A0A087X1N9_HUMAN Loading...

ADAMTS like 5

AlphaFold DB , UniProt , Accession A0A087X1N9, Species HUMAN (Homo sapiens, Human), Gene ADAMTSL5, Length 130 aa.

						>A0A087X1N9_HUMAN|A0A087X1N9|ADAMTSL5
MGKLRPGRVEWLASGHTERPHLFQNLLLFLWALLNCGLGVSAQGPGEWTPWVSWTRCSSSCGRGVSVRSRRCLRLPGEEPCWGDSHEYRLCQLPDCPPGAVPFRDLQCALYNGRPVLGTQKTYQWVPFHG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	36	Very low	40.3	Very low	244 Å²	244	170.5 Å²	170.5	100%	1.202	86%	0.858	S	S	*	*				0	121.7	0	-63.5	81.9	177.4	0	0	108.3
2	G	38.7	Very low	40	Very low	80 Å²	80	170.7 Å²	170.7	83%	0.825	86%	0.862	S	S	*	*			trans	-84.6	163.3	-167.7	0	0	0	0	0	114.7
3	K	37.2	Very low	40.4	Very low	211 Å²	211	164.9 Å²	164.9	92%	0.917	86%	0.857	S	S	*	*			trans	-106.9	113	161.2	-77.8	-162.2	175.5	-178	0	108.8
4	L	37.7	Very low	40	Very low	176 Å²	176	160.7 Å²	160.7	92%	0.921	85%	0.848	S	S	*	*	P	Polyproline II helix	trans	-69.8	131.7	169.9	-69.3	160.5	0	0	0	108.6
5	R	43.6	Very low	40.3	Very low	236 Å²	236	155 Å²	155	89%	0.891	84%	0.843	S	S	*	*	P	Polyproline II helix	trans	-88	140.6	167	-60.2	-166.4	-152.6	-160.9	7.5	108.7	G7	R5-G7 PolarHBondContact O-N 3.5Å
6	P	42.9	Very low	40	Very low	131 Å²	131	156.3 Å²	156.3	85%	0.851	84%	0.841	S	S	*	*	P	Polyproline II helix	trans	-70.1	133.5	172.2	-2.7	17.9	0	0	0	109.8
7	G	41	Very low	39.9	Very low	66 Å²	66	155.3 Å²	155.3	68%	0.68	84%	0.842	S	S	*	*	P	Polyproline II helix	trans	-67.4	146	174.3	0	0	0	0	0	112.2	R5 V9	R5-G7 PolarHBondContact O-N 3.5Å; G7-V9 PolarHBondContact O-N 3.07Å
8	R	40.7	Very low	40.2	Very low	230 Å²	230	156.3 Å²	156.3	87%	0.868	84%	0.84	S	S	*	*	P	Polyproline II helix	trans	-63.6	119.6	171.8	-179.3	-174.7	-64.3	-173.7	-1.1	109
9	V	48.7	Very low	40.7	Very low	103 Å²	103	159.1 Å²	159.1	62%	0.624	84%	0.838	S	S	*	*			trans	-105.3	109.7	168.5	-175.8	0	0	0	0	107.4	G7 W11	G7-V9 PolarHBondContact O-N 3.07Å; V9-W11 HydrophobicContact CG1-CD2 4.34Å; V9-W11 HydrophobicContact CG1-CG 4.38Å; V9-W11 HydrophobicContact CG1-CZ2 4.1Å; V9-W11 VanDerWaalsContact CG1-NE1 3.25Å
10	E	39.1	Very low	41.1	Very low	170 Å²	170	157.4 Å²	157.4	79%	0.794	84%	0.836	S	S	*	*			trans	-76.2	123.3	166	-86.3	168.6	161.3	0	0	108.6
11	W	37.7	Very low	41.9	Very low	228 Å²	228	154.9 Å²	154.9	86%	0.864	82%	0.82	S	S	*	*			trans	-112.3	128.3	165	-72.6	111	0	0	0	109.4	V9	V9-W11 HydrophobicContact CG1-CD2 4.34Å; V9-W11 HydrophobicContact CG1-CG 4.38Å; V9-W11 HydrophobicContact CG1-CZ2 4.1Å; V9-W11 VanDerWaalsContact CG1-NE1 3.25Å
12	L	36.5	Very low	42.8	Very low	173 Å²	173	149.8 Å²	149.8	91%	0.906	80%	0.797	S	S	*	*			trans	-62.7	147.4	175.9	-75.4	156.3	0	0	0	111.7
13	A	45.2	Very low	43.5	Very low	96 Å²	96	154.2 Å²	154.2	79%	0.793	79%	0.794	S	S	*	*			trans	-56.7	147	175.5	0	0	0	0	0	113
14	S	35.2	Very low	44.5	Very low	106 Å²	106	150.4 Å²	150.4	74%	0.741	78%	0.779	S	S	*	*			trans	-144	116.5	154.2	-72.4	0	0	0	0	108
15	G	44.3	Very low	45.4	Very low	75 Å²	75	145.6 Å²	145.6	77%	0.773	75%	0.754	S	S	*	*			trans	-70.3	137.8	179.5	0	0	0	0	0	111.2
16	H	36.3	Very low	46.5	Very low	175 Å²	175	139.1 Å²	139.1	81%	0.81	74%	0.737	S	S	*	*			trans	-113	125.3	167.2	-80.5	-79.6	0	0	0	109.6
17	T	37.7	Very low	47.6	Very low	140 Å²	140	138.8 Å²	138.8	86%	0.859	73%	0.727	S	S	*	*			trans	-70.8	119.8	179.2	-44.2	0	0	0	0	110.5
18	E	45.4	Very low	48.8	Very low	173 Å²	173	139.7 Å²	139.7	81%	0.808	72%	0.716	S	S	*	*			trans	-65.2	131	176.7	-71.3	-82.5	141	0	0	112.6
19	R	49.6	Very low	49.9	Very low	210 Å²	210	135.2 Å²	135.2	79%	0.792	70%	0.703	S	S	*	*			trans	-129.7	148.6	162.3	-84.4	-172.5	-169.4	179.3	4.9	108.9	H21	R19-H21 PolarHBondContact O-CD2 3.29Å; R19-H21 PolarHBondContact O-N 3.38Å; R19-H21 VanDerWaalsContact O-N 3.16Å
20	P	48.6	Very low	50.8	Low	124 Å²	124	135 Å²	135	81%	0.805	70%	0.698	S	S	*	*			trans	-74.9	109.5	-150.2	28.2	-33.9	0	0	0	113.5	L22	P20-L22 PolarHBondContact O-N 2.04Å
21	H	57.7	Low	52	Low	105 Å²	105	134.7 Å²	134.7	49%	0.486	69%	0.689	S	S	.	*			trans	-89.7	34.2	-179.9	-78.4	-80.4	0	0	0	114.2	R19 F23 Q24 N25	R19-H21 PolarHBondContact O-CD2 3.29Å; R19-H21 PolarHBondContact O-N 3.38Å; R19-H21 VanDerWaalsContact O-N 3.16Å; H21-F23 PolarHBondContact O-N 2.78Å; H21-Q24 PolarHBondContact O-N 3.42Å; H21-N25 WeakPolarHBondContact O-CB 3.24Å; H21-N25 PolarHBondContact O-N 2.9Å; H21-N25 PolarHBondContact O-ND2 3.4Å
22	L	55.4	Low	53.2	Low	138 Å²	138	125.9 Å²	125.9	72%	0.723	67%	0.665	S	S	*	*	H	α-helix	trans	-61.4	-38.2	-171.7	-99.7	158	0	0	0	114	P20 L26	P20-L22 PolarHBondContact O-N 2.04Å; L22-L26 PolarHBondContact O-N 3.35Å
23	F	53.8	Low	54.5	Low	173 Å²	173	123.5 Å²	123.5	76%	0.759	65%	0.653	S	S	*	*	H	α-helix	trans	-81.1	-36.3	-178.2	-113.7	-94.6	0	0	0	114	H21 L26 L27	H21-F23 PolarHBondContact O-N 2.78Å; F23-L26 PolarHBondContact O-N 3.17Å; F23-L27 PolarHBondContact O-N 3.24Å
24	Q	58.2	Low	55.2	Low	131 Å²	131	125.5 Å²	125.5	61%	0.612	65%	0.649	S	S	*	*	H	α-helix	trans	-75.3	-33.9	178	-165.2	143.4	-18.6	0	0	111.5	H21 L28	H21-Q24 PolarHBondContact O-N 3.42Å; Q24-L28 HydrophobicContact CG-CD1 4.4Å; Q24-L28 WeakPolarHBondContact O-CB 3.44Å; Q24-L28 VanDerWaalsContact O-CG 3.28Å; Q24-L28 WeakPolarHBondContact O-CG 3.05Å; Q24-L28 PolarHBondContact O-N 3.1Å
25	N	56.9	Low	56.4	Low	74 Å²	74	124.9 Å²	124.9	40%	0.396	64%	0.638	S	S	.	*	H	α-helix	trans	-64.3	-40.6	170.6	-70.1	-11.5	0	0	0	110.8	H21 L27 L28 F29	H21-N25 WeakPolarHBondContact O-CB 3.24Å; H21-N25 PolarHBondContact O-N 2.9Å; H21-N25 PolarHBondContact O-ND2 3.4Å; N25-L27 PolarHBondContact O-N 3.23Å; N25-L28 PolarHBondContact O-N 3.09Å; N25-F29 HydrophobicContact CB-CD2 4.25Å; N25-F29 HydrophobicContact CB-CE2 4.41Å; N25-F29 VanDerWaalsContact O-CB 3.29Å; N25-F29 WeakPolarHBondContact O-CB 3.39Å; N25-F29 WeakPolarHBondContact O-CD2 3.08Å; N25-F29 PolarHBondContact O-N 3.11Å
26	L	64.9	Low	56.9	Low	101 Å²	101	126.3 Å²	126.3	53%	0.529	64%	0.635	S	S	.	*	H	α-helix	trans	-63.1	-40.4	179.4	-152.4	82.7	0	0	0	112.8	L22 F23 F29 L30	L22-L26 PolarHBondContact O-N 3.35Å; F23-L26 PolarHBondContact O-N 3.17Å; L26-F29 PolarHBondContact O-N 3.44Å; L26-L30 WeakPolarHBondContact O-CB 3.34Å; L26-L30 PolarHBondContact O-N 2.8Å
27	L	67.1	Low	58	Low	123 Å²	123	121.2 Å²	121.2	64%	0.644	63%	0.63	S	S	*	*	H	α-helix	trans	-68.7	-39.5	175.3	-104.9	139.9	0	0	0	112.5	F23 N25 L30 W31	F23-L27 PolarHBondContact O-N 3.24Å; N25-L27 PolarHBondContact O-N 3.23Å; L27-L30 PolarHBondContact O-N 2.97Å; L27-W31 VanDerWaalsContact O-CB 3.25Å; L27-W31 WeakPolarHBondContact O-CB 3.45Å; L27-W31 PolarHBondContact O-N 3.29Å
28	L	65.6	Low	58.9	Low	86 Å²	86	121.9 Å²	121.9	45%	0.45	63%	0.627	S	S	.	*	H	α-helix	trans	-68.9	-36.6	173.5	-71.4	170.2	0	0	0	112.1	Q24 N25 W31 A32	Q24-L28 HydrophobicContact CG-CD1 4.4Å; Q24-L28 WeakPolarHBondContact O-CB 3.44Å; Q24-L28 VanDerWaalsContact O-CG 3.28Å; Q24-L28 WeakPolarHBondContact O-CG 3.05Å; Q24-L28 PolarHBondContact O-N 3.1Å; N25-L28 PolarHBondContact O-N 3.09Å; L28-W31 HydrophobicContact CD2-CE3 3.92Å; L28-W31 HydrophobicContact CD2-CZ3 4.25Å; L28-W31 PolarHBondContact O-N 3.21Å; L28-A32 WeakPolarHBondContact O-CB 3.23Å; L28-A32 PolarHBondContact O-N 3.49Å
29	F	63.8	Low	59.5	Low	136 Å²	136	116.2 Å²	116.2	60%	0.596	62%	0.615	S	S	*	*	H	α-helix	trans	-67.3	-42.6	173.3	-89.7	-69.2	0	0	0	111.2	N25 L26 A32 L33	N25-F29 HydrophobicContact CB-CD2 4.25Å; N25-F29 HydrophobicContact CB-CE2 4.41Å; N25-F29 VanDerWaalsContact O-CB 3.29Å; N25-F29 WeakPolarHBondContact O-CB 3.39Å; N25-F29 WeakPolarHBondContact O-CD2 3.08Å; N25-F29 PolarHBondContact O-N 3.11Å; L26-F29 PolarHBondContact O-N 3.44Å; F29-A32 PolarHBondContact O-N 2.89Å; F29-L33 WeakPolarHBondContact O-CB 3.48Å; F29-L33 WeakPolarHBondContact O-CG 3.5Å; F29-L33 PolarHBondContact O-N 3.1Å
30	L	67.4	Low	60	Low	99 Å²	99	111.6 Å²	111.6	52%	0.518	61%	0.61	S	S	.	*	H	α-helix	trans	-65.5	-39.7	173.5	-88.2	156.1	0	0	0	112.2	L26 L27 L33 L34	L26-L30 WeakPolarHBondContact O-CB 3.34Å; L26-L30 PolarHBondContact O-N 2.8Å; L27-L30 PolarHBondContact O-N 2.97Å; L30-L33 PolarHBondContact O-N 3.32Å; L30-L34 WeakPolarHBondContact O-CB 3.37Å; L30-L34 PolarHBondContact O-N 3.18Å
31	W	65.5	Low	60.5	Low	162 Å²	162	110.2 Å²	110.2	61%	0.614	60%	0.603	S	S	*	*	H	α-helix	trans	-66.3	-38.5	173.7	179.2	56.9	0	0	0	112.5	L27 L28 L34 N35	L27-W31 VanDerWaalsContact O-CB 3.25Å; L27-W31 WeakPolarHBondContact O-CB 3.45Å; L27-W31 PolarHBondContact O-N 3.29Å; L28-W31 HydrophobicContact CD2-CE3 3.92Å; L28-W31 HydrophobicContact CD2-CZ3 4.25Å; L28-W31 PolarHBondContact O-N 3.21Å; W31-L34 PolarHBondContact O-N 3.36Å; W31-N35 PolarHBondContact NE1-ND2 3.1Å; W31-N35 WeakPolarHBondContact O-CB 3.36Å; W31-N35 PolarHBondContact O-N 3.29Å
32	A	63.1	Low	60.6	Low	43 Å²	43	108.8 Å²	108.8	36%	0.355	61%	0.61	S	S	.	*	H	α-helix	trans	-67.5	-41.1	173.2	0	0	0	0	0	111.6	L28 F29 N35 C36	L28-A32 WeakPolarHBondContact O-CB 3.23Å; L28-A32 PolarHBondContact O-N 3.49Å; F29-A32 PolarHBondContact O-N 2.89Å; A32-N35 CarbonylContact O-C 3.6Å; A32-N35 PolarHBondContact O-N 2.81Å; A32-C36 WeakPolarHBondContact O-CA 3.38Å; A32-C36 WeakPolarHBondContact O-CB 3.47Å; A32-C36 PolarHBondContact O-N 3.04Å; A32-C36 PolarHBondContact O-SG 3.23Å; A32-C36 VanDerWaalsContact O-SG 3.35Å
33	L	62.3	Low	61.1	Low	123 Å²	123	105.6 Å²	105.6	64%	0.644	59%	0.592	S	S	*	*	H	α-helix	trans	-66.3	-36.8	174.6	-70.3	168.5	0	0	0	111.8	F29 L30	F29-L33 WeakPolarHBondContact O-CB 3.48Å; F29-L33 WeakPolarHBondContact O-CG 3.5Å; F29-L33 PolarHBondContact O-N 3.1Å; L30-L33 PolarHBondContact O-N 3.32Å
34	L	61.4	Low	62.2	Low	138 Å²	138	99.4 Å²	99.4	72%	0.723	58%	0.576	S	S	*	*	H	α-helix	trans	-68.5	-38.4	173.6	-125.3	83.1	0	0	0	112.3	L30 W31	L30-L34 WeakPolarHBondContact O-CB 3.37Å; L30-L34 PolarHBondContact O-N 3.18Å; W31-L34 PolarHBondContact O-N 3.36Å
35	N	59.9	Low	63.5	Low	94 Å²	94	98 Å²	98	50%	0.503	58%	0.578	S	S	.	*	H	α-helix	trans	-81	-21.8	176.6	-95	-49.4	0	0	0	113.8	W31 A32 G37	W31-N35 PolarHBondContact NE1-ND2 3.1Å; W31-N35 WeakPolarHBondContact O-CB 3.36Å; W31-N35 PolarHBondContact O-N 3.29Å; A32-N35 CarbonylContact O-C 3.6Å; A32-N35 PolarHBondContact O-N 2.81Å; N35-G37 PolarHBondContact O-N 3.4Å
36	C	55.1	Low	65.2	Low	104 Å²	104	95 Å²	95	70%	0.703	57%	0.565	S	S	*	*	H	α-helix	trans	-73.6	-15.4	176.7	-91	0	0	0	0	113	A32	A32-C36 WeakPolarHBondContact O-CA 3.38Å; A32-C36 WeakPolarHBondContact O-CB 3.47Å; A32-C36 PolarHBondContact O-N 3.04Å; A32-C36 PolarHBondContact O-SG 3.23Å; A32-C36 VanDerWaalsContact O-SG 3.35Å
37	G	58.1	Low	66.6	Low	69 Å²	69	97.1 Å²	97.1	71%	0.711	57%	0.572	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.5	-8.6	178	0	0	0	0	0	115.5	N35	N35-G37 PolarHBondContact O-N 3.4Å
38	L	57.1	Low	68.1	Low	153 Å²	153	94 Å²	94	80%	0.801	55%	0.552	S	S	*	*	T	Hydrogen-bonded Turn	trans	-120.1	15.3	-179.1	-85	153.5	0	0	0	112.8	V40	L38-V40 PolarHBondContact O-N 2.94Å
39	G	57.3	Low	69.6	Low	54 Å²	54	91.5 Å²	91.5	56%	0.557	54%	0.54	S	S	*	.			trans	-73	94.9	164	0	0	0	0	0	108.6	S41	G39-S41 PolarHBondContact O-N 3.18Å
40	V	60.9	Low	71.3	Confident	114 Å²	114	90.5 Å²	90.5	69%	0.691	55%	0.547	S	S	*	.			trans	-49.2	101.6	153	173.4	0	0	0	0	104.6	L38 A42	L38-V40 PolarHBondContact O-N 2.94Å; V40-A42 PolarHBondContact O-N 2.86Å
41	S	59.6	Low	72.8	Confident	94 Å²	94	89.5 Å²	89.5	66%	0.657	54%	0.537	S	S	*	.			trans	-53.7	121.5	169.6	-79.9	0	0	0	0	104.7	G39 Q43	G39-S41 PolarHBondContact O-N 3.18Å; S41-Q43 PolarHBondContact O-N 3.04Å
42	A	59.8	Low	74.3	Confident	76 Å²	76	85.2 Å²	85.2	63%	0.628	53%	0.528	S	S	*	.			trans	-55.5	98.3	166.4	0	0	0	0	0	105	V40	V40-A42 PolarHBondContact O-N 2.86Å
43	Q	65.8	Low	76	Confident	71 Å²	71	88.1 Å²	88.1	33%	0.332	55%	0.546	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.6	142.8	175.6	-70	155.7	62.9	0	0	104.5	S41 P76 G77 E78	S41-Q43 PolarHBondContact O-N 3.04Å; Q43-P76 PolarHBondContact NE2-O 2.92Å; Q43-G77 PolarHBondContact N-O 2.97Å; Q43-E78 HydrophobicContact CB-CB 4.22Å; Q43-E78 HydrophobicContact CB-CG 3.2Å; Q43-E78 HydrophobicContact CG-CG 4.39Å; Q43-E78 WeakPolarHBondContact O-CA 3.37Å
44	G	76	Confident	77.7	Confident	42 Å²	42	85 Å²	85	43%	0.433	53%	0.525	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-53.8	178	-166	0	0	0	0	0	115.4	G46 E78 E79	G44-G46 PolarHBondContact O-N 3.42Å; G44-E78 WeakPolarHBondContact O-CB 3.35Å; G44-E79 PolarHBondContact O-N 2.63Å
45	P	86.7	Confident	79.5	Confident	102 Å²	102	82 Å²	82	66%	0.662	51%	0.514	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-59.3	134.2	178.4	26.9	-33.7	0	0	0	110.6
46	G	91.9	Very high	81.3	Confident	11 Å²	11	88.6 Å²	88.6	11%	0.113	53%	0.531	C	S	.	.			trans	-55.4	153.9	172.9	0	0	0	0	0	111.9	G44 E79 C81	G44-G46 PolarHBondContact O-N 3.42Å; G46-E79 WeakPolarHBondContact CA-O 3.4Å; G46-E79 PolarHBondContact N-O 3.26Å; G46-C81 PolarHBondContact O-SG 2.9Å
47	E	95.1	Very high	83.3	Confident	145 Å²	145	84.5 Å²	84.5	68%	0.678	50%	0.504	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104.1	137	-174	-168.9	176.7	-179.1	0	0	111.7	L73 C81	E47-L73 PolarHBondContact N-O 3.28Å; E47-L73 PolarHBondContact O-N 2.67Å; E47-C81 VanDerWaalsContact C-SG 3.57Å
48	W	97.8	Very high	85.1	Confident	57 Å²	57	85.4 Å²	85.4	22%	0.216	50%	0.499	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.9	134.2	173.7	-77.2	117	0	0	0	111.2	R70 R71 C72 C81 W82 G83	W48-R70 HydrophobicContact CD2-CG 4.14Å; W48-R70 HydrophobicContact CE3-CB 4.27Å; W48-R70 HydrophobicContact CE3-CG 3.51Å; W48-R70 HydrophobicContact CZ3-CG 3.84Å; W48-R71 VanDerWaalsContact CE3-C 3.45Å; W48-C72 HydrophobicContact CE3-CB 4.05Å; W48-C72 HydrophobicContact CH2-CB 4.1Å; W48-C72 HydrophobicContact CZ3-CB 3.72Å; W48-C81 HydrophobicContact CD2-CB 3.76Å; W48-C81 HydrophobicContact CE3-CB 4.32Å; W48-C81 HydrophobicContact CG-CB 4.26Å; W48-C81 HydrophobicContact CH2-CB 3.98Å; W48-C81 HydrophobicContact CZ2-CB 3.36Å; W48-C81 HydrophobicContact CZ3-CB 4.42Å; W48-W82 PolarHBondContact NE1-O 3.49Å; W48-G83 WeakPolarHBondContact CZ2-O 3.39Å
49	T	98.1	Very high	86.8	Confident	35 Å²	35	80 Å²	80	22%	0.215	47%	0.474	C	S	.	.	P	Polyproline II helix	trans	-61.2	157.4	161	68.1	0	0	0	0	110.1	R71 L73	T49-R71 HydrophobicContact CG2-CB 3.98Å; T49-R71 WeakPolarHBondContact CG2-O 2.95Å; T49-R71 PolarHBondContact N-O 3.01Å; T49-R71 PolarHBondContact OG1-N 3.24Å; T49-R71 PolarHBondContact OG1-O 3.29Å; T49-L73 HydrophobicContact CG2-CD1 3.87Å; T49-L73 HydrophobicContact CG2-CD2 3.92Å; T49-L73 HydrophobicContact CG2-CG 3.71Å
50	P	98.1	Very high	88.5	Confident	114 Å²	114	83 Å²	83	74%	0.74	49%	0.487	S	S	*	.	P	Polyproline II helix	trans	-52.4	149.8	163.5	-24.5	34.4	0	0	0	111	V52	P50-V52 PolarHBondContact O-N 2.03Å
51	W	98.5	Very high	90.2	Very high	79 Å²	79	78.9 Å²	78.9	30%	0.299	46%	0.463	S	S	.	.	P	Polyproline II helix	trans	-61.9	135.2	171.8	-72.8	107.4	0	0	0	110.4	R68 S69 R70 E87	W51-R68 HydrophobicContact CD2-CG 4.29Å; W51-R68 HydrophobicContact CE3-CB 4.36Å; W51-R68 HydrophobicContact CE3-CG 3.7Å; W51-R68 HydrophobicContact CZ3-CG 4.1Å; W51-S69 VanDerWaalsContact CE3-C 3.46Å; W51-R70 HydrophobicContact CD2-CB 4.15Å; W51-R70 HydrophobicContact CD2-CG 4.1Å; W51-R70 HydrophobicContact CE3-CB 3.8Å; W51-R70 HydrophobicContact CE3-CG 3.74Å; W51-R70 HydrophobicContact CH2-CG 3.71Å; W51-R70 VanDerWaalsContact CZ2-CD 3.47Å; W51-R70 HydrophobicContact CZ2-CG 4.07Å; W51-R70 VanDerWaalsContact CZ2-CZ 3.46Å; W51-R70 HydrophobicContact CZ3-CB 4.09Å; W51-R70 HydrophobicContact CZ3-CG 3.55Å; W51-E87 HydrophobicContact CH2-CB 4.02Å; W51-E87 HydrophobicContact CZ3-CB 4.18Å
52	V	98.3	Very high	91.8	Very high	71 Å²	71	75 Å²	75	43%	0.43	44%	0.437	S	S	.	.	P	Polyproline II helix	trans	-67	160	164.9	-56.5	0	0	0	0	110	P50 R68 S69	P50-V52 PolarHBondContact O-N 2.03Å; V52-R68 HydrophobicContact CG2-CB 4.5Å; V52-S69 WeakPolarHBondContact CG2-O 3.34Å; V52-S69 PolarHBondContact N-O 3.42Å
53	S	98.4	Very high	93.4	Very high	104 Å²	104	79.6 Å²	79.6	73%	0.727	44%	0.438	S	S	*	.	P	Polyproline II helix	trans	-57.2	146.8	170.1	55.9	0	0	0	0	110.8	T55	S53-T55 PolarHBondContact O-N 3.39Å
54	W	98.5	Very high	94.8	Very high	57 Å²	57	76.4 Å²	76.4	22%	0.216	43%	0.425	C	S	.	.	P	Polyproline II helix	trans	-53	136.5	171.1	-68.3	101	0	0	0	111.4	S66 V67 R68 E87 R89	W54-S66 WeakPolarHBondContact CZ3-O 3.22Å; W54-V67 VanDerWaalsContact CE3-C 3.42Å; W54-R68 HydrophobicContact CD2-CB 3.95Å; W54-R68 HydrophobicContact CD2-CG 3.98Å; W54-R68 VanDerWaalsContact CE2-CD 3.49Å; W54-R68 HydrophobicContact CE3-CB 3.79Å; W54-R68 HydrophobicContact CE3-CG 3.84Å; W54-R68 HydrophobicContact CG-CB 4.48Å; W54-R68 HydrophobicContact CH2-CG 3.69Å; W54-R68 VanDerWaalsContact CZ2-CD 3.49Å; W54-R68 HydrophobicContact CZ2-CG 3.82Å; W54-R68 HydrophobicContact CZ3-CB 4.11Å; W54-R68 HydrophobicContact CZ3-CG 3.69Å; W54-E87 HydrophobicContact CH2-CB 4.04Å; W54-E87 HydrophobicContact CH2-CG 3.85Å; W54-E87 WeakPolarHBondContact CZ3-O 3.21Å; W54-R89 VanDerWaalsContact CD1-CZ 3.48Å; W54-R89 HydrophobicContact CD2-CG 4.23Å; W54-R89 HydrophobicContact CE3-CG 3.85Å; W54-R89 VanDerWaalsContact CG-CZ 3.45Å; W54-R89 HydrophobicContact CH2-CB 3.93Å; W54-R89 HydrophobicContact CH2-CG 3.87Å; W54-R89 HydrophobicContact CZ2-CB 4.47Å; W54-R89 HydrophobicContact CZ2-CG 4.26Å; W54-R89 HydrophobicContact CZ3-CB 4.08Å; W54-R89 HydrophobicContact CZ3-CG 3.65Å
55	T	98.4	Very high	95.8	Very high	77 Å²	77	76.9 Å²	76.9	47%	0.472	42%	0.419	S	S	.	.	P	Polyproline II helix	trans	-62.5	163.4	169.5	62	0	0	0	0	110.4	S53 V67	S53-T55 PolarHBondContact O-N 3.39Å; T55-V67 WeakPolarHBondContact CG2-O 3Å; T55-V67 PolarHBondContact N-O 3.05Å; T55-V67 PolarHBondContact OG1-N 3.45Å; T55-V67 PolarHBondContact OG1-O 2.88Å
56	R	97.6	Very high	96.4	Very high	231 Å²	231	72.2 Å²	72.2	87%	0.872	39%	0.389	S	S	*	.	P	Polyproline II helix	trans	-56.3	150.2	163.5	-174.3	178.3	-75.4	179.6	-3.4	109.3
57	C	97.4	Very high	96.7	Very high	19 Å²	19	73.5 Å²	73.5	13%	0.128	39%	0.394	C	S	.	.	P	Polyproline II helix	trans	-53.7	139.7	172.7	-161.9	0	0	0	0	110.8	S59 C91 L93	C57-S59 PolarHBondContact O-N 2.93Å; C57-C91 WeakPolarHBondContact CA-SG 3.39Å; C57-C91 HydrophobicContact CB-CB 3.88Å; C57-C91 WeakPolarHBondContact CB-SG 3.46Å; C57-C91 WeakPolarHBondContact SG-CB 3.41Å; C57-C91 CovalentContact SG-SG 2.03Å; C57-C91 PolarHBondContact SG-SG 2.03Å; C57-L93 HydrophobicContact CB-CD1 3.79Å
58	S	95.5	Very high	96.9	Very high	88 Å²	88	69.5 Å²	69.5	62%	0.615	37%	0.373	S	S	*	.	S	Bend	trans	-64.2	-17.2	179.1	64.1	0	0	0	0	113.9	V65	S58-V65 WeakPolarHBondContact CB-O 3.35Å; S58-V65 PolarHBondContact N-O 2.91Å; S58-V65 PolarHBondContact OG-N 3.4Å; S58-V65 PolarHBondContact OG-O 2.97Å
59	S	93.4	Very high	96.9	Very high	40 Å²	40	68.8 Å²	68.8	28%	0.28	38%	0.377	S	S	.	.	S	Bend	trans	-114.2	156.4	176.1	-58.2	0	0	0	0	110.2	C57 C61 R63 L93	C57-S59 PolarHBondContact O-N 2.93Å; S59-C61 WeakPolarHBondContact CB-O 3.47Å; S59-R63 PolarHBondContact OG-O 3.19Å; S59-L93 WeakPolarHBondContact O-CD1 3.45Å
60	S	93.7	Very high	96.9	Very high	116 Å²	116	69.4 Å²	69.4	81%	0.811	38%	0.375	S	S	*	.	S	Bend	trans	-95.6	-11.6	174.8	54.8	0	0	0	0	113.5
61	C	94.7	Very high	96.9	Very high	28 Å²	28	73.3 Å²	73.3	19%	0.189	38%	0.375	C	S	.	.	S	Bend	trans	-150	165.9	175.6	59.4	0	0	0	0	109.2	S59 P94 C96	S59-C61 WeakPolarHBondContact CB-O 3.47Å; C61-P94 CarbonylContact C-O 3.56Å; C61-P94 WeakPolarHBondContact CA-O 3.45Å; C61-P94 WeakPolarHBondContact CB-O 3.36Å; C61-C96 HydrophobicContact CB-CB 3.92Å; C61-C96 WeakPolarHBondContact CB-SG 2.98Å; C61-C96 WeakPolarHBondContact SG-CA 3.38Å; C61-C96 WeakPolarHBondContact SG-CB 3.39Å; C61-C96 CovalentContact SG-SG 2.04Å; C61-C96 PolarHBondContact SG-SG 3.5Å
62	G	94.2	Very high	96.8	Very high	11 Å²	11	71.6 Å²	71.6	11%	0.113	37%	0.374	C	S	.	.	S	Bend	trans	61.3	-139.7	178.3	0	0	0	0	0	113.1	L93 P94	G62-L93 WeakPolarHBondContact O-CB 3.45Å; G62-L93 PolarHBondContact O-N 3.2Å; G62-P94 PolarHBondContact N-O 3.17Å
63	R	94.3	Very high	96.7	Very high	173 Å²	173	73.1 Å²	73.1	65%	0.653	38%	0.38	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.7	135.4	-177.8	-173.9	179.6	-65.2	174.4	2.2	111	S59	S59-R63 PolarHBondContact OG-O 3.19Å
64	G	95	Very high	96.5	Very high	5 Å²	5	75 Å²	75	5%	0.052	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142	-166.4	170.3	0	0	0	0	0	112.7	L90 C91	G64-L90 WeakPolarHBondContact O-CA 3.35Å; G64-C91 PolarHBondContact N-O 3.39Å; G64-C91 PolarHBondContact O-N 3.21Å; G64-C91 PolarHBondContact O-SG 3.26Å; G64-C91 VanDerWaalsContact O-SG 3.42Å
65	V	97.2	Very high	96.1	Very high	52 Å²	52	77 Å²	77	32%	0.315	39%	0.385	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125	136.5	177.8	-179.9	0	0	0	0	109.2	S58 V67 Y88 R89 L90 C91	S58-V65 WeakPolarHBondContact CB-O 3.35Å; S58-V65 PolarHBondContact N-O 2.91Å; S58-V65 PolarHBondContact OG-N 3.4Å; S58-V65 PolarHBondContact OG-O 2.97Å; V65-V67 HydrophobicContact CG1-CG2 4.37Å; V65-Y88 HydrophobicContact CG1-CD1 4.04Å; V65-R89 CarbonylContact C-O 3.52Å; V65-R89 WeakPolarHBondContact CA-O 3.29Å; V65-L90 HydrophobicContact CG2-CD2 4.25Å; V65-C91 PolarHBondContact N-SG 3.44Å; V65-C91 VanDerWaalsContact N-SG 3.39Å
66	S	98.4	Very high	95.5	Very high	4 Å²	4	78.7 Å²	78.7	3%	0.028	40%	0.398	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	145.5	165.7	-52.9	0	0	0	0	109.2	W54 R89 C91	W54-S66 WeakPolarHBondContact CZ3-O 3.22Å; S66-R89 PolarHBondContact N-O 2.9Å; S66-R89 PolarHBondContact O-N 2.79Å; S66-C91 PolarHBondContact OG-SG 3.14Å
67	V	98.6	Very high	94.9	Very high	38 Å²	38	69.4 Å²	69.4	23%	0.23	37%	0.374	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.1	144.6	-178.1	-170.2	0	0	0	0	108.9	W54 T55 V65 E87 Y88	W54-V67 VanDerWaalsContact CE3-C 3.42Å; T55-V67 WeakPolarHBondContact CG2-O 3Å; T55-V67 PolarHBondContact N-O 3.05Å; T55-V67 PolarHBondContact OG1-N 3.45Å; T55-V67 PolarHBondContact OG1-O 2.88Å; V65-V67 HydrophobicContact CG1-CG2 4.37Å; V67-E87 WeakPolarHBondContact CA-O 3.41Å; V67-Y88 HydrophobicContact CB-CD1 4.44Å; V67-Y88 HydrophobicContact CB-CE1 4.46Å; V67-Y88 HydrophobicContact CG1-CD1 4.17Å; V67-Y88 HydrophobicContact CG1-CE1 3.88Å; V67-Y88 HydrophobicContact CG2-CD1 3.66Å; V67-Y88 HydrophobicContact CG2-CE1 3.73Å
68	R	98.6	Very high	94.5	Very high	60 Å²	60	70.8 Å²	70.8	23%	0.226	38%	0.378	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.2	155.3	162.2	65.3	176.3	-179.3	-176	-3.9	109.5	W51 V52 W54 H86 E87	W51-R68 HydrophobicContact CD2-CG 4.29Å; W51-R68 HydrophobicContact CE3-CB 4.36Å; W51-R68 HydrophobicContact CE3-CG 3.7Å; W51-R68 HydrophobicContact CZ3-CG 4.1Å; V52-R68 HydrophobicContact CG2-CB 4.5Å; W54-R68 HydrophobicContact CD2-CB 3.95Å; W54-R68 HydrophobicContact CD2-CG 3.98Å; W54-R68 VanDerWaalsContact CE2-CD 3.49Å; W54-R68 HydrophobicContact CE3-CB 3.79Å; W54-R68 HydrophobicContact CE3-CG 3.84Å; W54-R68 HydrophobicContact CG-CB 4.48Å; W54-R68 HydrophobicContact CH2-CG 3.69Å; W54-R68 VanDerWaalsContact CZ2-CD 3.49Å; W54-R68 HydrophobicContact CZ2-CG 3.82Å; W54-R68 HydrophobicContact CZ3-CB 4.11Å; W54-R68 HydrophobicContact CZ3-CG 3.69Å; R68-H86 WeakPolarHBondContact O-CA 3.44Å; R68-E87 HydrophobicContact CG-CB 3.87Å; R68-E87 IonicContact CZ-OE1 3.91Å; R68-E87 IonicContact CZ-OE2 3.09Å; R68-E87 PolarHBondContact N-O 3.42Å; R68-E87 IonicContact NE-OE1 2.78Å; R68-E87 IonicContact NE-OE2 2.63Å; R68-E87 PolarHBondContact NE-OE2 2.83Å; R68-E87 VanDerWaalsContact NH2-CD 3.32Å; R68-E87 IonicContact NH2-OE1 3.26Å; R68-E87 PolarHBondContact NH2-OE1 2.77Å; R68-E87 IonicContact NH2-OE2 3.88Å; R68-E87 PolarHBondContact NH2-OE2 3.03Å; R68-E87 PolarHBondContact O-N 2.82Å
69	S	98.5	Very high	94.3	Very high	42 Å²	42	71.3 Å²	71.3	29%	0.294	37%	0.371	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.9	161.4	-178.9	61.6	0	0	0	0	112	W51 V52 S85	W51-S69 VanDerWaalsContact CE3-C 3.46Å; V52-S69 WeakPolarHBondContact CG2-O 3.34Å; V52-S69 PolarHBondContact N-O 3.42Å; S69-S85 CarbonylContact C-O 3.59Å; S69-S85 VanDerWaalsContact CA-O 3.29Å; S69-S85 WeakPolarHBondContact CA-O 3.11Å
70	R	98.4	Very high	94.2	Very high	49 Å²	49	72.9 Å²	72.9	19%	0.185	38%	0.381	C	S	.	.			trans	-144.3	160.1	170.6	59.6	178	178.4	176.3	1	108.4	W48 W51 D84 S85	W48-R70 HydrophobicContact CD2-CG 4.14Å; W48-R70 HydrophobicContact CE3-CB 4.27Å; W48-R70 HydrophobicContact CE3-CG 3.51Å; W48-R70 HydrophobicContact CZ3-CG 3.84Å; W51-R70 HydrophobicContact CD2-CB 4.15Å; W51-R70 HydrophobicContact CD2-CG 4.1Å; W51-R70 HydrophobicContact CE3-CB 3.8Å; W51-R70 HydrophobicContact CE3-CG 3.74Å; W51-R70 HydrophobicContact CH2-CG 3.71Å; W51-R70 VanDerWaalsContact CZ2-CD 3.47Å; W51-R70 HydrophobicContact CZ2-CG 4.07Å; W51-R70 VanDerWaalsContact CZ2-CZ 3.46Å; W51-R70 HydrophobicContact CZ3-CB 4.09Å; W51-R70 HydrophobicContact CZ3-CG 3.55Å; R70-D84 PolarHBondContact NE-O 2.95Å; R70-D84 PolarHBondContact NH2-O 2.97Å; R70-S85 PolarHBondContact N-O 2.93Å
71	R	97.6	Very high	94.3	Very high	195 Å²	195	68.1 Å²	68.1	74%	0.736	35%	0.347	S	S	*	.			trans	-112.7	145.4	179.1	-63.1	-178.5	-177	169	1.3	109.8	W48 T49	W48-R71 VanDerWaalsContact CE3-C 3.45Å; T49-R71 HydrophobicContact CG2-CB 3.98Å; T49-R71 WeakPolarHBondContact CG2-O 2.95Å; T49-R71 PolarHBondContact N-O 3.01Å; T49-R71 PolarHBondContact OG1-N 3.24Å; T49-R71 PolarHBondContact OG1-O 3.29Å
72	C	97	Very high	94.3	Very high	43 Å²	43	77 Å²	77	29%	0.291	38%	0.377	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.8	115.6	170.1	-179.3	0	0	0	0	108	W48 C81	W48-C72 HydrophobicContact CE3-CB 4.05Å; W48-C72 HydrophobicContact CH2-CB 4.1Å; W48-C72 HydrophobicContact CZ3-CB 3.72Å; C72-C81 WeakPolarHBondContact CA-SG 3.5Å; C72-C81 HydrophobicContact CB-CB 3.72Å; C72-C81 WeakPolarHBondContact CB-SG 3.38Å; C72-C81 WeakPolarHBondContact SG-CB 3.36Å; C72-C81 PolarHBondContact SG-N 2.86Å; C72-C81 CovalentContact SG-SG 2.03Å; C72-C81 PolarHBondContact SG-SG 2.98Å
73	L	95.7	Very high	94.3	Very high	103 Å²	103	79.2 Å²	79.2	54%	0.539	40%	0.399	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.6	121.4	171	-56.9	-177.1	0	0	0	107.5	E47 T49	E47-L73 PolarHBondContact N-O 3.28Å; E47-L73 PolarHBondContact O-N 2.67Å; T49-L73 HydrophobicContact CG2-CD1 3.87Å; T49-L73 HydrophobicContact CG2-CD2 3.92Å; T49-L73 HydrophobicContact CG2-CG 3.71Å
74	R	93.1	Very high	94.4	Very high	143 Å²	143	76.9 Å²	76.9	54%	0.54	40%	0.4	S	S	.	.			trans	-150.5	148.8	176.6	71	177.7	-175.5	81.7	2.8	112.1	E78	R74-E78 WeakPolarHBondContact CA-OE2 3.32Å; R74-E78 HydrophobicContact CB-CB 4.03Å
75	L	90.1	Very high	94.6	Very high	99 Å²	99	79 Å²	79	52%	0.518	41%	0.414	S	S	.	.			trans	-85.1	162.3	170.4	-63.9	175.7	0	0	0	111.6	G77 E78	L75-G77 PolarHBondContact O-N 2.93Å; L75-E78 HydrophobicContact CB-CG 4.13Å; L75-E78 PolarHBondContact N-OE2 3.47Å; L75-E78 PolarHBondContact O-N 2.78Å; L75-E78 VanDerWaalsContact O-N 3.14Å
76	P	87.4	Confident	94.6	Very high	113 Å²	113	80.7 Å²	80.7	73%	0.734	42%	0.418	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.4	118.4	169.6	-21.7	33.9	0	0	0	111.1	Q43	Q43-P76 PolarHBondContact NE2-O 2.92Å
77	G	84.4	Confident	94.6	Very high	36 Å²	36	83.8 Å²	83.8	37%	0.371	43%	0.432	S	S	.	.	T	Hydrogen-bonded Turn	trans	99.4	-3.8	-177	0	0	0	0	0	114.9	Q43 L75	Q43-G77 PolarHBondContact N-O 2.97Å; L75-G77 PolarHBondContact O-N 2.93Å
78	E	89.6	Confident	94.6	Very high	48 Å²	48	89.3 Å²	89.3	22%	0.224	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.2	147.2	167.7	-75.6	178.4	178.1	0	0	112	Q43 G44 R74 L75	Q43-E78 HydrophobicContact CB-CB 4.22Å; Q43-E78 HydrophobicContact CB-CG 3.2Å; Q43-E78 HydrophobicContact CG-CG 4.39Å; Q43-E78 WeakPolarHBondContact O-CA 3.37Å; G44-E78 WeakPolarHBondContact O-CB 3.35Å; R74-E78 WeakPolarHBondContact CA-OE2 3.32Å; R74-E78 HydrophobicContact CB-CB 4.03Å; L75-E78 HydrophobicContact CB-CG 4.13Å; L75-E78 PolarHBondContact N-OE2 3.47Å; L75-E78 PolarHBondContact O-N 2.78Å; L75-E78 VanDerWaalsContact O-N 3.14Å
79	E	90.6	Very high	94.6	Very high	100 Å²	100	92.1 Å²	92.1	47%	0.467	46%	0.461	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.4	144.2	175	-69.3	-63.7	152	0	0	111.1	G44 G46	G44-E79 PolarHBondContact O-N 2.63Å; G46-E79 WeakPolarHBondContact CA-O 3.4Å; G46-E79 PolarHBondContact N-O 3.26Å
80	P	91.8	Very high	94.6	Very high	73 Å²	73	96 Å²	96	47%	0.474	48%	0.478	S	S	.	.	P	Polyproline II helix	trans	-64.8	150.3	175.4	28.7	-33.6	0	0	0	111.2	W82	P80-W82 PolarHBondContact O-N 3.45Å
81	C	94.9	Very high	94.5	Very high	16 Å²	16	94.7 Å²	94.7	11%	0.108	48%	0.475	C	S	.	.	P	Polyproline II helix	trans	-63.8	134.8	174.7	-53.5	0	0	0	0	110.6	G46 E47 W48 C72	G46-C81 PolarHBondContact O-SG 2.9Å; E47-C81 VanDerWaalsContact C-SG 3.57Å; W48-C81 HydrophobicContact CD2-CB 3.76Å; W48-C81 HydrophobicContact CE3-CB 4.32Å; W48-C81 HydrophobicContact CG-CB 4.26Å; W48-C81 HydrophobicContact CH2-CB 3.98Å; W48-C81 HydrophobicContact CZ2-CB 3.36Å; W48-C81 HydrophobicContact CZ3-CB 4.42Å; C72-C81 WeakPolarHBondContact CA-SG 3.5Å; C72-C81 HydrophobicContact CB-CB 3.72Å; C72-C81 WeakPolarHBondContact CB-SG 3.38Å; C72-C81 WeakPolarHBondContact SG-CB 3.36Å; C72-C81 PolarHBondContact SG-N 2.86Å; C72-C81 CovalentContact SG-SG 2.03Å; C72-C81 PolarHBondContact SG-SG 2.98Å
82	W	94.2	Very high	94.4	Very high	214 Å²	214	91.2 Å²	91.2	81%	0.811	47%	0.467	S	S	*	.	S	Bend	trans	-81.1	136.1	176.2	-66.3	82.6	0	0	0	111.1	W48 P80	W48-W82 PolarHBondContact NE1-O 3.49Å; P80-W82 PolarHBondContact O-N 3.45Å
83	G	94.9	Very high	94.4	Very high	57 Å²	57	91.9 Å²	91.9	59%	0.588	47%	0.468	S	S	*	.	S	Bend	trans	101.1	-177	178.1	0	0	0	0	0	114.5	W48	W48-G83 WeakPolarHBondContact CZ2-O 3.39Å
84	D	97.4	Very high	94.4	Very high	125 Å²	125	91.9 Å²	91.9	67%	0.668	47%	0.474	S	S	*	.			trans	-81.1	143.8	-171.8	-60.5	-49.7	0	0	0	112.8	R70 H86	R70-D84 PolarHBondContact NE-O 2.95Å; R70-D84 PolarHBondContact NH2-O 2.97Å; D84-H86 VanDerWaalsContact C-N 3.31Å; D84-H86 WeakPolarHBondContact CB-O 3.34Å
85	S	97.8	Very high	94.6	Very high	50 Å²	50	91.6 Å²	91.6	35%	0.35	48%	0.483	S	S	.	.	S	Bend	trans	-82.3	-11.8	172.3	55.8	0	0	0	0	113	S69 R70	S69-S85 CarbonylContact C-O 3.59Å; S69-S85 VanDerWaalsContact CA-O 3.29Å; S69-S85 WeakPolarHBondContact CA-O 3.11Å; R70-S85 PolarHBondContact N-O 2.93Å
86	H	98.4	Very high	94.8	Very high	86 Å²	86	89.6 Å²	89.6	40%	0.398	48%	0.477	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.7	147.6	-176.4	-65.9	77.9	0	0	0	110.6	R68 D84 Y88	R68-H86 WeakPolarHBondContact O-CA 3.44Å; D84-H86 VanDerWaalsContact C-N 3.31Å; D84-H86 WeakPolarHBondContact CB-O 3.34Å; H86-Y88 HydrophobicContact CB-CE2 4Å
87	E	98.5	Very high	95.2	Very high	70 Å²	70	88.3 Å²	88.3	33%	0.327	47%	0.469	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	146.5	172.9	-165.8	-175.1	148.9	0	0	109.8	W51 W54 V67 R68	W51-E87 HydrophobicContact CH2-CB 4.02Å; W51-E87 HydrophobicContact CZ3-CB 4.18Å; W54-E87 HydrophobicContact CH2-CB 4.04Å; W54-E87 HydrophobicContact CH2-CG 3.85Å; W54-E87 WeakPolarHBondContact CZ3-O 3.21Å; V67-E87 WeakPolarHBondContact CA-O 3.41Å; R68-E87 HydrophobicContact CG-CB 3.87Å; R68-E87 IonicContact CZ-OE1 3.91Å; R68-E87 IonicContact CZ-OE2 3.09Å; R68-E87 PolarHBondContact N-O 3.42Å; R68-E87 IonicContact NE-OE1 2.78Å; R68-E87 IonicContact NE-OE2 2.63Å; R68-E87 PolarHBondContact NE-OE2 2.83Å; R68-E87 VanDerWaalsContact NH2-CD 3.32Å; R68-E87 IonicContact NH2-OE1 3.26Å; R68-E87 PolarHBondContact NH2-OE1 2.77Å; R68-E87 IonicContact NH2-OE2 3.88Å; R68-E87 PolarHBondContact NH2-OE2 3.03Å; R68-E87 PolarHBondContact O-N 2.82Å
88	Y	98.4	Very high	95.8	Very high	154 Å²	154	93.3 Å²	93.3	60%	0.604	49%	0.494	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-124.4	140.2	-174.5	-58	-92.8	0	0	0	109.6	V65 V67 H86	V65-Y88 HydrophobicContact CG1-CD1 4.04Å; V67-Y88 HydrophobicContact CB-CD1 4.44Å; V67-Y88 HydrophobicContact CB-CE1 4.46Å; V67-Y88 HydrophobicContact CG1-CD1 4.17Å; V67-Y88 HydrophobicContact CG1-CE1 3.88Å; V67-Y88 HydrophobicContact CG2-CD1 3.66Å; V67-Y88 HydrophobicContact CG2-CE1 3.73Å; H86-Y88 HydrophobicContact CB-CE2 4Å
89	R	98	Very high	95.9	Very high	119 Å²	119	94.9 Å²	94.9	45%	0.449	52%	0.523	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.1	150.5	169.9	70.7	179.6	-174.6	178.3	1.5	111	W54 V65 S66	W54-R89 VanDerWaalsContact CD1-CZ 3.48Å; W54-R89 HydrophobicContact CD2-CG 4.23Å; W54-R89 HydrophobicContact CE3-CG 3.85Å; W54-R89 VanDerWaalsContact CG-CZ 3.45Å; W54-R89 HydrophobicContact CH2-CB 3.93Å; W54-R89 HydrophobicContact CH2-CG 3.87Å; W54-R89 HydrophobicContact CZ2-CB 4.47Å; W54-R89 HydrophobicContact CZ2-CG 4.26Å; W54-R89 HydrophobicContact CZ3-CB 4.08Å; W54-R89 HydrophobicContact CZ3-CG 3.65Å; V65-R89 CarbonylContact C-O 3.52Å; V65-R89 WeakPolarHBondContact CA-O 3.29Å; S66-R89 PolarHBondContact N-O 2.9Å; S66-R89 PolarHBondContact O-N 2.79Å
90	L	97.8	Very high	96	Very high	124 Å²	124	92.4 Å²	92.4	65%	0.649	52%	0.52	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-72.3	139.1	168.1	-63.5	175.9	0	0	0	109.7	G64 V65	G64-L90 WeakPolarHBondContact O-CA 3.35Å; V65-L90 HydrophobicContact CG2-CD2 4.25Å
91	C	97	Very high	95.9	Very high	20 Å²	20	94 Å²	94	14%	0.135	53%	0.528	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.3	140.6	168.8	40	0	0	0	0	109	C57 G64 V65 S66	C57-C91 WeakPolarHBondContact CA-SG 3.39Å; C57-C91 HydrophobicContact CB-CB 3.88Å; C57-C91 WeakPolarHBondContact CB-SG 3.46Å; C57-C91 WeakPolarHBondContact SG-CB 3.41Å; C57-C91 CovalentContact SG-SG 2.03Å; C57-C91 PolarHBondContact SG-SG 2.03Å; G64-C91 PolarHBondContact N-O 3.39Å; G64-C91 PolarHBondContact O-N 3.21Å; G64-C91 PolarHBondContact O-SG 3.26Å; G64-C91 VanDerWaalsContact O-SG 3.42Å; V65-C91 PolarHBondContact N-SG 3.44Å; V65-C91 VanDerWaalsContact N-SG 3.39Å; S66-C91 PolarHBondContact OG-SG 3.14Å
92	Q	96.3	Very high	95.6	Very high	122 Å²	122	97 Å²	97	57%	0.57	55%	0.547	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-117.6	121.4	178.1	-166.6	71.8	37.2	0	0	108.2
93	L	95.9	Very high	95.4	Very high	57 Å²	57	93.2 Å²	93.2	30%	0.298	54%	0.537	S	S	.	.			trans	-110.4	170.4	177.7	-70.8	157.6	0	0	0	109.1	C57 S59 G62	C57-L93 HydrophobicContact CB-CD1 3.79Å; S59-L93 WeakPolarHBondContact O-CD1 3.45Å; G62-L93 WeakPolarHBondContact O-CB 3.45Å; G62-L93 PolarHBondContact O-N 3.2Å
94	P	96.9	Very high	95.2	Very high	103 Å²	103	96 Å²	96	67%	0.669	53%	0.53	S	S	*	.	S	Bend	trans	-52.3	148.7	170.5	-26.2	35.8	0	0	0	111.7	C61 G62	C61-P94 CarbonylContact C-O 3.56Å; C61-P94 WeakPolarHBondContact CA-O 3.45Å; C61-P94 WeakPolarHBondContact CB-O 3.36Å; G62-P94 PolarHBondContact N-O 3.17Å
95	D	95.8	Very high	95	Very high	138 Å²	138	93.1 Å²	93.1	74%	0.738	51%	0.514	S	S	*	.	P	Polyproline II helix	trans	-56.5	148.6	-178.4	-68	-39.8	0	0	0	112.2
96	C	95.2	Very high	94.8	Very high	57 Å²	57	95.2 Å²	95.2	39%	0.385	52%	0.521	S	S	.	.	P	Polyproline II helix	trans	-69.5	148.5	178.2	-65.9	0	0	0	0	111	C61 A100	C61-C96 HydrophobicContact CB-CB 3.92Å; C61-C96 WeakPolarHBondContact CB-SG 2.98Å; C61-C96 WeakPolarHBondContact SG-CA 3.38Å; C61-C96 WeakPolarHBondContact SG-CB 3.39Å; C61-C96 CovalentContact SG-SG 2.04Å; C61-C96 PolarHBondContact SG-SG 3.5Å; C96-A100 HydrophobicContact CB-CB 3.8Å
97	P	96.3	Very high	94.6	Very high	86 Å²	86	95.5 Å²	95.5	56%	0.558	52%	0.523	S	S	*	.	P	Polyproline II helix	trans	-60.5	152.4	177.4	25.4	-33.6	0	0	0	111	G99 A100	P97-G99 PolarHBondContact O-N 3.33Å; P97-A100 HydrophobicContact CG-CB 4.32Å; P97-A100 VanDerWaalsContact O-CB 3.24Å; P97-A100 WeakPolarHBondContact O-CB 3.39Å; P97-A100 PolarHBondContact O-N 3.34Å
98	P	95.6	Very high	94.4	Very high	140 Å²	140	93.5 Å²	93.5	91%	0.909	52%	0.516	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.4	135.2	175.2	-23.4	32.9	0	0	0	111.3	A100	P98-A100 VanDerWaalsContact C-N 3.3Å; P98-A100 PolarHBondContact O-N 2.74Å
99	G	92.2	Very high	94.3	Very high	81 Å²	81	88.3 Å²	88.3	84%	0.835	51%	0.505	S	S	*	.	T	Hydrogen-bonded Turn	trans	80.9	3.8	-178.1	0	0	0	0	0	115	P97 V101	P97-G99 PolarHBondContact O-N 3.33Å; G99-V101 PolarHBondContact O-N 2.87Å
100	A	91.7	Very high	94.2	Very high	49 Å²	49	87.7 Å²	87.7	41%	0.405	51%	0.51	S	S	.	.	P	Polyproline II helix	trans	-59.5	126.2	168.7	0	0	0	0	0	110.5	C96 P97 P98	C96-A100 HydrophobicContact CB-CB 3.8Å; P97-A100 HydrophobicContact CG-CB 4.32Å; P97-A100 VanDerWaalsContact O-CB 3.24Å; P97-A100 WeakPolarHBondContact O-CB 3.39Å; P97-A100 PolarHBondContact O-N 3.34Å; P98-A100 VanDerWaalsContact C-N 3.3Å; P98-A100 PolarHBondContact O-N 2.74Å
101	V	90.8	Very high	94.1	Very high	105 Å²	105	88 Å²	88	64%	0.636	50%	0.504	S	S	*	.	P	Polyproline II helix	trans	-77.1	126.9	175.4	179.6	0	0	0	0	108.6	G99 D105	G99-V101 PolarHBondContact O-N 2.87Å; V101-D105 HydrophobicContact CG1-CB 3.93Å
102	P	89.1	Confident	94	Very high	79 Å²	79	90.1 Å²	90.1	51%	0.513	51%	0.514	S	S	.	.	P	Polyproline II helix	trans	-63.1	145.9	177.9	-15.2	27	0	0	0	111.2	R104 D105 L106	P102-R104 PolarHBondContact O-N 2.78Å; P102-D105 WeakPolarHBondContact CB-OD2 3.4Å; P102-D105 WeakPolarHBondContact CD-OD2 3.15Å; P102-D105 VanDerWaalsContact CG-OD2 3.22Å; P102-D105 WeakPolarHBondContact CG-OD2 3.13Å; P102-D105 WeakPolarHBondContact O-CB 3.03Å; P102-D105 PolarHBondContact O-N 2.91Å; P102-D105 VanDerWaalsContact O-N 3.1Å; P102-L106 PolarHBondContact O-N 3.46Å
103	F	88.9	Confident	93.8	Very high	135 Å²	135	86.7 Å²	86.7	59%	0.592	51%	0.511	S	S	*	.	H	α-helix	trans	-59	-35.1	-174.4	-178.5	-111.8	0	0	0	113.2	D105 L106 Q107	F103-D105 PolarHBondContact O-N 3.36Å; F103-L106 PolarHBondContact O-N 3.35Å; F103-Q107 HydrophobicContact CD1-CG 4.18Å; F103-Q107 HydrophobicContact CE1-CG 3.78Å; F103-Q107 VanDerWaalsContact CE1-NE2 3.34Å; F103-Q107 HydrophobicContact CE2-CG 4.18Å; F103-Q107 HydrophobicContact CZ-CG 3.78Å; F103-Q107 WeakPolarHBondContact O-CG 3.5Å; F103-Q107 PolarHBondContact O-N 3.41Å
104	R	90.8	Very high	93.7	Very high	115 Å²	115	91 Å²	91	43%	0.434	52%	0.523	S	S	.	.	H	α-helix	trans	-64	-41.3	178.4	-60.6	-174.3	73.5	-162.7	1.8	111.8	P102 L106 Q107 C108 P127 F128 H129	P102-R104 PolarHBondContact O-N 2.78Å; R104-L106 VanDerWaalsContact C-N 3.33Å; R104-Q107 PolarHBondContact O-N 2.81Å; R104-C108 PolarHBondContact O-N 2.85Å; R104-C108 PolarHBondContact O-SG 3.04Å; R104-C108 VanDerWaalsContact O-SG 3.42Å; R104-P127 HydrophobicContact CB-CB 4.02Å; R104-P127 HydrophobicContact CB-CG 3.92Å; R104-F128 PolarHBondContact NH1-O 3.05Å; R104-F128 PolarHBondContact NH2-O 3.5Å; R104-H129 PolarHBondContact NH1-ND1 3.41Å
105	D	93.7	Very high	93.5	Very high	65 Å²	65	89.9 Å²	89.9	35%	0.348	52%	0.516	S	S	.	.	H	α-helix	trans	-62.9	-42.1	176.2	-61.9	-84.8	0	0	0	111.2	V101 P102 F103 C108 A109 P127	V101-D105 HydrophobicContact CG1-CB 3.93Å; P102-D105 WeakPolarHBondContact CB-OD2 3.4Å; P102-D105 WeakPolarHBondContact CD-OD2 3.15Å; P102-D105 VanDerWaalsContact CG-OD2 3.22Å; P102-D105 WeakPolarHBondContact CG-OD2 3.13Å; P102-D105 WeakPolarHBondContact O-CB 3.03Å; P102-D105 PolarHBondContact O-N 2.91Å; P102-D105 VanDerWaalsContact O-N 3.1Å; F103-D105 PolarHBondContact O-N 3.36Å; D105-C108 PolarHBondContact O-N 2.86Å; D105-A109 WeakPolarHBondContact O-CB 3.14Å; D105-A109 PolarHBondContact O-N 3.5Å; D105-P127 HydrophobicContact CB-CG 4.39Å; D105-P127 WeakPolarHBondContact OD1-CD 3.45Å; D105-P127 WeakPolarHBondContact OD1-CG 3.49Å
106	L	92.6	Very high	93.2	Very high	95 Å²	95	85.7 Å²	85.7	50%	0.497	50%	0.495	S	S	.	.	H	α-helix	trans	-62	-45.2	175.9	-175.6	64.1	0	0	0	111.6	P102 F103 R104 C108 A109 L110	P102-L106 PolarHBondContact O-N 3.46Å; F103-L106 PolarHBondContact O-N 3.35Å; R104-L106 VanDerWaalsContact C-N 3.33Å; L106-C108 VanDerWaalsContact C-N 3.33Å; L106-C108 PolarHBondContact O-N 2.74Å; L106-A109 PolarHBondContact O-N 3.08Å; L106-L110 WeakPolarHBondContact O-CG 3.25Å; L106-L110 PolarHBondContact O-N 3.41Å
107	Q	94.4	Very high	93	Very high	92 Å²	92	91.2 Å²	91.2	43%	0.43	52%	0.52	S	S	.	.	H	α-helix	trans	-60.8	-41.9	178	-72.1	-172.4	-59.3	0	0	112.2	F103 R104 L110 Y111	F103-Q107 HydrophobicContact CD1-CG 4.18Å; F103-Q107 HydrophobicContact CE1-CG 3.78Å; F103-Q107 VanDerWaalsContact CE1-NE2 3.34Å; F103-Q107 HydrophobicContact CE2-CG 4.18Å; F103-Q107 HydrophobicContact CZ-CG 3.78Å; F103-Q107 WeakPolarHBondContact O-CG 3.5Å; F103-Q107 PolarHBondContact O-N 3.41Å; R104-Q107 PolarHBondContact O-N 2.81Å; Q107-L110 WeakPolarHBondContact O-CB 3.21Å; Q107-Y111 WeakPolarHBondContact O-CD2 3.5Å
108	C	95.6	Very high	92.6	Very high	27 Å²	27	91.3 Å²	91.3	18%	0.182	54%	0.536	C	S	.	.	H	α-helix	trans	-64.7	-45	174.9	-71.4	0	0	0	0	111.3	R104 D105 L106 L110 Y111 W125 V126	R104-C108 PolarHBondContact O-N 2.85Å; R104-C108 PolarHBondContact O-SG 3.04Å; R104-C108 VanDerWaalsContact O-SG 3.42Å; D105-C108 PolarHBondContact O-N 2.86Å; L106-C108 VanDerWaalsContact C-N 3.33Å; L106-C108 PolarHBondContact O-N 2.74Å; C108-L110 PolarHBondContact O-N 2.81Å; C108-L110 VanDerWaalsContact O-N 3.09Å; C108-Y111 PolarHBondContact O-N 3.48Å; C108-W125 HydrophobicContact CB-CB 3.85Å; C108-W125 WeakPolarHBondContact CB-O 3.13Å; C108-W125 WeakPolarHBondContact O-CB 3.38Å; C108-V126 VanDerWaalsContact SG-C 3.53Å
109	A	96.2	Very high	92.3	Very high	45 Å²	45	87.6 Å²	87.6	37%	0.372	51%	0.511	S	S	.	.	H	α-helix	trans	-58.9	-27.1	-178.3	0	0	0	0	0	113.7	D105 L106 Y111 N112	D105-A109 WeakPolarHBondContact O-CB 3.14Å; D105-A109 PolarHBondContact O-N 3.5Å; L106-A109 PolarHBondContact O-N 3.08Å; A109-Y111 PolarHBondContact O-N 3.38Å; A109-Y111 VanDerWaalsContact O-N 3.11Å; A109-N112 WeakPolarHBondContact O-CB 3.33Å; A109-N112 PolarHBondContact O-N 3.3Å; A109-N112 VanDerWaalsContact O-N 3.1Å
110	L	95.8	Very high	92.2	Very high	106 Å²	106	92.4 Å²	92.4	56%	0.555	51%	0.512	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.8	-19.4	174.1	-66.9	175.6	0	0	0	114.1	L106 Q107 C108 R114	L106-L110 WeakPolarHBondContact O-CG 3.25Å; L106-L110 PolarHBondContact O-N 3.41Å; Q107-L110 WeakPolarHBondContact O-CB 3.21Å; C108-L110 PolarHBondContact O-N 2.81Å; C108-L110 VanDerWaalsContact O-N 3.09Å; L110-R114 PolarHBondContact O-NE 3.47Å; L110-R114 PolarHBondContact O-NH2 2.86Å
111	Y	94.9	Very high	92.3	Very high	131 Å²	131	96.6 Å²	96.6	51%	0.514	52%	0.521	S	S	.	.	T	Hydrogen-bonded Turn	trans	-103.6	-3.7	-180	-65.5	-91.8	0	0	0	113.5	Q107 C108 A109 G113 R114 W125	Q107-Y111 WeakPolarHBondContact O-CD2 3.5Å; C108-Y111 PolarHBondContact O-N 3.48Å; A109-Y111 PolarHBondContact O-N 3.38Å; A109-Y111 VanDerWaalsContact O-N 3.11Å; Y111-G113 PolarHBondContact O-N 3.29Å; Y111-R114 WeakPolarHBondContact O-CB 3.29Å; Y111-R114 PolarHBondContact O-N 3.42Å; Y111-R114 VanDerWaalsContact O-N 3.1Å; Y111-W125 VanDerWaalsContact CB-CD1 3.5Å; Y111-W125 PolarHBondContact O-NE1 2.76Å
112	N	95.1	Very high	92.5	Very high	64 Å²	64	95.6 Å²	95.6	34%	0.342	52%	0.516	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.9	135.3	176.3	-70.7	-11.7	0	0	0	110.6	A109 R114 Q124 W125	A109-N112 WeakPolarHBondContact O-CB 3.33Å; A109-N112 PolarHBondContact O-N 3.3Å; A109-N112 VanDerWaalsContact O-N 3.1Å; N112-R114 PolarHBondContact O-N 3.04Å; N112-Q124 WeakPolarHBondContact OD1-CA 3.11Å; N112-W125 PolarHBondContact OD1-N 3.44Å
113	G	93.3	Very high	92.7	Very high	50 Å²	50	97.4 Å²	97.4	52%	0.515	51%	0.513	S	S	.	.	T	Hydrogen-bonded Turn	trans	74.7	-4.5	-179.8	0	0	0	0	0	115	Y111 T122 Y123	Y111-G113 PolarHBondContact O-N 3.29Å; G113-T122 VanDerWaalsContact O-CG2 3.23Å; G113-T122 WeakPolarHBondContact O-CG2 3.35Å; G113-Y123 PolarHBondContact N-O 3.24Å
114	R	93.3	Very high	93	Very high	148 Å²	148	98.4 Å²	98.4	56%	0.558	52%	0.519	S	S	*	.	P	Polyproline II helix	trans	-76.6	131.4	171.9	-60.2	-172.9	-173.8	-119	-0.8	109.5	L110 Y111 N112	L110-R114 PolarHBondContact O-NE 3.47Å; L110-R114 PolarHBondContact O-NH2 2.86Å; Y111-R114 WeakPolarHBondContact O-CB 3.29Å; Y111-R114 PolarHBondContact O-N 3.42Å; Y111-R114 VanDerWaalsContact O-N 3.1Å; N112-R114 PolarHBondContact O-N 3.04Å
115	P	92.3	Very high	93.2	Very high	79 Å²	79	98.3 Å²	98.3	51%	0.513	52%	0.519	S	S	.	.	B	Isolated β-bridge	trans	-67.1	138.2	176.7	27.1	-32.6	0	0	0	110.3	K121	P115-K121 WeakPolarHBondContact CA-O 3.28Å
116	V	90.4	Very high	93.3	Very high	51 Å²	51	100.1 Å²	100.1	31%	0.309	53%	0.532	S	S	.	.	P	Polyproline II helix	trans	-78.1	132.3	176.5	177.2	0	0	0	0	109.1	G118 T119 K121 Y123 W125	V116-G118 PolarHBondContact O-N 3.28Å; V116-T119 CarbonylContact O-C 3.57Å; V116-T119 PolarHBondContact O-N 3.48Å; V116-T119 PolarHBondContact O-OG1 3.27Å; V116-T119 VanDerWaalsContact O-OG1 3.05Å; V116-K121 PolarHBondContact N-O 3.37Å; V116-Y123 HydrophobicContact CB-CE2 4.47Å; V116-Y123 HydrophobicContact CG2-CD2 3.62Å; V116-Y123 HydrophobicContact CG2-CE2 3.83Å; V116-W125 HydrophobicContact CG2-CZ2 4.01Å
117	L	89.4	Confident	93.5	Very high	173 Å²	173	96.4 Å²	96.4	91%	0.906	51%	0.514	S	S	*	.	T	Hydrogen-bonded Turn	trans	-49.4	128.7	-179.8	-65.7	175.4	0	0	0	111.3
118	G	89.2	Confident	93.4	Very high	87 Å²	87	99.8 Å²	99.8	90%	0.897	53%	0.527	S	S	*	.	T	Hydrogen-bonded Turn	trans	85	1.3	-176.7	0	0	0	0	0	115	V116	V116-G118 PolarHBondContact O-N 3.28Å
119	T	89.8	Confident	93	Very high	62 Å²	62	105.4 Å²	105.4	38%	0.38	55%	0.551	S	S	.	*			trans	-139.7	155.2	174.1	75.6	0	0	0	0	111.4	V116 K121	V116-T119 CarbonylContact O-C 3.57Å; V116-T119 PolarHBondContact O-N 3.48Å; V116-T119 PolarHBondContact O-OG1 3.27Å; V116-T119 VanDerWaalsContact O-OG1 3.05Å; T119-K121 PolarHBondContact OG1-N 2.94Å
120	Q	89.9	Confident	92.1	Very high	182 Å²	182	108.9 Å²	108.9	85%	0.85	59%	0.591	S	S	*	*	S	Bend	trans	-89.1	10.2	169.1	-155.2	68.6	5.8	0	0	112.2
121	K	93.3	Very high	91.9	Very high	137 Å²	137	109 Å²	109	60%	0.596	59%	0.592	S	S	*	*			trans	-87.6	142.2	-176	-65.9	-175.9	179.5	-179.1	0	110.4	P115 V116 T119 Y123	P115-K121 WeakPolarHBondContact CA-O 3.28Å; V116-K121 PolarHBondContact N-O 3.37Å; T119-K121 PolarHBondContact OG1-N 2.94Å; K121-Y123 HydrophobicContact CB-CE2 3.62Å; K121-Y123 WeakPolarHBondContact CD-OH 3.45Å
122	T	94.4	Very high	91.8	Very high	85 Å²	85	107.8 Å²	107.8	52%	0.521	60%	0.596	S	S	.	*	B	Isolated β-bridge	trans	-112.6	151.7	174.5	58.5	0	0	0	0	110.2	G113	G113-T122 VanDerWaalsContact O-CG2 3.23Å; G113-T122 WeakPolarHBondContact O-CG2 3.35Å
123	Y	93.7	Very high	91.6	Very high	117 Å²	117	110.3 Å²	110.3	46%	0.459	61%	0.611	S	S	.	*			trans	-136.6	162.5	-175.8	-61.3	-91.3	0	0	0	111.3	G113 V116 K121	G113-Y123 PolarHBondContact N-O 3.24Å; V116-Y123 HydrophobicContact CB-CE2 4.47Å; V116-Y123 HydrophobicContact CG2-CD2 3.62Å; V116-Y123 HydrophobicContact CG2-CE2 3.83Å; K121-Y123 HydrophobicContact CB-CE2 3.62Å; K121-Y123 WeakPolarHBondContact CD-OH 3.45Å
124	Q	95.8	Very high	91.5	Very high	156 Å²	156	113.8 Å²	113.8	73%	0.729	62%	0.616	S	S	*	*			trans	-93.5	118.4	162.6	-174	175.5	0.7	0	0	108.2	N112	N112-Q124 WeakPolarHBondContact OD1-CA 3.11Å
125	W	95.3	Very high	91.4	Very high	113 Å²	113	111.7 Å²	111.7	43%	0.428	62%	0.62	S	S	.	*			trans	-84.9	134.4	178.8	-63.3	80.4	0	0	0	109	C108 Y111 N112 V116	C108-W125 HydrophobicContact CB-CB 3.85Å; C108-W125 WeakPolarHBondContact CB-O 3.13Å; C108-W125 WeakPolarHBondContact O-CB 3.38Å; Y111-W125 VanDerWaalsContact CB-CD1 3.5Å; Y111-W125 PolarHBondContact O-NE1 2.76Å; N112-W125 PolarHBondContact OD1-N 3.44Å; V116-W125 HydrophobicContact CG2-CZ2 4.01Å
126	V	95.7	Very high	91.3	Very high	103 Å²	103	113.9 Å²	113.9	62%	0.624	63%	0.627	S	S	*	*			trans	-127.8	154.1	177.2	-64.9	0	0	0	0	109.8	C108 F128	C108-V126 VanDerWaalsContact SG-C 3.53Å; V126-F128 PolarHBondContact O-N 3.16Å
127	P	95.4	Very high	91.4	Very high	17 Å²	17	118.4 Å²	118.4	11%	0.11	65%	0.65	C	S	.	*			trans	-63.1	136.1	177.8	-22.9	34.6	0	0	0	112.3	R104 D105 H129	R104-P127 HydrophobicContact CB-CB 4.02Å; R104-P127 HydrophobicContact CB-CG 3.92Å; D105-P127 HydrophobicContact CB-CG 4.39Å; D105-P127 WeakPolarHBondContact OD1-CD 3.45Å; D105-P127 WeakPolarHBondContact OD1-CG 3.49Å; P127-H129 PolarHBondContact O-CD2 3.05Å
128	F	93.4	Very high	91.6	Very high	162 Å²	162	114.2 Å²	114.2	71%	0.711	63%	0.63	S	S	*	*			trans	-87.9	126.3	171	177.1	-106.3	0	0	0	110.6	R104 V126	R104-F128 PolarHBondContact NH1-O 3.05Å; R104-F128 PolarHBondContact NH2-O 3.5Å; V126-F128 PolarHBondContact O-N 3.16Å
129	H	86.4	Confident	91.7	Very high	146 Å²	146	116.4 Å²	116.4	68%	0.676	61%	0.608	S	S	*	*			trans	-101.4	-6.5	-174	-73.9	-83.3	0	0	0	115.9	R104 P127	R104-H129 PolarHBondContact NH1-ND1 3.41Å; P127-H129 PolarHBondContact O-CD2 3.05Å
130	G	77.9	Confident	91.9	Very high	117 Å²	117	121.4 Å²	121.4	100%	1.206	63%	0.628	S	S	*	*			trans	79.3	0	-179.1	0	0	0	0	0	112.2

Retrieved 130 of 130 residues in 105.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).