A0A087X1Q0_HUMAN Loading...

Integrator complex subunit 7

AlphaFold DB , UniProt , Accession A0A087X1Q0, Species HUMAN (Homo sapiens, Human), Gene INTS7, Length 42 aa.

						>A0A087X1Q0_HUMAN|A0A087X1Q0|INTS7
MASNSTKSFLADAGYGEQELDANSALMELDKDGVTSPVFQNT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.7	Very low	55.8	Low	244 Å²	244	129 Å²	129	100%	1.202	74%	0.741	S	S	*	*				0	101.3	0	-73.7	175.3	164.3	0	107.6	S3	M1-S3 VanDerWaalsContact O-N 3.12Å; M1-S3 PolarHBondContact O-N 3.18Å
2	A	50.1	Low	56.2	Low	112 Å²	112	130.6 Å²	130.6	93%	0.926	75%	0.746	S	S	*	*			trans	-76.4	94.8	175.2	0	0	0	0	108.1
3	S	52.3	Low	56.9	Low	106 Å²	106	124.3 Å²	124.3	74%	0.741	72%	0.719	S	S	*	*			trans	-113.5	65.2	159.8	-175.1	0	0	0	106.5	M1 S5	M1-S3 VanDerWaalsContact O-N 3.12Å; M1-S3 PolarHBondContact O-N 3.18Å; S3-S5 PolarHBondContact O-N 2.91Å
4	N	54.3	Low	57.1	Low	152 Å²	152	120.4 Å²	120.4	81%	0.813	72%	0.719	S	S	*	*			trans	-74.8	74.6	161.3	-170.3	44.2	0	0	105.3	T6	N4-T6 PolarHBondContact O-N 3.09Å
5	S	56.3	Low	57.4	Low	85 Å²	85	122.4 Å²	122.4	59%	0.594	71%	0.71	S	S	*	*			trans	-39.9	109.3	166	179.7	0	0	0	105.8	S3 K7	S3-S5 PolarHBondContact O-N 2.91Å; S5-K7 PolarHBondContact O-N 2.94Å
6	T	59	Low	58.2	Low	131 Å²	131	118.3 Å²	118.3	80%	0.804	70%	0.702	S	S	*	*			trans	-49.1	94.1	171.7	-36.1	0	0	0	105.4	N4 S8	N4-T6 PolarHBondContact O-N 3.09Å; T6-S8 VanDerWaalsContact C-N 3.29Å; T6-S8 PolarHBondContact O-N 3.35Å
7	K	59.2	Low	58.9	Low	177 Å²	177	120.6 Å²	120.6	77%	0.77	70%	0.704	S	S	*	*			trans	-57.6	108.8	170.4	-77.2	-175.3	178.2	-173.4	102.2	S5 F9	S5-K7 PolarHBondContact O-N 2.94Å; K7-F9 PolarHBondContact O-N 3Å
8	S	64.1	Low	59.7	Low	62 Å²	62	122.5 Å²	122.5	43%	0.434	71%	0.705	S	S	.	*			trans	-49.2	130.1	-176.4	50.6	0	0	0	106.2	T6 L10 A11	T6-S8 VanDerWaalsContact C-N 3.29Å; T6-S8 PolarHBondContact O-N 3.35Å; S8-L10 PolarHBondContact O-N 3.48Å; S8-A11 WeakPolarHBondContact O-CB 3.2Å; S8-A11 PolarHBondContact O-N 3.05Å
9	F	61.6	Low	60.4	Low	187 Å²	187	125.8 Å²	125.8	82%	0.82	71%	0.714	S	S	*	*	H	α-helix	trans	-50.1	-27.1	-177.3	169.7	-98.6	0	0	112.6	K7 A11	K7-F9 PolarHBondContact O-N 3Å; F9-A11 PolarHBondContact O-N 3.41Å
10	L	55.2	Low	60.9	Low	97 Å²	97	127.3 Å²	127.3	51%	0.508	72%	0.719	S	S	.	*	H	α-helix	trans	-60.9	-35.2	172.2	-75.8	143.7	0	0	114.3	S8	S8-L10 PolarHBondContact O-N 3.48Å
11	A	61.5	Low	61.7	Low	66 Å²	66	125.8 Å²	125.8	55%	0.545	71%	0.709	S	S	.	*	H	α-helix	trans	-72.6	-28.6	-176.2	0	0	0	0	113.8	S8 F9	S8-A11 WeakPolarHBondContact O-CB 3.2Å; S8-A11 PolarHBondContact O-N 3.05Å; F9-A11 PolarHBondContact O-N 3.41Å
12	D	60.1	Low	63.2	Low	148 Å²	148	117.8 Å²	117.8	79%	0.791	68%	0.682	S	S	*	*	H	α-helix	trans	-82.3	-23.4	-175.8	-152.6	37.1	0	0	112.6	G14	D12-G14 VanDerWaalsContact C-N 3.32Å
13	A	65.2	Low	64.2	Low	49 Å²	49	118.6 Å²	118.6	41%	0.405	67%	0.671	S	S	.	*	T	Hydrogen-bonded Turn	trans	-90.9	7.2	-179.3	0	0	0	0	113.4	Y15	A13-Y15 VanDerWaalsContact O-CD2 3.3Å; A13-Y15 VanDerWaalsContact O-N 3.07Å; A13-Y15 PolarHBondContact O-N 2.94Å; A13-Y15 WeakPolarHBondContact O-CE2 3.47Å; A13-Y15 WeakPolarHBondContact O-CD2 2.98Å; A13-Y15 HydrophobicContact CB-CG 4.43Å; A13-Y15 HydrophobicContact CB-CE2 3.63Å; A13-Y15 HydrophobicContact CB-CD2 3.33Å
14	G	59.9	Low	64.8	Low	69 Å²	69	117.1 Å²	117.1	71%	0.711	66%	0.66	S	S	*	*	T	Hydrogen-bonded Turn	trans	67.1	4.3	-178.7	0	0	0	0	114.2	D12 G16	D12-G14 VanDerWaalsContact C-N 3.32Å; G14-G16 PolarHBondContact O-N 3.41Å
15	Y	61.5	Low	65.3	Low	151 Å²	151	114.2 Å²	114.2	59%	0.592	66%	0.657	S	S	*	*			trans	-83.1	75.1	174.9	-58.3	-64.9	0	0	108.2	A13	A13-Y15 VanDerWaalsContact O-CD2 3.3Å; A13-Y15 VanDerWaalsContact O-N 3.07Å; A13-Y15 PolarHBondContact O-N 2.94Å; A13-Y15 WeakPolarHBondContact O-CE2 3.47Å; A13-Y15 WeakPolarHBondContact O-CD2 2.98Å; A13-Y15 HydrophobicContact CB-CG 4.43Å; A13-Y15 HydrophobicContact CB-CE2 3.63Å; A13-Y15 HydrophobicContact CB-CD2 3.33Å
16	G	71	Confident	66	Low	56 Å²	56	116.8 Å²	116.8	58%	0.577	66%	0.664	S	S	*	*			trans	-56.3	161.1	162.9	0	0	0	0	110.7	G14 Q18	G14-G16 PolarHBondContact O-N 3.41Å; G16-Q18 PolarHBondContact O-N 3.45Å
17	E	70.2	Confident	66.6	Low	158 Å²	158	118.7 Å²	118.7	74%	0.738	67%	0.665	S	S	*	*			trans	-49.2	115.7	-179.2	-50.2	-59.3	155.8	0	110.4	E19	E17-E19 PolarHBondContact O-N 2.96Å
18	Q	72.5	Confident	67.2	Low	155 Å²	155	118.1 Å²	118.1	72%	0.724	67%	0.665	S	S	*	*			trans	-81.1	100.1	174.4	-69.8	-178.9	19.1	0	107.7	G16 L20	G16-Q18 PolarHBondContact O-N 3.45Å; Q18-L20 PolarHBondContact O-N 3.31Å; Q18-L20 VanDerWaalsContact O-N 3.13Å
19	E	73.9	Confident	67.5	Low	186 Å²	186	123.8 Å²	123.8	87%	0.869	69%	0.69	S	S	*	*			trans	-65.3	111.5	173.5	-64.6	178.7	-172.2	0	108.8	E17 D21	E17-E19 PolarHBondContact O-N 2.96Å; E19-D21 PolarHBondContact O-N 3.06Å
20	L	70.3	Confident	67.9	Low	154 Å²	154	121.3 Å²	121.3	81%	0.806	69%	0.685	S	S	*	*			trans	-71.7	124.7	173.3	-65.3	174.6	0	0	108.7	Q18 A22	Q18-L20 PolarHBondContact O-N 3.31Å; Q18-L20 VanDerWaalsContact O-N 3.13Å; L20-A22 PolarHBondContact O-N 2.98Å
21	D	76.7	Confident	68.3	Low	96 Å²	96	126 Å²	126	51%	0.513	70%	0.701	S	S	.	*			trans	-64.2	125.3	172.6	-177.4	4.5	0	0	109.1	E19 N23 S24	E19-D21 PolarHBondContact O-N 3.06Å; D21-N23 PolarHBondContact OD2-ND2 3.13Å; D21-N23 PolarHBondContact OD1-ND2 2.87Å; D21-N23 PolarHBondContact OD1-N 3.12Å; D21-N23 VanDerWaalsContact O-N 3.07Å; D21-N23 PolarHBondContact O-N 2.7Å; D21-N23 VanDerWaalsContact OD1-N 3.08Å; D21-S24 WeakPolarHBondContact O-CB 3.36Å; D21-S24 PolarHBondContact O-N 2.92Å; D21-S24 PolarHBondContact O-OG 3.08Å
22	A	72.6	Confident	68.4	Low	77 Å²	77	130.8 Å²	130.8	64%	0.636	72%	0.718	S	S	*	*	G	3₁₀ helix	trans	-57	-23.5	178	0	0	0	0	112.6	L20 S24 A25	L20-A22 PolarHBondContact O-N 2.98Å; A22-S24 VanDerWaalsContact C-N 3.27Å; A22-S24 PolarHBondContact O-N 3.07Å; A22-A25 PolarHBondContact O-N 2.67Å
23	N	71.2	Confident	68.5	Low	129 Å²	129	126.6 Å²	126.6	69%	0.69	71%	0.71	S	S	*	*	G	3₁₀ helix	trans	-70.2	-21.6	176.9	-58.2	-43.7	0	0	113.3	D21	D21-N23 PolarHBondContact OD2-ND2 3.13Å; D21-N23 PolarHBondContact OD1-ND2 2.87Å; D21-N23 PolarHBondContact OD1-N 3.12Å; D21-N23 VanDerWaalsContact O-N 3.07Å; D21-N23 PolarHBondContact O-N 2.7Å; D21-N23 VanDerWaalsContact OD1-N 3.08Å
24	S	65.1	Low	68.1	Low	75 Å²	75	130.1 Å²	130.1	52%	0.524	73%	0.726	S	S	.	*	G	3₁₀ helix	trans	-79.8	-17.3	179.6	68.3	0	0	0	113.9	D21 A22 L26	D21-S24 WeakPolarHBondContact O-CB 3.36Å; D21-S24 PolarHBondContact O-N 2.92Å; D21-S24 PolarHBondContact O-OG 3.08Å; A22-S24 VanDerWaalsContact C-N 3.27Å; A22-S24 PolarHBondContact O-N 3.07Å; S24-L26 VanDerWaalsContact C-N 3.28Å; S24-L26 PolarHBondContact O-N 2.85Å
25	A	64.9	Low	68.1	Low	90 Å²	90	133.5 Å²	133.5	74%	0.744	73%	0.733	S	S	*	*	G	3₁₀ helix	trans	-76.7	-13	-177.9	0	0	0	0	113.9	A22	A22-A25 PolarHBondContact O-N 2.67Å
26	L	70.4	Confident	68.1	Low	140 Å²	140	130.2 Å²	130.2	73%	0.733	73%	0.733	S	S	*	*	G	3₁₀ helix	trans	-102.9	31.5	-170.8	-100.7	166.7	0	0	113.5	S24 E28	S24-L26 VanDerWaalsContact C-N 3.28Å; S24-L26 PolarHBondContact O-N 2.85Å; L26-E28 PolarHBondContact O-N 3.18Å
27	M	71.1	Confident	67.7	Low	170 Å²	170	132 Å²	132	84%	0.837	73%	0.734	S	S	*	*			trans	-79.9	81.1	172.1	-150.7	173.1	-65.4	0	108.8	L29	M27-L29 PolarHBondContact O-N 2.92Å
28	E	72.3	Confident	67.4	Low	165 Å²	165	130.1 Å²	130.1	77%	0.771	73%	0.733	S	S	*	*			trans	-54.8	125.5	179	55	-169.4	-168.6	0	111.5	L26 D30	L26-E28 PolarHBondContact O-N 3.18Å; E28-D30 PolarHBondContact O-N 2.77Å
29	L	69.9	Low	67.2	Low	182 Å²	182	131.4 Å²	131.4	95%	0.953	74%	0.736	S	S	*	*			trans	-72.4	91.4	174.1	-66.8	167.3	0	0	108.3	M27	M27-L29 PolarHBondContact O-N 2.92Å
30	D	69.8	Low	66.8	Low	135 Å²	135	131.1 Å²	131.1	72%	0.722	74%	0.735	S	S	*	*			trans	-114.2	111.2	169.1	-152.8	24.7	0	0	110.1	E28	E28-D30 PolarHBondContact O-N 2.77Å
31	K	64	Low	66.1	Low	194 Å²	194	130.6 Å²	130.6	84%	0.843	73%	0.733	S	S	*	*	S	Bend	trans	-172.2	0.1	153.5	-109.5	169.3	-162.2	179.8	117.8
32	D	64.2	Low	65.2	Low	167 Å²	167	135.4 Å²	135.4	89%	0.893	77%	0.766	S	S	*	*			trans	-123.4	26.5	-178.3	-63.4	-35	0	0	114.4
33	G	62.7	Low	64.8	Low	61 Å²	61	138.4 Å²	138.4	63%	0.629	77%	0.773	S	S	*	*	S	Bend	trans	-100.6	103	172.8	0	0	0	0	112
34	V	55.1	Low	64.5	Low	122 Å²	122	138.8 Å²	138.8	74%	0.739	78%	0.777	S	S	*	*			trans	101.8	64.9	166.4	-165	0	0	0	114.5	S36	V34-S36 PolarHBondContact O-N 3.07Å; V34-S36 VanDerWaalsContact O-N 3.09Å; V34-S36 WeakPolarHBondContact CG1-OG 3.43Å
35	T	59.7	Low	64.4	Low	141 Å²	141	142.4 Å²	142.4	87%	0.865	79%	0.791	S	S	*	*			trans	-71.7	80.8	141.2	48.1	0	0	0	108	P37	T35-P37 WeakPolarHBondContact O-CD 3.3Å
36	S	61.6	Low	64.4	Low	82 Å²	82	145.5 Å²	145.5	57%	0.573	79%	0.794	S	S	*	*			trans	-59.2	117.9	166	-69.2	0	0	0	108.2	V34 V38	V34-S36 PolarHBondContact O-N 3.07Å; V34-S36 VanDerWaalsContact O-N 3.09Å; V34-S36 WeakPolarHBondContact CG1-OG 3.43Å; S36-V38 PolarHBondContact O-N 3.22Å
37	P	63.4	Low	64	Low	93 Å²	93	145.8 Å²	145.8	60%	0.604	80%	0.798	S	S	*	*			trans	-66.1	109.2	169.2	26.2	-30.1	0	0	107.6	T35 F39	T35-P37 WeakPolarHBondContact O-CD 3.3Å; P37-F39 HydrophobicContact CB-CD2 4.29Å; P37-F39 HydrophobicContact CB-CE2 3.93Å; P37-F39 HydrophobicContact CB-CZ 4.25Å; P37-F39 HydrophobicContact CG-CD2 4.26Å; P37-F39 HydrophobicContact CG-CE2 3.64Å; P37-F39 HydrophobicContact CG-CZ 4.2Å; P37-F39 PolarHBondContact O-N 3.49Å
38	V	64.6	Low	63.6	Low	118 Å²	118	144.2 Å²	144.2	72%	0.715	80%	0.795	S	S	*	*			trans	-69	91.5	166.2	-178.5	0	0	0	106.2	S36 Q40	S36-V38 PolarHBondContact O-N 3.22Å; V38-Q40 VanDerWaalsContact C-N 3.28Å; V38-Q40 HydrophobicContact CG1-CG 3.73Å; V38-Q40 PolarHBondContact O-N 3.01Å
39	F	67.4	Low	62.9	Low	182 Å²	182	142.7 Å²	142.7	80%	0.798	80%	0.797	S	S	*	*			trans	-67.2	93.2	164.3	-67.9	-79.5	0	0	107.3	P37 N41	P37-F39 HydrophobicContact CB-CD2 4.29Å; P37-F39 HydrophobicContact CB-CE2 3.93Å; P37-F39 HydrophobicContact CB-CZ 4.25Å; P37-F39 HydrophobicContact CG-CD2 4.26Å; P37-F39 HydrophobicContact CG-CE2 3.64Å; P37-F39 HydrophobicContact CG-CZ 4.2Å; P37-F39 PolarHBondContact O-N 3.49Å; F39-N41 PolarHBondContact O-N 3.07Å
40	Q	65.8	Low	62.4	Low	180 Å²	180	139.7 Å²	139.7	84%	0.841	79%	0.785	S	S	*	*			trans	-73.1	103.2	164.1	-66.4	-142.2	32.3	0	107.4	V38	V38-Q40 VanDerWaalsContact C-N 3.28Å; V38-Q40 HydrophobicContact CG1-CG 3.73Å; V38-Q40 PolarHBondContact O-N 3.01Å
41	N	55.8	Low	61.8	Low	144 Å²	144	140.1 Å²	140.1	77%	0.77	79%	0.79	S	S	*	*			trans	-83.5	112.3	173.3	-175.6	83.2	0	0	109.1	F39	F39-N41 PolarHBondContact O-N 3.07Å
42	T	57.1	Low	61.6	Low	197 Å²	197	135.2 Å²	135.2	100%	1.209	79%	0.785	S	S	*	*			trans	44.3	0	157.2	-38.6	0	0	0	118.5

Retrieved 42 of 42 residues in 44.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).