O-N 2.97Å; Y51-L54 HydrophobicContact CD1-CD1 4.21Å; Y51-L54 WeakPolarHBondContact O-CB 3.49Å; Y51-L54 PolarHBondContact O-N 3.26Å; A52-L54 PolarHBondContact O-N 2.94Å; L54-P56 VanDerWaalsContact C-CD 3.47Å; L54-Y57 PolarHBondContact O-N 3.06Å; L54-L58 PolarHBondContact O-N 3.42Å
55	Q	95.3	Very high	97.7	Very high	100 Å²	100	98.5 Å²	98.5	47%	0.467	50%	0.5	S	S	.	.	H	α-helix	trans	-53.9	-45.6	-176.6	-170.3	62	49.3	0	0	113.3	A52 Y57 L58 D59	A52-Q55 WeakPolarHBondContact O-CB 3.3Å; A52-Q55 PolarHBondContact O-N 3.3Å; Q55-Y57 PolarHBondContact O-N 2.99Å; Q55-L58 PolarHBondContact O-N 3.47Å; Q55-L58 VanDerWaalsContact O-N 3.1Å; Q55-D59 PolarHBondContact NE2-OD1 2.99Å; Q55-D59 VanDerWaalsContact O-CG 3.25Å; Q55-D59 PolarHBondContact O-N 2.9Å
56	P	98	Very high	97.7	Very high	66 Å²	66	99 Å²	99	43%	0.429	50%	0.504	S	S	.	.	H	α-helix	trans	-62.7	-26.8	179.9	-22.4	34.6	0	0	0	114	G53 L54 Q60	G53-P56 WeakPolarHBondContact O-CD 3.29Å; L54-P56 VanDerWaalsContact C-CD 3.47Å; P56-Q60 VanDerWaalsContact O-CG 3.26Å; P56-Q60 WeakPolarHBondContact O-CG 3.46Å; P56-Q60 PolarHBondContact O-N 3.48Å; P56-Q60 VanDerWaalsContact O-N 3.1Å; P56-Q60 PolarHBondContact O-NE2 3.24Å; P56-Q60 VanDerWaalsContact O-NE2 3.07Å
57	Y	98.2	Very high	97.7	Very high	145 Å²	145	100.7 Å²	100.7	57%	0.569	51%	0.51	S	S	*	.	H	α-helix	trans	-77.2	-37.6	176.5	-62.7	-71.7	0	0	0	111.4	G53 L54 Q55 D59 Q60 I61	G53-Y57 WeakPolarHBondContact O-CD2 3.46Å; L54-Y57 PolarHBondContact O-N 3.06Å; Q55-Y57 PolarHBondContact O-N 2.99Å; Y57-D59 VanDerWaalsContact C-N 3.32Å; Y57-Q60 PolarHBondContact O-N 3.12Å; Y57-I61 WeakPolarHBondContact O-CG1 3.4Å; Y57-I61 PolarHBondContact O-N 2.92Å
58	L	97.8	Very high	97.7	Very high	90 Å²	90	100 Å²	100	47%	0.471	51%	0.509	S	S	.	.	H	α-helix	trans	-63.1	-41.7	172.5	-64.1	175.6	0	0	0	110.9	L54 Q55 Q60 I61 N62	L54-L58 PolarHBondContact O-N 3.42Å; Q55-L58 PolarHBondContact O-N 3.47Å; Q55-L58 VanDerWaalsContact O-N 3.1Å; L58-Q60 VanDerWaalsContact C-N 3.33Å; L58-Q60 PolarHBondContact O-N 2.92Å; L58-I61 HydrophobicContact CD2-CD1 4.5Å; L58-I61 WeakPolarHBondContact O-CB 3.37Å; L58-I61 PolarHBondContact O-N 3.24Å; L58-N62 PolarHBondContact O-N 3.28Å; L58-N62 PolarHBondContact O-ND2 2.95Å
59	D	97.6	Very high	97.8	Very high	76 Å²	76	96.4 Å²	96.4	41%	0.406	50%	0.496	S	S	.	.	H	α-helix	trans	-63.8	-40	176.3	-60	-23.5	0	0	0	111.3	Q55 Y57 N62 V63	Q55-D59 PolarHBondContact NE2-OD1 2.99Å; Q55-D59 VanDerWaalsContact O-CG 3.25Å; Q55-D59 PolarHBondContact O-N 2.9Å; Y57-D59 VanDerWaalsContact C-N 3.32Å; D59-N62 PolarHBondContact O-N 3.39Å; D59-V63 WeakPolarHBondContact O-CG2 3.5Å; D59-V63 PolarHBondContact O-N 3.19Å; D59-V63 VanDerWaalsContact O-N 3.1Å
60	Q	98.4	Very high	97.8	Very high	107 Å²	107	93.7 Å²	93.7	50%	0.5	49%	0.492	S	S	.	.	H	α-helix	trans	-62.9	-39.6	173.3	-78.5	169.4	62.8	0	0	112.7	P56 Y57 L58 V63 I64	P56-Q60 VanDerWaalsContact O-CG 3.26Å; P56-Q60 WeakPolarHBondContact O-CG 3.46Å; P56-Q60 PolarHBondContact O-N 3.48Å; P56-Q60 VanDerWaalsContact O-N 3.1Å; P56-Q60 PolarHBondContact O-NE2 3.24Å; P56-Q60 VanDerWaalsContact O-NE2 3.07Å; Y57-Q60 PolarHBondContact O-N 3.12Å; L58-Q60 VanDerWaalsContact C-N 3.33Å; L58-Q60 PolarHBondContact O-N 2.92Å; Q60-V63 PolarHBondContact O-N 3.42Å; Q60-I64 VanDerWaalsContact O-CG1 3.32Å; Q60-I64 WeakPolarHBondContact O-CG1 3.4Å; Q60-I64 PolarHBondContact O-N 3.41Å
61	I	98.4	Very high	97.8	Very high	85 Å²	85	92.1 Å²	92.1	44%	0.436	49%	0.491	S	S	.	.	H	α-helix	trans	-60.3	-47.2	175.7	-71.9	164.3	0	0	0	110	Y57 L58 V63 I64 E65	Y57-I61 WeakPolarHBondContact O-CG1 3.4Å; Y57-I61 PolarHBondContact O-N 2.92Å; L58-I61 HydrophobicContact CD2-CD1 4.5Å; L58-I61 WeakPolarHBondContact O-CB 3.37Å; L58-I61 PolarHBondContact O-N 3.24Å; I61-V63 VanDerWaalsContact C-N 3.31Å; I61-V63 PolarHBondContact O-N 3.02Å; I61-I64 PolarHBondContact O-N 3.49Å; I61-I64 VanDerWaalsContact O-N 3.1Å; I61-E65 HydrophobicContact CG2-CG 4.45Å; I61-E65 WeakPolarHBondContact O-CG 3.42Å; I61-E65 PolarHBondContact O-N 3.39Å
62	N	98.2	Very high	97.9	Very high	83 Å²	83	91.3 Å²	91.3	44%	0.444	49%	0.492	S	S	.	.	H	α-helix	trans	-58.2	-43.2	177.8	-64.4	-26.7	0	0	0	111.9	L58 D59 I64 E65 E66	L58-N62 PolarHBondContact O-N 3.28Å; L58-N62 PolarHBondContact O-ND2 2.95Å; D59-N62 PolarHBondContact O-N 3.39Å; N62-I64 VanDerWaalsContact C-N 3.34Å; N62-I64 PolarHBondContact O-N 3.01Å; N62-E65 PolarHBondContact O-N 3.14Å; N62-E66 PolarHBondContact O-N 2.93Å; N62-E66 VanDerWaalsContact O-N 3.09Å
63	V	98.3	Very high	98	Very high	71 Å²	71	93.7 Å²	93.7	43%	0.43	49%	0.492	S	S	.	.	H	α-helix	trans	-63	-41.1	176.7	172.2	0	0	0	0	111.6	D59 Q60 I61 E66 Q67	D59-V63 WeakPolarHBondContact O-CG2 3.5Å; D59-V63 PolarHBondContact O-N 3.19Å; D59-V63 VanDerWaalsContact O-N 3.1Å; Q60-V63 PolarHBondContact O-N 3.42Å; I61-V63 VanDerWaalsContact C-N 3.31Å; I61-V63 PolarHBondContact O-N 3.02Å; V63-E66 PolarHBondContact O-N 3.41Å; V63-Q67 VanDerWaalsContact O-CG 3.31Å; V63-Q67 WeakPolarHBondContact O-CG 3.46Å; V63-Q67 PolarHBondContact O-N 3.41Å
64	I	98.4	Very high	98	Very high	95 Å²	95	94 Å²	94	49%	0.487	49%	0.491	S	S	.	.	H	α-helix	trans	-64.4	-42.1	177	-70.3	166.3	0	0	0	110.5	Q60 I61 N62 E66 Q67 V68	Q60-I64 VanDerWaalsContact O-CG1 3.32Å; Q60-I64 WeakPolarHBondContact O-CG1 3.4Å; Q60-I64 PolarHBondContact O-N 3.41Å; I61-I64 PolarHBondContact O-N 3.49Å; I61-I64 VanDerWaalsContact O-N 3.1Å; N62-I64 VanDerWaalsContact C-N 3.34Å; N62-I64 PolarHBondContact O-N 3.01Å; I64-E66 VanDerWaalsContact C-N 3.34Å; I64-E66 PolarHBondContact O-N 3.5Å; I64-Q67 PolarHBondContact O-N 3.01Å; I64-V68 HydrophobicContact CG2-CG2 4.24Å; I64-V68 VanDerWaalsContact O-CG2 3.32Å; I64-V68 WeakPolarHBondContact O-CG2 3.41Å; I64-V68 PolarHBondContact O-N 3.45Å
65	E	98.5	Very high	98.1	Very high	123 Å²	123	92.2 Å²	92.2	58%	0.575	49%	0.49	S	S	*	.	H	α-helix	trans	-58.6	-45	176.8	-73	-178.1	169.9	0	0	111.8	I61 N62 Q67 V68 A69	I61-E65 HydrophobicContact CG2-CG 4.45Å; I61-E65 WeakPolarHBondContact O-CG 3.42Å; I61-E65 PolarHBondContact O-N 3.39Å; N62-E65 PolarHBondContact O-N 3.14Å; E65-Q67 PolarHBondContact O-N 3.42Å; E65-V68 PolarHBondContact O-N 3.03Å; E65-A69 PolarHBondContact O-N 3.22Å
66	E	98.2	Very high	98.2	Very high	144 Å²	144	95.8 Å²	95.8	67%	0.673	50%	0.5	S	S	*	.	H	α-helix	trans	-61.8	-42.3	175.8	-71.3	-179.2	178.6	0	0	112.3	N62 V63 I64 A69 A70	N62-E66 PolarHBondContact O-N 2.93Å; N62-E66 VanDerWaalsContact O-N 3.09Å; V63-E66 PolarHBondContact O-N 3.41Å; I64-E66 VanDerWaalsContact C-N 3.34Å; I64-E66 PolarHBondContact O-N 3.5Å; E66-A69 PolarHBondContact O-N 3.08Å; E66-A70 PolarHBondContact O-N 2.95Å
67	Q	98.4	Very high	98.2	Very high	114 Å²	114	98.5 Å²	98.5	53%	0.533	51%	0.505	S	S	.	.	H	α-helix	trans	-65.3	-41.1	177.8	-71.8	175.2	11.8	0	0	112.1	V63 I64 E65 A70 L71	V63-Q67 VanDerWaalsContact O-CG 3.31Å; V63-Q67 WeakPolarHBondContact O-CG 3.46Å; V63-Q67 PolarHBondContact O-N 3.41Å; I64-Q67 PolarHBondContact O-N 3.01Å; E65-Q67 PolarHBondContact O-N 3.42Å; Q67-A70 PolarHBondContact O-N 2.93Å; Q67-L71 WeakPolarHBondContact O-CB 3.48Å; Q67-L71 WeakPolarHBondContact O-CG 3.46Å; Q67-L71 PolarHBondContact O-N 3.42Å
68	V	98.5	Very high	98.1	Very high	67 Å²	67	97.2 Å²	97.2	41%	0.406	51%	0.508	S	S	.	.	H	α-helix	trans	-62.3	-45.6	175.8	170.1	0	0	0	0	110.3	I64 E65 A70 L71 E72	I64-V68 HydrophobicContact CG2-CG2 4.24Å; I64-V68 VanDerWaalsContact O-CG2 3.32Å; I64-V68 WeakPolarHBondContact O-CG2 3.41Å; I64-V68 PolarHBondContact O-N 3.45Å; E65-V68 PolarHBondContact O-N 3.03Å; V68-A70 VanDerWaalsContact C-N 3.31Å; V68-A70 PolarHBondContact O-N 2.88Å; V68-L71 WeakPolarHBondContact O-CB 3.37Å; V68-L71 PolarHBondContact O-N 3.42Å; V68-L71 VanDerWaalsContact O-N 3.15Å; V68-E72 HydrophobicContact CG1-CG 4.49Å; V68-E72 WeakPolarHBondContact O-CG 3.46Å; V68-E72 PolarHBondContact O-N 3.29Å
69	A	98.3	Very high	98.1	Very high	42 Å²	42	96.3 Å²	96.3	35%	0.347	50%	0.503	S	S	.	.	H	α-helix	trans	-60.4	-39.8	176.6	0	0	0	0	0	112.4	E65 E66 E72 Q73	E65-A69 PolarHBondContact O-N 3.22Å; E66-A69 PolarHBondContact O-N 3.08Å; A69-E72 PolarHBondContact O-N 3.44Å; A69-Q73 WeakPolarHBondContact O-CG 3.34Å; A69-Q73 PolarHBondContact O-N 3.35Å; A69-Q73 VanDerWaalsContact O-N 3.12Å
70	A	98.3	Very high	98.1	Very high	57 Å²	57	94.3 Å²	94.3	47%	0.471	50%	0.497	S	S	.	.	H	α-helix	trans	-65.3	-41.5	175.4	0	0	0	0	0	112.2	E66 Q67 V68 Q73 A74	E66-A70 PolarHBondContact O-N 2.95Å; Q67-A70 PolarHBondContact O-N 2.93Å; V68-A70 VanDerWaalsContact C-N 3.31Å; V68-A70 PolarHBondContact O-N 2.88Å; A70-Q73 PolarHBondContact O-N 2.97Å; A70-A74 PolarHBondContact O-N 3.19Å
71	L	98.5	Very high	98.1	Very high	121 Å²	121	97.2 Å²	97.2	63%	0.634	51%	0.505	S	S	*	.	H	α-helix	trans	-63.3	-42.9	175.9	-78.1	166.5	0	0	0	111.8	Q67 V68 Q73 A74 A75	Q67-L71 WeakPolarHBondContact O-CB 3.48Å; Q67-L71 WeakPolarHBondContact O-CG 3.46Å; Q67-L71 PolarHBondContact O-N 3.42Å; V68-L71 WeakPolarHBondContact O-CB 3.37Å; V68-L71 PolarHBondContact O-N 3.42Å; V68-L71 VanDerWaalsContact O-N 3.15Å; L71-Q73 VanDerWaalsContact C-N 3.34Å; L71-Q73 PolarHBondContact O-N 2.97Å; L71-A74 PolarHBondContact O-N 2.7Å; L71-A75 WeakPolarHBondContact O-CB 3.27Å; L71-A75 PolarHBondContact O-N 2.68Å
72	E	98.2	Very high	98	Very high	131 Å²	131	96.7 Å²	96.7	61%	0.612	51%	0.508	S	S	*	.	H	α-helix	trans	-59.6	-44.5	175.5	-74.8	-178.6	174.5	0	0	111.7	V68 A69 A74 A75 Y76	V68-E72 HydrophobicContact CG1-CG 4.49Å; V68-E72 WeakPolarHBondContact O-CG 3.46Å; V68-E72 PolarHBondContact O-N 3.29Å; A69-E72 PolarHBondContact O-N 3.44Å; E72-A74 VanDerWaalsContact C-N 3.33Å; E72-A74 PolarHBondContact O-N 3.36Å; E72-A75 PolarHBondContact O-N 2.85Å; E72-Y76 WeakPolarHBondContact O-CB 3.49Å; E72-Y76 PolarHBondContact O-N 3.35Å
73	Q	98.1	Very high	97.9	Very high	118 Å²	118	98.4 Å²	98.4	55%	0.551	51%	0.512	S	S	*	.	H	α-helix	trans	-63.3	-39.1	175.7	-71.5	-178.9	32.4	0	0	112.5	A69 A70 L71 Y76 K77	A69-Q73 WeakPolarHBondContact O-CG 3.34Å; A69-Q73 PolarHBondContact O-N 3.35Å; A69-Q73 VanDerWaalsContact O-N 3.12Å; A70-Q73 PolarHBondContact O-N 2.97Å; L71-Q73 VanDerWaalsContact C-N 3.34Å; L71-Q73 PolarHBondContact O-N 2.97Å; Q73-Y76 PolarHBondContact O-N 2.97Å; Q73-K77 WeakPolarHBondContact O-CG 3.5Å; Q73-K77 PolarHBondContact O-N 3.42Å
74	A	97.9	Very high	97.8	Very high	45 Å²	45	101.7 Å²	101.7	37%	0.372	52%	0.52	S	S	.	.	H	α-helix	trans	-64.9	-44.3	176.7	0	0	0	0	0	111.3	A70 L71 E72 Y76 K77 L78	A70-A74 PolarHBondContact O-N 3.19Å; L71-A74 PolarHBondContact O-N 2.7Å; E72-A74 VanDerWaalsContact C-N 3.33Å; E72-A74 PolarHBondContact O-N 3.36Å; A74-Y76 PolarHBondContact O-N 3.02Å; A74-K77 PolarHBondContact O-N 3.49Å; A74-L78 WeakPolarHBondContact O-CB 3.4Å; A74-L78 WeakPolarHBondContact O-CG 3.21Å; A74-L78 PolarHBondContact O-N 2.82Å
75	A	98.3	Very high	97.7	Very high	57 Å²	57	102 Å²	102	47%	0.471	52%	0.523	S	S	.	.	H	α-helix	trans	-60.7	-44.1	175.6	0	0	0	0	0	111.6	L71 E72 K77 L78 D79	L71-A75 WeakPolarHBondContact O-CB 3.27Å; L71-A75 PolarHBondContact O-N 2.68Å; E72-A75 PolarHBondContact O-N 2.85Å; A75-K77 PolarHBondContact O-N 3.36Å; A75-L78 PolarHBondContact O-N 2.96Å; A75-D79 PolarHBondContact O-N 3.22Å
76	Y	98	Very high	97.6	Very high	175 Å²	175	101 Å²	101	69%	0.686	52%	0.518	S	S	*	.	H	α-helix	trans	-60.3	-44.5	176	-172.7	-93.4	0	0	0	112.3	E72 Q73 A74 D79 A80	E72-Y76 WeakPolarHBondContact O-CB 3.49Å; E72-Y76 PolarHBondContact O-N 3.35Å; Q73-Y76 PolarHBondContact O-N 2.97Å; A74-Y76 PolarHBondContact O-N 3.02Å; Y76-D79 PolarHBondContact O-N 3.45Å; Y76-A80 WeakPolarHBondContact O-CB 3.31Å; Y76-A80 PolarHBondContact O-N 3.17Å
77	K	97.5	Very high	97.5	Very high	123 Å²	123	96.5 Å²	96.5	54%	0.535	51%	0.505	S	S	.	.	H	α-helix	trans	-61.3	-47.1	175.5	-73.4	170.4	-175	171	0	111	Q73 A74 A75 D79 A80 Y81	Q73-K77 WeakPolarHBondContact O-CG 3.5Å; Q73-K77 PolarHBondContact O-N 3.42Å; A74-K77 PolarHBondContact O-N 3.49Å; A75-K77 PolarHBondContact O-N 3.36Å; K77-D79 PolarHBondContact O-N 3.47Å; K77-A80 PolarHBondContact O-N 3.42Å; K77-Y81 WeakPolarHBondContact O-CD2 3.4Å; K77-Y81 PolarHBondContact O-N 2.9Å
78	L	97.6	Very high	97.3	Very high	118 Å²	118	98 Å²	98	62%	0.618	51%	0.51	S	S	*	.	H	α-helix	trans	-59.4	-46	178.9	-77.4	169.3	0	0	0	112	A74 A75 A80 Y81 S82	A74-L78 WeakPolarHBondContact O-CB 3.4Å; A74-L78 WeakPolarHBondContact O-CG 3.21Å; A74-L78 PolarHBondContact O-N 2.82Å; A75-L78 PolarHBondContact O-N 2.96Å; L78-A80 PolarHBondContact O-N 3.22Å; L78-Y81 PolarHBondContact O-N 2.95Å; L78-S82 WeakPolarHBondContact O-CB 3.5Å; L78-S82 PolarHBondContact O-N 2.92Å; L78-S82 PolarHBondContact O-OG 2.95Å; L78-S82 VanDerWaalsContact O-OG 3.1Å
79	D	97.3	Very high	97.1	Very high	71 Å²	71	101.9 Å²	101.9	38%	0.38	52%	0.518	S	S	.	.	H	α-helix	trans	-58.7	-45.9	175.5	174.8	67.3	0	0	0	111.8	A75 Y76 K77 Y81 S82 K83	A75-D79 PolarHBondContact O-N 3.22Å; Y76-D79 PolarHBondContact O-N 3.45Å; K77-D79 PolarHBondContact O-N 3.47Å; D79-Y81 VanDerWaalsContact C-N 3.35Å; D79-Y81 PolarHBondContact O-N 3.33Å; D79-S82 PolarHBondContact O-N 3.16Å; D79-K83 WeakPolarHBondContact O-CG 3.45Å; D79-K83 PolarHBondContact O-N 2.88Å; D79-K83 WeakPolarHBondContact OD1-CE 3.36Å; D79-K83 IonicContact OD1-NZ 3.33Å; D79-K83 PolarHBondContact OD1-NZ 3.05Å; D79-K83 VanDerWaalsContact OD2-CE 3.27Å; D79-K83 WeakPolarHBondContact OD2-CE 3.46Å; D79-K83 IonicContact OD2-NZ 2.67Å; D79-K83 PolarHBondContact OD2-NZ 3.18Å
80	A	97.3	Very high	96.9	Very high	33 Å²	33	105 Å²	105	27%	0.273	52%	0.524	S	S	.	.	H	α-helix	trans	-62.2	-40.1	177.7	0	0	0	0	0	112.7	Y76 K77 L78 K84	Y76-A80 WeakPolarHBondContact O-CB 3.31Å; Y76-A80 PolarHBondContact O-N 3.17Å; K77-A80 PolarHBondContact O-N 3.42Å; L78-A80 PolarHBondContact O-N 3.22Å; A80-K84 WeakPolarHBondContact O-CG 3.42Å; A80-K84 PolarHBondContact O-N 3.32Å; A80-K84 VanDerWaalsContact O-N 3.15Å
81	Y	97.2	Very high	96.6	Very high	169 Å²	169	109.8 Å²	109.8	66%	0.663	53%	0.534	S	S	*	.	H	α-helix	trans	-65.5	-46.5	174.7	-88	-75.9	0	0	0	111.7	K77 L78 D79 K83 K84 L85	K77-Y81 WeakPolarHBondContact O-CD2 3.4Å; K77-Y81 PolarHBondContact O-N 2.9Å; L78-Y81 PolarHBondContact O-N 2.95Å; D79-Y81 VanDerWaalsContact C-N 3.35Å; D79-Y81 PolarHBondContact O-N 3.33Å; Y81-K83 PolarHBondContact O-N 3.32Å; Y81-K84 PolarHBondContact O-N 3.43Å; Y81-L85 WeakPolarHBondContact O-CB 3.48Å; Y81-L85 PolarHBondContact O-N 3.12Å
82	S	97.2	Very high	96.3	Very high	74 Å²	74	109.3 Å²	109.3	52%	0.517	53%	0.532	S	S	.	.	H	α-helix	trans	-58.3	-47.2	178.1	-66.7	0	0	0	0	111.9	L78 D79 K84 L85 E86	L78-S82 WeakPolarHBondContact O-CB 3.5Å; L78-S82 PolarHBondContact O-N 2.92Å; L78-S82 PolarHBondContact O-OG 2.95Å; L78-S82 VanDerWaalsContact O-OG 3.1Å; D79-S82 PolarHBondContact O-N 3.16Å; S82-K84 PolarHBondContact O-N 3.43Å; S82-L85 PolarHBondContact O-N 3.47Å; S82-E86 WeakPolarHBondContact O-CB 3.36Å; S82-E86 PolarHBondContact O-N 2.92Å
83	K	96.9	Very high	95.9	Very high	118 Å²	118	110.3 Å²	110.3	51%	0.513	54%	0.536	S	S	.	.	H	α-helix	trans	-60.3	-42.9	176.1	-74.4	171.5	176.4	163.7	0	112.7	D79 Y81 L85 A87	D79-K83 WeakPolarHBondContact O-CG 3.45Å; D79-K83 PolarHBondContact O-N 2.88Å; D79-K83 WeakPolarHBondContact OD1-CE 3.36Å; D79-K83 IonicContact OD1-NZ 3.33Å; D79-K83 PolarHBondContact OD1-NZ 3.05Å; D79-K83 VanDerWaalsContact OD2-CE 3.27Å; D79-K83 WeakPolarHBondContact OD2-CE 3.46Å; D79-K83 IonicContact OD2-NZ 2.67Å; D79-K83 PolarHBondContact OD2-NZ 3.18Å; Y81-K83 PolarHBondContact O-N 3.32Å; K83-L85 VanDerWaalsContact C-N 3.34Å; K83-A87 WeakPolarHBondContact O-CB 3.16Å; K83-A87 PolarHBondContact O-N 3.45Å
84	K	96.4	Very high	94.9	Very high	141 Å²	141	113.4 Å²	113.4	61%	0.613	55%	0.548	S	S	*	.	H	α-helix	trans	-63.2	-41.2	176.5	-78.5	174.1	-178.4	174.8	0	111.8	A80 Y81 S82 K88	A80-K84 WeakPolarHBondContact O-CG 3.42Å; A80-K84 PolarHBondContact O-N 3.32Å; A80-K84 VanDerWaalsContact O-N 3.15Å; Y81-K84 PolarHBondContact O-N 3.43Å; S82-K84 PolarHBondContact O-N 3.43Å; K84-K88 PolarHBondContact O-N 2.99Å
85	L	95.8	Very high	92.9	Very high	102 Å²	102	124.2 Å²	124.2	53%	0.534	58%	0.579	S	S	.	*	H	α-helix	trans	-65.7	-47.3	178.9	-178.9	61.1	0	0	0	111.2	Y81 S82 K83 A87 K88 Y89	Y81-L85 WeakPolarHBondContact O-CB 3.48Å; Y81-L85 PolarHBondContact O-N 3.12Å; S82-L85 PolarHBondContact O-N 3.47Å; K83-L85 VanDerWaalsContact C-N 3.34Å; L85-A87 VanDerWaalsContact C-N 3.32Å; L85-A87 PolarHBondContact O-N 3.41Å; L85-K88 WeakPolarHBondContact O-CB 3.46Å; L85-K88 PolarHBondContact O-N 3.05Å; L85-K88 VanDerWaalsContact O-N 3.12Å; L85-Y89 HydrophobicContact CD1-CD2 4.03Å; L85-Y89 HydrophobicContact CD1-CE2 4.08Å; L85-Y89 HydrophobicContact CG-CD2 4.26Å; L85-Y89 PolarHBondContact O-N 2.87Å
86	E	95.8	Very high	92.6	Very high	101 Å²	101	127.6 Å²	127.6	47%	0.472	59%	0.585	S	S	.	*	H	α-helix	trans	-57.7	-44.7	176.9	-169	-168	163.8	0	0	111.6	S82 K88 Y89 K90	S82-E86 WeakPolarHBondContact O-CB 3.36Å; S82-E86 PolarHBondContact O-N 2.92Å; E86-K88 VanDerWaalsContact C-N 3.31Å; E86-K88 PolarHBondContact O-N 3.27Å; E86-Y89 PolarHBondContact O-N 3.42Å; E86-K90 HydrophobicContact CG-CD 4.4Å; E86-K90 PolarHBondContact O-N 3.28Å; E86-K90 WeakPolarHBondContact OE1-CE 3.44Å; E86-K90 IonicContact OE1-NZ 2.65Å; E86-K90 PolarHBondContact OE1-NZ 3Å
87	A	95.3	Very high	92.3	Very high	49 Å²	49	125.1 Å²	125.1	41%	0.405	58%	0.579	S	S	.	*	H	α-helix	trans	-62.4	-35.6	177.5	0	0	0	0	0	113	K83 L85 K91	K83-A87 WeakPolarHBondContact O-CB 3.16Å; K83-A87 PolarHBondContact O-N 3.45Å; L85-A87 VanDerWaalsContact C-N 3.32Å; L85-A87 PolarHBondContact O-N 3.41Å; A87-K91 WeakPolarHBondContact O-CG 3.41Å; A87-K91 PolarHBondContact O-N 3.19Å
88	K	95.1	Very high	92	Very high	146 Å²	146	125.2 Å²	125.2	64%	0.635	58%	0.582	S	S	*	*	H	α-helix	trans	-68	-44.7	174.1	-75.8	-175.6	179.4	-175.7	0	111.4	K84 L85 E86 K91 L92	K84-K88 PolarHBondContact O-N 2.99Å; L85-K88 WeakPolarHBondContact O-CB 3.46Å; L85-K88 PolarHBondContact O-N 3.05Å; L85-K88 VanDerWaalsContact O-N 3.12Å; E86-K88 VanDerWaalsContact C-N 3.31Å; E86-K88 PolarHBondContact O-N 3.27Å; K88-K91 PolarHBondContact O-N 2.99Å; K88-L92 PolarHBondContact O-N 3.12Å
89	Y	94.4	Very high	91.7	Very high	149 Å²	149	125.6 Å²	125.6	58%	0.584	58%	0.58	S	S	*	*	H	α-helix	trans	-59.3	-49.7	177.6	-102.5	-85.3	0	0	0	111.9	L85 E86 K91 L92 E93	L85-Y89 HydrophobicContact CD1-CD2 4.03Å; L85-Y89 HydrophobicContact CD1-CE2 4.08Å; L85-Y89 HydrophobicContact CG-CD2 4.26Å; L85-Y89 PolarHBondContact O-N 2.87Å; E86-Y89 PolarHBondContact O-N 3.42Å; Y89-K91 PolarHBondContact O-N 3.36Å; Y89-K91 VanDerWaalsContact O-N 3.14Å; Y89-L92 WeakPolarHBondContact O-CB 3.47Å; Y89-L92 PolarHBondContact O-N 3.45Å; Y89-E93 PolarHBondContact O-N 2.84Å
90	K	94.4	Very high	91.3	Very high	107 Å²	107	129.1 Å²	129.1	47%	0.465	59%	0.592	S	S	.	*	H	α-helix	trans	-58.6	-28.5	177.2	-77.5	176.9	169.8	166.9	0	114	E86 K94	E86-K90 HydrophobicContact CG-CD 4.4Å; E86-K90 PolarHBondContact O-N 3.28Å; E86-K90 WeakPolarHBondContact OE1-CE 3.44Å; E86-K90 IonicContact OE1-NZ 2.65Å; E86-K90 PolarHBondContact OE1-NZ 3Å; K90-K94 WeakPolarHBondContact O-CG 3.34Å
91	K	92.3	Very high	90.9	Very high	157 Å²	157	135.5 Å²	135.5	68%	0.683	61%	0.613	S	S	*	*	H	α-helix	trans	-75.6	-33.4	174.5	-76	178.5	-179.2	-176	0	112.4	A87 K88 Y89	A87-K91 WeakPolarHBondContact O-CG 3.41Å; A87-K91 PolarHBondContact O-N 3.19Å; K88-K91 PolarHBondContact O-N 2.99Å; Y89-K91 PolarHBondContact O-N 3.36Å; Y89-K91 VanDerWaalsContact O-N 3.14Å
92	L	91.9	Very high	90.5	Very high	111 Å²	111	133.1 Å²	133.1	58%	0.581	61%	0.61	S	S	*	*	H	α-helix	trans	-74.2	-38.6	178.5	-70.9	168.1	0	0	0	111.8	K88 Y89 K94 R95	K88-L92 PolarHBondContact O-N 3.12Å; Y89-L92 WeakPolarHBondContact O-CB 3.47Å; Y89-L92 PolarHBondContact O-N 3.45Å; L92-K94 PolarHBondContact O-N 3.23Å; L92-R95 PolarHBondContact O-N 3.49Å
93	E	88.8	Confident	90	Very high	153 Å²	153	137.6 Å²	137.6	72%	0.715	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.2	-18.2	176.8	-71.8	-175.1	140.3	0	0	114.3	Y89	Y89-E93 PolarHBondContact O-N 2.84Å
94	K	76.9	Confident	89.4	Confident	182 Å²	182	139.3 Å²	139.3	79%	0.791	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91	0.6	179.1	-71	-178.9	-179.4	-170.7	0	113.6	K90 L92	K90-K94 WeakPolarHBondContact O-CG 3.34Å; L92-K94 PolarHBondContact O-N 3.23Å
95	R	55.5	Low	88.8	Confident	273 Å²	273	139.1 Å²	139.1	100%	1.03	63%	0.627	S	S	*	*			trans	-102.6	0	175.6	-82	-179.8	132.9	-176.9	-4	110	L92	L92-R95 PolarHBondContact O-N 3.49Å

Retrieved 95 of 95 residues in 62.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).