A0A087X1T8_HUMAN Loading...

Asparaginase and isoaspartyl peptidase 1

AlphaFold DB , UniProt , Accession A0A087X1T8, Species HUMAN (Homo sapiens, Human), Gene ASRGL1, Length 56 aa.

						>A0A087X1T8_HUMAN|A0A087X1T8|ASRGL1
IPGEKLVTERNKKRLEKEKHEKGAQKTDCQKFFRGHKLTTRLTVDVLGNLSSTCSQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	I	61.5	Low	75.2	Confident	165 Å²	165	115.7 Å²	115.7	85%	0.846	59%	0.591	S	S	*	*				0	126.1	0	-59	169.8	0	0	0	106.8	G3 K5 L6	I1-G3 PolarHBondContact O-N 3.21Å; I1-K5 HydrophobicContact CG2-CB 4.05Å; I1-L6 HydrophobicContact CB-CD1 4.39Å; I1-L6 HydrophobicContact CB-CD2 4.48Å; I1-L6 HydrophobicContact CB-CG 4.5Å; I1-L6 HydrophobicContact CD1-CD2 4.5Å; I1-L6 HydrophobicContact CG2-CD1 4.3Å; I1-L6 HydrophobicContact CG2-CD2 3.85Å; I1-L6 HydrophobicContact CG2-CG 3.89Å
2	P	71.2	Confident	75.9	Confident	72 Å²	72	114.2 Å²	114.2	47%	0.468	58%	0.577	S	S	.	*			trans	-56.6	136	178.6	-19.8	30	0	0	0	110.5	E4 K5	P2-E4 PolarHBondContact O-N 3.46Å; P2-K5 HydrophobicContact CB-CG 4.32Å; P2-K5 HydrophobicContact CG-CD 4.17Å; P2-K5 HydrophobicContact CG-CG 4.36Å; P2-K5 WeakPolarHBondContact O-CB 3.46Å; P2-K5 PolarHBondContact O-N 2.93Å
3	G	69.1	Low	76.6	Confident	46 Å²	46	118.2 Å²	118.2	47%	0.474	59%	0.589	S	S	.	*	G	3₁₀ helix	trans	-55.4	-36.6	-177.1	0	0	0	0	0	112.9	I1 K5 L6 V7	I1-G3 PolarHBondContact O-N 3.21Å; G3-K5 PolarHBondContact O-N 3.12Å; G3-L6 WeakPolarHBondContact O-CB 3.44Å; G3-L6 PolarHBondContact O-N 3.48Å; G3-V7 WeakPolarHBondContact O-CG2 3.46Å; G3-V7 PolarHBondContact O-N 3.22Å; G3-V7 VanDerWaalsContact O-N 3.12Å
4	E	73.9	Confident	77	Confident	167 Å²	167	121.9 Å²	121.9	78%	0.78	59%	0.592	S	S	*	*	G	3₁₀ helix	trans	-62.8	-24.7	176	-73.8	121.2	148.7	0	0	114.2	P2 L6	P2-E4 PolarHBondContact O-N 3.46Å; E4-L6 VanDerWaalsContact C-N 3.26Å; E4-L6 PolarHBondContact O-N 2.96Å
5	K	68.3	Low	77.3	Confident	165 Å²	165	120.1 Å²	120.1	72%	0.717	59%	0.586	S	S	*	*	G	3₁₀ helix	trans	-78.4	-12.5	174.6	-62.4	-168	-176.8	-175.1	0	112.9	I1 P2 G3	I1-K5 HydrophobicContact CG2-CB 4.05Å; P2-K5 HydrophobicContact CB-CG 4.32Å; P2-K5 HydrophobicContact CG-CD 4.17Å; P2-K5 HydrophobicContact CG-CG 4.36Å; P2-K5 WeakPolarHBondContact O-CB 3.46Å; P2-K5 PolarHBondContact O-N 2.93Å; G3-K5 PolarHBondContact O-N 3.12Å
6	L	72.1	Confident	77.5	Confident	102 Å²	102	121.6 Å²	121.6	53%	0.534	59%	0.591	S	S	.	*	T	Hydrogen-bonded Turn	trans	-101.6	-20.4	178.7	-59.5	172.5	0	0	0	112.1	I1 G3 E4 T8	I1-L6 HydrophobicContact CB-CD1 4.39Å; I1-L6 HydrophobicContact CB-CD2 4.48Å; I1-L6 HydrophobicContact CB-CG 4.5Å; I1-L6 HydrophobicContact CD1-CD2 4.5Å; I1-L6 HydrophobicContact CG2-CD1 4.3Å; I1-L6 HydrophobicContact CG2-CD2 3.85Å; I1-L6 HydrophobicContact CG2-CG 3.89Å; G3-L6 WeakPolarHBondContact O-CB 3.44Å; G3-L6 PolarHBondContact O-N 3.48Å; E4-L6 VanDerWaalsContact C-N 3.26Å; E4-L6 PolarHBondContact O-N 2.96Å; L6-T8 PolarHBondContact O-N 2.91Å
7	V	78.4	Confident	77.4	Confident	75 Å²	75	123.5 Å²	123.5	46%	0.455	60%	0.596	S	S	.	*			trans	-82.9	100.5	175.5	-178.6	0	0	0	0	109.2	G3 K12	G3-V7 WeakPolarHBondContact O-CG2 3.46Å; G3-V7 PolarHBondContact O-N 3.22Å; G3-V7 VanDerWaalsContact O-N 3.12Å; V7-K12 HydrophobicContact CG1-CD 4.16Å; V7-K12 VanDerWaalsContact CG1-CE 3.49Å; V7-K12 HydrophobicContact CG1-CG 3.61Å
8	T	84.6	Confident	77.3	Confident	70 Å²	70	121.9 Å²	121.9	43%	0.429	59%	0.588	S	S	.	*			trans	-86.7	154.5	171	63.2	0	0	0	0	110.8	L6 R10 N11 K12	L6-T8 PolarHBondContact O-N 2.91Å; T8-R10 PolarHBondContact O-N 3.09Å; T8-R10 VanDerWaalsContact O-N 3.14Å; T8-N11 WeakPolarHBondContact O-CA 3.47Å; T8-N11 WeakPolarHBondContact O-CB 3.49Å; T8-N11 PolarHBondContact O-N 3.14Å; T8-N11 PolarHBondContact OG1-N 3.3Å; T8-K12 PolarHBondContact O-N 3.28Å; T8-K12 VanDerWaalsContact O-N 3.09Å
9	E	83.8	Confident	77	Confident	136 Å²	136	123.1 Å²	123.1	64%	0.636	59%	0.589	S	S	*	*	H	α-helix	trans	-54.5	-32.7	173.5	-70.8	-60.3	103.8	0	0	112.3	K12 K13	E9-K12 PolarHBondContact O-N 2.91Å; E9-K12 WeakPolarHBondContact OE1-CD 3.36Å; E9-K12 WeakPolarHBondContact OE1-CE 3.36Å; E9-K12 IonicContact OE1-NZ 2.72Å; E9-K12 PolarHBondContact OE1-NZ 2.96Å; E9-K13 PolarHBondContact O-N 2.96Å; E9-K13 VanDerWaalsContact O-N 3.09Å
10	R	82.3	Confident	76.4	Confident	195 Å²	195	124.4 Å²	124.4	74%	0.736	60%	0.595	S	S	*	*	H	α-helix	trans	-64.3	-40.4	174	-172.7	176.5	-178.4	172.7	0.8	112.5	T8 R14	T8-R10 PolarHBondContact O-N 3.09Å; T8-R10 VanDerWaalsContact O-N 3.14Å; R10-R14 WeakPolarHBondContact O-CG 3.33Å; R10-R14 PolarHBondContact O-N 2.72Å; R10-R14 VanDerWaalsContact O-N 3.17Å
11	N	81.7	Confident	75.8	Confident	80 Å²	80	125 Å²	125	43%	0.428	60%	0.597	S	S	.	*	H	α-helix	trans	-69.1	-38.1	177.1	-80.3	-16.5	0	0	0	111.6	T8 R14 L15	T8-N11 WeakPolarHBondContact O-CA 3.47Å; T8-N11 WeakPolarHBondContact O-CB 3.49Å; T8-N11 PolarHBondContact O-N 3.14Å; T8-N11 PolarHBondContact OG1-N 3.3Å; N11-R14 PolarHBondContact O-N 3.08Å; N11-L15 WeakPolarHBondContact O-CB 3.44Å; N11-L15 PolarHBondContact O-N 3.11Å
12	K	84.2	Confident	75.9	Confident	97 Å²	97	122.4 Å²	122.4	42%	0.422	58%	0.579	S	S	.	*	H	α-helix	trans	-59.9	-48.7	174.5	-64.1	-177.5	-171	165.5	0	111.5	V7 T8 E9 R14 L15 E16	V7-K12 HydrophobicContact CG1-CD 4.16Å; V7-K12 VanDerWaalsContact CG1-CE 3.49Å; V7-K12 HydrophobicContact CG1-CG 3.61Å; T8-K12 PolarHBondContact O-N 3.28Å; T8-K12 VanDerWaalsContact O-N 3.09Å; E9-K12 PolarHBondContact O-N 2.91Å; E9-K12 WeakPolarHBondContact OE1-CD 3.36Å; E9-K12 WeakPolarHBondContact OE1-CE 3.36Å; E9-K12 IonicContact OE1-NZ 2.72Å; E9-K12 PolarHBondContact OE1-NZ 2.96Å; K12-R14 VanDerWaalsContact C-N 3.32Å; K12-R14 PolarHBondContact O-N 3.21Å; K12-L15 WeakPolarHBondContact O-CB 3.43Å; K12-L15 PolarHBondContact O-N 3.39Å; K12-L15 VanDerWaalsContact O-N 3.11Å; K12-E16 PolarHBondContact O-N 3.17Å
13	K	84.7	Confident	75.2	Confident	167 Å²	167	120.7 Å²	120.7	73%	0.726	58%	0.575	S	S	*	*	H	α-helix	trans	-63.3	-35.9	-179.4	-155.9	173.6	-171.1	177.2	0	113.1	E9 K17	E9-K13 PolarHBondContact O-N 2.96Å; E9-K13 VanDerWaalsContact O-N 3.09Å; K13-K17 PolarHBondContact O-N 3.03Å
14	R	82.8	Confident	74.5	Confident	170 Å²	170	121.7 Å²	121.7	64%	0.642	58%	0.579	S	S	*	*	H	α-helix	trans	-67.4	-42.2	173.2	-75.1	180	71.3	179	3.3	111.8	R10 N11 K12 E16 K17 E18	R10-R14 WeakPolarHBondContact O-CG 3.33Å; R10-R14 PolarHBondContact O-N 2.72Å; R10-R14 VanDerWaalsContact O-N 3.17Å; N11-R14 PolarHBondContact O-N 3.08Å; K12-R14 VanDerWaalsContact C-N 3.32Å; K12-R14 PolarHBondContact O-N 3.21Å; R14-E16 PolarHBondContact O-N 2.76Å; R14-K17 PolarHBondContact O-N 3.43Å; R14-E18 PolarHBondContact O-N 2.98Å
15	L	81.1	Confident	73.5	Confident	94 Å²	94	120.9 Å²	120.9	49%	0.492	58%	0.575	S	S	.	*	H	α-helix	trans	-62.8	-41	179.6	-175.8	63.8	0	0	0	112	N11 K12 E18 K19	N11-L15 WeakPolarHBondContact O-CB 3.44Å; N11-L15 PolarHBondContact O-N 3.11Å; K12-L15 WeakPolarHBondContact O-CB 3.43Å; K12-L15 PolarHBondContact O-N 3.39Å; K12-L15 VanDerWaalsContact O-N 3.11Å; L15-E18 PolarHBondContact O-N 3.35Å; L15-K19 WeakPolarHBondContact O-CG 3.41Å; L15-K19 PolarHBondContact O-N 2.8Å
16	E	79.6	Confident	72.7	Confident	144 Å²	144	120.6 Å²	120.6	67%	0.673	57%	0.574	S	S	*	*	H	α-helix	trans	-65.1	-41.7	176.6	-67.9	-165	112.1	0	0	112.5	K12 R14 K19 H20	K12-E16 PolarHBondContact O-N 3.17Å; R14-E16 PolarHBondContact O-N 2.76Å; E16-K19 PolarHBondContact O-N 2.86Å; E16-H20 PolarHBondContact O-N 2.71Å
17	K	77.3	Confident	71.8	Confident	154 Å²	154	120 Å²	120	67%	0.67	57%	0.574	S	S	*	*	H	α-helix	trans	-63	-43.6	176.4	-167.6	-178.5	178.4	-173.5	0	112	K13 R14 H20 E21	K13-K17 PolarHBondContact O-N 3.03Å; R14-K17 PolarHBondContact O-N 3.43Å; K17-H20 PolarHBondContact O-N 3.4Å; K17-E21 PolarHBondContact O-N 2.92Å; K17-E21 VanDerWaalsContact O-N 3.08Å
18	E	74.1	Confident	70.4	Confident	96 Å²	96	122.5 Å²	122.5	45%	0.449	59%	0.585	S	S	.	*	H	α-helix	trans	-65.9	-39	179.2	-167.5	-174.3	113.2	0	0	112.2	R14 L15 H20 E21 K22	R14-E18 PolarHBondContact O-N 2.98Å; L15-E18 PolarHBondContact O-N 3.35Å; E18-H20 VanDerWaalsContact C-N 3.31Å; E18-H20 PolarHBondContact O-N 3.09Å; E18-E21 PolarHBondContact O-N 3.39Å; E18-K22 HydrophobicContact CG-CD 4.07Å; E18-K22 HydrophobicContact CG-CG 4.43Å; E18-K22 WeakPolarHBondContact O-CB 3.34Å; E18-K22 PolarHBondContact O-N 3.33Å; E18-K22 WeakPolarHBondContact OE1-CE 3.44Å; E18-K22 IonicContact OE1-NZ 2.71Å; E18-K22 PolarHBondContact OE1-NZ 3.01Å
19	K	72.4	Confident	68.8	Low	143 Å²	143	123 Å²	123	62%	0.622	59%	0.59	S	S	*	*	H	α-helix	trans	-61.3	-39.4	174.8	-77.8	-178.1	178.2	-171	0	112.2	L15 E16 G23	L15-K19 WeakPolarHBondContact O-CG 3.41Å; L15-K19 PolarHBondContact O-N 2.8Å; E16-K19 PolarHBondContact O-N 2.86Å; K19-G23 WeakPolarHBondContact O-CA 3.43Å; K19-G23 PolarHBondContact O-N 2.91Å
20	H	65.8	Low	67.2	Low	150 Å²	150	124.2 Å²	124.2	69%	0.694	60%	0.596	S	S	*	*	H	α-helix	trans	-67.8	-46.2	178	-162.3	162.4	0	0	0	111.1	E16 K17 E18 G23 A24	E16-H20 PolarHBondContact O-N 2.71Å; K17-H20 PolarHBondContact O-N 3.4Å; E18-H20 VanDerWaalsContact C-N 3.31Å; E18-H20 PolarHBondContact O-N 3.09Å; H20-G23 PolarHBondContact O-N 3.33Å; H20-A24 PolarHBondContact O-N 3.18Å
21	E	63.9	Low	65.7	Low	136 Å²	136	123.2 Å²	123.2	64%	0.636	60%	0.597	S	S	*	*	H	α-helix	trans	-65.4	-45.9	-179.7	-166.5	175	93.4	0	0	112.3	K17 E18 G23 A24 Q25	K17-E21 PolarHBondContact O-N 2.92Å; K17-E21 VanDerWaalsContact O-N 3.08Å; E18-E21 PolarHBondContact O-N 3.39Å; E21-G23 VanDerWaalsContact C-N 3.26Å; E21-G23 PolarHBondContact O-N 3.48Å; E21-A24 PolarHBondContact O-N 2.91Å; E21-Q25 PolarHBondContact O-N 3.44Å
22	K	62	Low	64.4	Low	111 Å²	111	127.4 Å²	127.4	48%	0.483	61%	0.612	S	S	.	*	H	α-helix	trans	-67	-27.4	172.7	-72.6	-179.3	177.1	170.9	0	112.6	E18 K26	E18-K22 HydrophobicContact CG-CD 4.07Å; E18-K22 HydrophobicContact CG-CG 4.43Å; E18-K22 WeakPolarHBondContact O-CB 3.34Å; E18-K22 PolarHBondContact O-N 3.33Å; E18-K22 WeakPolarHBondContact OE1-CE 3.44Å; E18-K22 IonicContact OE1-NZ 2.71Å; E18-K22 PolarHBondContact OE1-NZ 3.01Å; K22-K26 WeakPolarHBondContact O-CG 3.39Å
23	G	56.6	Low	62.9	Low	37 Å²	37	126.7 Å²	126.7	38%	0.381	61%	0.609	S	S	.	*	H	α-helix	trans	-66.7	-43.8	174	0	0	0	0	0	112.2	K19 H20 E21 Q25 K26	K19-G23 WeakPolarHBondContact O-CA 3.43Å; K19-G23 PolarHBondContact O-N 2.91Å; H20-G23 PolarHBondContact O-N 3.33Å; E21-G23 VanDerWaalsContact C-N 3.26Å; E21-G23 PolarHBondContact O-N 3.48Å; G23-Q25 VanDerWaalsContact C-N 3.33Å; G23-Q25 PolarHBondContact O-N 3.3Å; G23-K26 PolarHBondContact O-N 3.05Å
24	A	54.1	Low	61.3	Low	66 Å²	66	130.7 Å²	130.7	55%	0.545	62%	0.619	S	S	.	*	H	α-helix	trans	-66.8	-34	177.1	0	0	0	0	0	112.6	H20 E21 K26 T27	H20-A24 PolarHBondContact O-N 3.18Å; E21-A24 PolarHBondContact O-N 2.91Å; A24-K26 VanDerWaalsContact C-N 3.32Å; A24-K26 PolarHBondContact O-N 3.47Å; A24-T27 PolarHBondContact O-OG1 3.32Å
25	Q	53.9	Low	60.1	Low	150 Å²	150	126.1 Å²	126.1	70%	0.701	63%	0.625	S	S	*	*	H	α-helix	trans	-74.7	-16.3	-178.6	-150.6	179.1	50.1	0	0	114.1	E21 G23 T27	E21-Q25 PolarHBondContact O-N 3.44Å; G23-Q25 VanDerWaalsContact C-N 3.33Å; G23-Q25 PolarHBondContact O-N 3.3Å; Q25-T27 VanDerWaalsContact C-N 3.25Å; Q25-T27 PolarHBondContact O-N 3.42Å
26	K	52.3	Low	58.9	Low	160 Å²	160	127.2 Å²	127.2	70%	0.696	63%	0.627	S	S	*	*	H	α-helix	trans	-69.7	-20.8	177.6	-77.4	176.9	-178.8	-171.2	0	113.7	K22 G23 A24	K22-K26 WeakPolarHBondContact O-CG 3.39Å; G23-K26 PolarHBondContact O-N 3.05Å; A24-K26 VanDerWaalsContact C-N 3.32Å; A24-K26 PolarHBondContact O-N 3.47Å
27	T	51.4	Low	57.6	Low	89 Å²	89	129.2 Å²	129.2	55%	0.546	63%	0.634	S	S	.	*	H	α-helix	trans	-74.7	-23.6	-175.5	-15.1	0	0	0	0	113.6	A24 Q25	A24-T27 PolarHBondContact O-OG1 3.32Å; Q25-T27 VanDerWaalsContact C-N 3.25Å; Q25-T27 PolarHBondContact O-N 3.42Å
28	D	49.9	Very low	56.7	Low	128 Å²	128	123.9 Å²	123.9	68%	0.684	61%	0.612	S	S	*	*	H	α-helix	trans	-81.6	-34.4	-176.7	-128.2	-93.2	0	0	0	112.3	Q30 K31	D28-Q30 VanDerWaalsContact C-N 3.32Å; D28-Q30 PolarHBondContact O-N 3.49Å; D28-K31 PolarHBondContact O-N 3.33Å
29	C	50.1	Low	56.3	Low	79 Å²	79	123.7 Å²	123.7	53%	0.534	62%	0.618	S	S	.	*	H	α-helix	trans	-63.9	-37.7	179.3	-133.7	0	0	0	0	111.6	K31 F32 F33	C29-K31 VanDerWaalsContact C-N 3.29Å; C29-K31 PolarHBondContact O-N 2.95Å; C29-F32 PolarHBondContact O-N 2.95Å; C29-F33 HydrophobicContact CB-CE2 4.31Å; C29-F33 WeakPolarHBondContact O-CD2 3.44Å; C29-F33 WeakPolarHBondContact O-CE2 3.37Å
30	Q	50.6	Low	56.3	Low	162 Å²	162	120.4 Å²	120.4	76%	0.757	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.6	-19.9	-172.2	-150.9	172.6	69.2	0	0	114.1	D28	D28-Q30 VanDerWaalsContact C-N 3.32Å; D28-Q30 PolarHBondContact O-N 3.49Å
31	K	51.4	Low	56.8	Low	174 Å²	174	121.8 Å²	121.8	76%	0.757	61%	0.609	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.8	-21.2	179.3	-70.1	-177.7	-178.2	174.9	0	113.3	D28 C29	D28-K31 PolarHBondContact O-N 3.33Å; C29-K31 VanDerWaalsContact C-N 3.29Å; C29-K31 PolarHBondContact O-N 2.95Å
32	F	53.4	Low	57.7	Low	169 Å²	169	120.8 Å²	120.8	74%	0.741	61%	0.607	S	S	*	*	S	Bend	trans	-84.3	-11.1	-173.7	-141.4	-92.1	0	0	0	114.4	C29	C29-F32 PolarHBondContact O-N 2.95Å
33	F	54.3	Low	58.8	Low	81 Å²	81	118.4 Å²	118.4	36%	0.355	60%	0.602	S	S	.	*			trans	-102.4	18.6	-166.7	-59.2	-61.6	0	0	0	116.3	C29 G35 L38	C29-F33 HydrophobicContact CB-CE2 4.31Å; C29-F33 WeakPolarHBondContact O-CD2 3.44Å; C29-F33 WeakPolarHBondContact O-CE2 3.37Å; F33-G35 PolarHBondContact O-N 2.99Å; F33-L38 HydrophobicContact CD1-CB 4.03Å; F33-L38 HydrophobicContact CD1-CD1 3.67Å; F33-L38 HydrophobicContact CD1-CG 4.29Å; F33-L38 HydrophobicContact CE1-CB 3.48Å; F33-L38 VanDerWaalsContact CE1-CB 3.48Å; F33-L38 HydrophobicContact CE1-CD1 3.56Å; F33-L38 HydrophobicContact CE1-CD2 3.77Å; F33-L38 HydrophobicContact CE1-CG 3.75Å; F33-L38 HydrophobicContact CZ-CB 4.46Å
34	R	50.4	Low	60.4	Low	252 Å²	252	121.6 Å²	121.6	95%	0.951	61%	0.614	S	S	*	*	S	Bend	trans	-79.5	73.6	168.5	-67.9	-165.7	-161.3	-127.7	5	110.2
35	G	56.5	Low	61.9	Low	73 Å²	73	121.9 Å²	121.9	75%	0.753	61%	0.606	S	S	*	*	S	Bend	trans	134.9	-19.2	164.5	0	0	0	0	0	117	F33	F33-G35 PolarHBondContact O-N 2.99Å
36	H	56.3	Low	63.4	Low	118 Å²	118	122.3 Å²	122.3	55%	0.546	62%	0.619	S	S	.	*			trans	-103.1	123.4	173.2	-95.8	-122.3	0	0	0	110.2	L38	H36-L38 VanDerWaalsContact C-N 3.25Å; H36-L38 HydrophobicContact CB-CD1 3.57Å; H36-L38 PolarHBondContact O-N 3.17Å
37	K	52.5	Low	65.2	Low	185 Å²	185	121.8 Å²	121.8	80%	0.804	62%	0.623	S	S	*	*			trans	-79.5	75.6	174.4	-169.9	172.5	-178.1	178.6	0	109.5	T39	K37-T39 PolarHBondContact O-N 3.39Å
38	L	59.1	Low	66.6	Low	43 Å²	43	120.2 Å²	120.2	23%	0.225	62%	0.624	C	S	.	*			trans	-69.4	125.5	169.5	-78.1	86.7	0	0	0	108.8	F33 H36 C54	F33-L38 HydrophobicContact CD1-CB 4.03Å; F33-L38 HydrophobicContact CD1-CD1 3.67Å; F33-L38 HydrophobicContact CD1-CG 4.29Å; F33-L38 HydrophobicContact CE1-CB 3.48Å; F33-L38 VanDerWaalsContact CE1-CB 3.48Å; F33-L38 HydrophobicContact CE1-CD1 3.56Å; F33-L38 HydrophobicContact CE1-CD2 3.77Å; F33-L38 HydrophobicContact CE1-CG 3.75Å; F33-L38 HydrophobicContact CZ-CB 4.46Å; H36-L38 VanDerWaalsContact C-N 3.25Å; H36-L38 HydrophobicContact CB-CD1 3.57Å; H36-L38 PolarHBondContact O-N 3.17Å; L38-C54 WeakPolarHBondContact CD2-SG 2.99Å
39	T	64.9	Low	68.5	Low	91 Å²	91	118.6 Å²	118.6	56%	0.558	62%	0.615	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-98.8	105.7	171.7	-56.6	0	0	0	0	107.7	K37 S55	K37-T39 PolarHBondContact O-N 3.39Å; T39-S55 PolarHBondContact N-O 3.5Å; T39-S55 PolarHBondContact O-N 2.96Å
40	T	72.1	Confident	70	Confident	74 Å²	74	120.6 Å²	120.6	45%	0.454	62%	0.62	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-91.7	122.6	173	-50.5	0	0	0	0	109.3	T53	T40-T53 WeakPolarHBondContact CA-O 2.91Å
41	R	76.9	Confident	71.6	Confident	179 Å²	179	115.9 Å²	115.9	68%	0.675	61%	0.605	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-102.1	128	171.1	-162.5	178.6	-165.8	-164	3.3	109	S52 T53	R41-S52 WeakPolarHBondContact O-CA 3.38Å; R41-T53 PolarHBondContact N-O 2.85Å; R41-T53 PolarHBondContact O-N 3.36Å
42	L	83.8	Confident	73	Confident	116 Å²	116	111.5 Å²	111.5	61%	0.607	60%	0.597	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-104.2	134.9	174.8	-67.8	163.8	0	0	0	108.6	L50	L42-L50 HydrophobicContact CD2-CD1 4.37Å
43	T	84.1	Confident	73.9	Confident	61 Å²	61	107 Å²	107	37%	0.374	58%	0.583	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-129	140.4	176.6	55.8	0	0	0	0	109.5	S51	T43-S51 PolarHBondContact N-O 3.46Å; T43-S51 PolarHBondContact O-N 3.42Å; T43-S51 PolarHBondContact OG1-O 3.2Å
44	V	89.5	Confident	74.3	Confident	103 Å²	103	107 Å²	107	62%	0.624	59%	0.592	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-122	127.3	174.3	-175.9	0	0	0	0	107.2	N49 L50	V44-N49 WeakPolarHBondContact CA-O 3.49Å; V44-L50 HydrophobicContact CG2-CD1 3.75Å
45	D	85.8	Confident	74.8	Confident	73 Å²	73	98.8 Å²	98.8	39%	0.39	57%	0.573	S	S	.	*			trans	-86.7	172.4	176.5	75.8	9.9	0	0	0	112.1	L47 G48 N49	D45-L47 PolarHBondContact O-N 2.97Å; D45-L47 WeakPolarHBondContact OD1-CA 3.45Å; D45-L47 WeakPolarHBondContact OD1-CB 3.5Å; D45-L47 PolarHBondContact OD1-N 3.37Å; D45-G48 PolarHBondContact O-N 3.37Å; D45-G48 PolarHBondContact OD1-N 3.27Å; D45-N49 PolarHBondContact N-O 3.08Å; D45-N49 VanDerWaalsContact N-O 3.08Å; D45-N49 WeakPolarHBondContact OD1-CB 3.43Å; D45-N49 PolarHBondContact OD1-N 3.34Å; D45-N49 PolarHBondContact OD1-ND2 3.38Å; D45-N49 WeakPolarHBondContact OD2-CB 3.36Å; D45-N49 PolarHBondContact OD2-ND2 3.26Å
46	V	85.9	Confident	74.9	Confident	158 Å²	158	105.1 Å²	105.1	96%	0.958	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.2	-21.7	-179.6	-178.2	0	0	0	0	112.3	G48	V46-G48 VanDerWaalsContact C-N 3.29Å
47	L	91.1	Very high	75.8	Confident	149 Å²	149	104.5 Å²	104.5	78%	0.78	59%	0.585	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.3	-4.6	175.9	-60	175.7	0	0	0	112.2	D45	D45-L47 PolarHBondContact O-N 2.97Å; D45-L47 WeakPolarHBondContact OD1-CA 3.45Å; D45-L47 WeakPolarHBondContact OD1-CB 3.5Å; D45-L47 PolarHBondContact OD1-N 3.37Å
48	G	80.9	Confident	77.1	Confident	56 Å²	56	100.3 Å²	100.3	58%	0.577	57%	0.574	S	S	*	*			trans	84.9	12.8	-179.7	0	0	0	0	0	114.2	D45 V46	D45-G48 PolarHBondContact O-N 3.37Å; D45-G48 PolarHBondContact OD1-N 3.27Å; V46-G48 VanDerWaalsContact C-N 3.29Å
49	N	88	Confident	78.1	Confident	94 Å²	94	103.4 Å²	103.4	50%	0.503	59%	0.593	S	S	.	*			trans	-75	133.2	175.4	-55.2	-50.7	0	0	0	110.1	V44 D45	V44-N49 WeakPolarHBondContact CA-O 3.49Å; D45-N49 PolarHBondContact N-O 3.08Å; D45-N49 VanDerWaalsContact N-O 3.08Å; D45-N49 WeakPolarHBondContact OD1-CB 3.43Å; D45-N49 PolarHBondContact OD1-N 3.34Å; D45-N49 PolarHBondContact OD1-ND2 3.38Å; D45-N49 WeakPolarHBondContact OD2-CB 3.36Å; D45-N49 PolarHBondContact OD2-ND2 3.26Å
50	L	82.7	Confident	78.9	Confident	122 Å²	122	104.2 Å²	104.2	64%	0.639	60%	0.595	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-97.1	123.9	176.8	-177.7	68.6	0	0	0	109.8	L42 V44	L42-L50 HydrophobicContact CD2-CD1 4.37Å; V44-L50 HydrophobicContact CG2-CD1 3.75Å
51	S	83.8	Confident	79.3	Confident	62 Å²	62	106.1 Å²	106.1	43%	0.434	60%	0.604	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-122.6	142.2	173.6	174.1	0	0	0	0	110.4	T43	T43-S51 PolarHBondContact N-O 3.46Å; T43-S51 PolarHBondContact O-N 3.42Å; T43-S51 PolarHBondContact OG1-O 3.2Å
52	S	81.8	Confident	79.4	Confident	83 Å²	83	101.2 Å²	101.2	58%	0.58	60%	0.599	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-123.2	138.1	175.5	65.5	0	0	0	0	110.8	R41	R41-S52 WeakPolarHBondContact O-CA 3.38Å
53	T	72.7	Confident	79.1	Confident	75 Å²	75	100.1 Å²	100.1	46%	0.46	60%	0.599	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-119.3	133	170.3	60.3	0	0	0	0	109.1	T40 R41	T40-T53 WeakPolarHBondContact CA-O 2.91Å; R41-T53 PolarHBondContact N-O 2.85Å; R41-T53 PolarHBondContact O-N 3.36Å
54	C	61	Low	78.7	Confident	81 Å²	81	103.2 Å²	103.2	55%	0.547	62%	0.616	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-115.4	123.1	179.7	-165.2	0	0	0	0	109.5	L38	L38-C54 WeakPolarHBondContact CD2-SG 2.99Å
55	S	61.7	Low	77.8	Confident	79 Å²	79	103.2 Å²	103.2	55%	0.552	62%	0.615	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-117.2	135.5	173.3	-63.4	0	0	0	0	109.9	T39	T39-S55 PolarHBondContact N-O 3.5Å; T39-S55 PolarHBondContact O-N 2.96Å
56	Q	58.8	Low	77.1	Confident	206 Å²	206	105.9 Å²	105.9	96%	0.963	64%	0.636	S	S	*	*			trans	-90.8	0	174.8	-70.6	-177.7	59.2	0	0	110.8

Retrieved 56 of 56 residues in 37.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).