A0A087X1V0_HUMAN Loading...

26S proteasome complex subunit SEM1

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins.

AlphaFold DB , UniProt , Accession A0A087X1V0, Species HUMAN (Homo sapiens, Human), Gene SEM1, Length 89 aa.

						>A0A087X1V0_HUMAN|A0A087X1V0|SEM1
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRHGHASAGLLQEKLLGEEPRWPNRNSSSLQLPA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	34.1	Very low	53.2	Low	243 Å²	243	130.2 Å²	130.2	100%	1.197	69%	0.685	S	S	*	*				0	127.5	0	-68.8	-59.6	-162.3	0	0	107.2
2	S	46.6	Very low	53.5	Low	103 Å²	103	128.9 Å²	128.9	72%	0.72	68%	0.678	S	S	*	*			trans	-50.9	133.1	-158.5	-55.7	0	0	0	0	116.5	K4	S2-K4 PolarHBondContact O-N 3.15Å
3	E	52.4	Low	53.7	Low	144 Å²	144	125.8 Å²	125.8	67%	0.673	66%	0.662	S	S	*	*			trans	-56.1	121.5	151.1	-179	144.5	70.9	0	0	109.5	K5	E3-K5 HydrophobicContact CG-CD 4.29Å; E3-K5 HydrophobicContact CG-CG 4.08Å; E3-K5 IonicContact OE1-NZ 2.85Å; E3-K5 PolarHBondContact OE1-NZ 2.75Å; E3-K5 WeakPolarHBondContact OE2-CE 3.18Å; E3-K5 IonicContact OE2-NZ 3.03Å; E3-K5 PolarHBondContact OE2-NZ 3.19Å
4	K	49.2	Very low	53.8	Low	165 Å²	165	126.6 Å²	126.6	72%	0.717	66%	0.66	S	S	*	*			trans	-127.2	88	160.8	-77.3	-166.2	176.4	82.8	0	106.7	S2 Q6	S2-K4 PolarHBondContact O-N 3.15Å; K4-Q6 VanDerWaalsContact C-N 3.29Å; K4-Q6 PolarHBondContact O-N 2.73Å
5	K	59.2	Low	53.9	Low	162 Å²	162	127.1 Å²	127.1	70%	0.704	66%	0.658	S	S	*	*			trans	-59.5	97.9	161.9	-74.9	162.9	173.6	135.3	0	106.3	E3	E3-K5 HydrophobicContact CG-CD 4.29Å; E3-K5 HydrophobicContact CG-CG 4.08Å; E3-K5 IonicContact OE1-NZ 2.85Å; E3-K5 PolarHBondContact OE1-NZ 2.75Å; E3-K5 WeakPolarHBondContact OE2-CE 3.18Å; E3-K5 IonicContact OE2-NZ 3.03Å; E3-K5 PolarHBondContact OE2-NZ 3.19Å
6	Q	59.8	Low	54	Low	148 Å²	148	127.1 Å²	127.1	69%	0.692	66%	0.659	S	S	*	*			trans	-54.5	132.5	165.4	-66.7	-73.1	-48.1	0	0	106	K4 V8	K4-Q6 VanDerWaalsContact C-N 3.29Å; K4-Q6 PolarHBondContact O-N 2.73Å; Q6-V8 PolarHBondContact O-N 3.14Å
7	P	54.8	Low	54.4	Low	120 Å²	120	128.6 Å²	128.6	78%	0.779	67%	0.669	S	S	*	*			trans	-58.6	109.8	170.4	25.8	-31	0	0	0	106.1	D9	P7-D9 PolarHBondContact O-N 2.77Å
8	V	58.8	Low	55.2	Low	97 Å²	97	130.7 Å²	130.7	59%	0.588	68%	0.675	S	S	*	*			trans	-61.4	120.8	175.3	-174.3	0	0	0	0	105.5	Q6 L10 L13	Q6-V8 PolarHBondContact O-N 3.14Å; V8-L10 PolarHBondContact O-N 2.78Å; V8-L13 HydrophobicContact CB-CD1 4.46Å; V8-L13 HydrophobicContact CG1-CD1 3.66Å; V8-L13 HydrophobicContact CG1-CD2 4.2Å; V8-L13 HydrophobicContact CG1-CG 3.93Å
9	D	55.9	Low	55.8	Low	109 Å²	109	131.8 Å²	131.8	58%	0.583	67%	0.674	S	S	*	*			trans	-65.1	106.5	-179.1	-168.6	11.3	0	0	0	107.7	P7 G11 L12	P7-D9 PolarHBondContact O-N 2.77Å; D9-G11 PolarHBondContact O-N 2.8Å; D9-L12 HydrophobicContact CB-CD1 4.27Å; D9-L12 WeakPolarHBondContact O-CB 3.19Å; D9-L12 PolarHBondContact O-N 3.43Å
10	L	56.5	Low	56.5	Low	112 Å²	112	133.1 Å²	133.1	59%	0.586	68%	0.677	S	S	*	*	H	α-helix	trans	-65	-20.4	-170.8	-63.8	173.3	0	0	0	111.9	V8 L13 E14	V8-L10 PolarHBondContact O-N 2.78Å; L10-L13 HydrophobicContact CD2-CD1 4.08Å; L10-L13 PolarHBondContact O-N 3.41Å; L10-E14 WeakPolarHBondContact O-CG 3.28Å; L10-E14 PolarHBondContact O-N 3.46Å
11	G	57.5	Low	57.1	Low	29 Å²	29	136.1 Å²	136.1	30%	0.299	69%	0.689	S	S	.	*	H	α-helix	trans	-65.9	-35	172.3	0	0	0	0	0	113.4	D9 L13 E14 E15	D9-G11 PolarHBondContact O-N 2.8Å; G11-L13 VanDerWaalsContact C-N 3.27Å; G11-L13 PolarHBondContact O-N 3.29Å; G11-E14 PolarHBondContact O-N 2.94Å; G11-E15 VanDerWaalsContact O-CG 3.28Å; G11-E15 WeakPolarHBondContact O-CG 3.34Å; G11-E15 PolarHBondContact O-N 3.42Å; G11-E15 VanDerWaalsContact O-N 3.11Å
12	L	57.4	Low	58.2	Low	115 Å²	115	131.1 Å²	131.1	60%	0.602	66%	0.661	S	S	*	*	H	α-helix	trans	-72.4	-19.1	174.6	-89.9	160.4	0	0	0	113.2	D9	D9-L12 HydrophobicContact CB-CD1 4.27Å; D9-L12 WeakPolarHBondContact O-CB 3.19Å; D9-L12 PolarHBondContact O-N 3.43Å
13	L	55.4	Low	59.4	Low	88 Å²	88	131.6 Å²	131.6	46%	0.461	66%	0.661	S	S	.	*	H	α-helix	trans	-90.6	-33.6	174.5	-63.6	178.6	0	0	0	111.8	V8 L10 G11 E15 D16	V8-L13 HydrophobicContact CB-CD1 4.46Å; V8-L13 HydrophobicContact CG1-CD1 3.66Å; V8-L13 HydrophobicContact CG1-CD2 4.2Å; V8-L13 HydrophobicContact CG1-CG 3.93Å; L10-L13 HydrophobicContact CD2-CD1 4.08Å; L10-L13 PolarHBondContact O-N 3.41Å; G11-L13 VanDerWaalsContact C-N 3.27Å; G11-L13 PolarHBondContact O-N 3.29Å; L13-E15 VanDerWaalsContact C-N 3.33Å; L13-D16 PolarHBondContact O-N 3.11Å
14	E	55.6	Low	59.8	Low	137 Å²	137	129.5 Å²	129.5	64%	0.64	67%	0.669	S	S	*	*	H	α-helix	trans	-67.2	-33.8	173.8	-73.8	173	-165.1	0	0	111.5	L10 G11 D16 D17	L10-E14 WeakPolarHBondContact O-CG 3.28Å; L10-E14 PolarHBondContact O-N 3.46Å; G11-E14 PolarHBondContact O-N 2.94Å; E14-D16 VanDerWaalsContact C-N 3.29Å; E14-D16 PolarHBondContact O-N 3.24Å; E14-D17 PolarHBondContact O-N 3.26Å
15	E	55.5	Low	60.4	Low	134 Å²	134	128.4 Å²	128.4	63%	0.626	67%	0.666	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.3	-23.4	172.9	-72.9	171.1	-160.4	0	0	113.5	G11 L13	G11-E15 VanDerWaalsContact O-CG 3.28Å; G11-E15 WeakPolarHBondContact O-CG 3.34Å; G11-E15 PolarHBondContact O-N 3.42Å; G11-E15 VanDerWaalsContact O-N 3.11Å; L13-E15 VanDerWaalsContact C-N 3.33Å
16	D	55.4	Low	60.2	Low	127 Å²	127	127.7 Å²	127.7	68%	0.679	67%	0.67	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.3	-21.6	178.9	-154.6	32.3	0	0	0	112.2	L13 E14	L13-D16 PolarHBondContact O-N 3.11Å; E14-D16 VanDerWaalsContact C-N 3.29Å; E14-D16 PolarHBondContact O-N 3.24Å
17	D	60.8	Low	60.1	Low	154 Å²	154	128.8 Å²	128.8	82%	0.824	67%	0.668	S	S	*	*	S	Bend	trans	-87.4	-8.8	171.8	-94.4	-21.7	0	0	0	112.8	E14 F19	E14-D17 PolarHBondContact O-N 3.26Å; D17-F19 VanDerWaalsContact C-N 3.35Å
18	E	69.1	Low	60.1	Low	165 Å²	165	127.1 Å²	127.1	77%	0.771	67%	0.665	S	S	*	*			trans	-94.8	11.8	178.4	-161.5	154.9	-163.6	0	0	112.8
19	F	67	Low	59.8	Low	153 Å²	153	125.6 Å²	125.6	67%	0.671	67%	0.669	S	S	*	*	S	Bend	trans	-71	130.4	167.5	-146.1	-100.7	0	0	0	109.6	D17 E21 F22	D17-F19 VanDerWaalsContact C-N 3.35Å; F19-E21 PolarHBondContact O-N 3.06Å; F19-E21 VanDerWaalsContact O-N 3.14Å; F19-F22 HydrophobicContact CD1-CD2 4.2Å; F19-F22 HydrophobicContact CD1-CE2 4.22Å; F19-F22 AromaticContact CE1-CD2 3.75Å; F19-F22 HydrophobicContact CE1-CD2 3.75Å; F19-F22 AromaticContact CE1-CE2 3.58Å; F19-F22 HydrophobicContact CE1-CE2 3.58Å; F19-F22 HydrophobicContact CZ-CE2 4.22Å
20	E	69.6	Low	59.7	Low	157 Å²	157	126.8 Å²	126.8	73%	0.734	67%	0.674	S	S	*	*			trans	-58.8	121.5	172	-75	-175.5	178.6	0	0	108.6	F22	E20-F22 WeakPolarHBondContact O-CD2 3.48Å; E20-F22 PolarHBondContact O-N 3.18Å
21	E	68.4	Low	59.6	Low	196 Å²	196	126.1 Å²	126.1	92%	0.916	67%	0.671	S	S	*	*			trans	-63.1	88	173.9	-166.3	178.5	-160.8	0	0	107.7	F19	F19-E21 PolarHBondContact O-N 3.06Å; F19-E21 VanDerWaalsContact O-N 3.14Å
22	F	57.6	Low	59.4	Low	138 Å²	138	133.2 Å²	133.2	61%	0.605	70%	0.696	S	S	*	*			trans	-57	137.3	174.9	-78.9	-87.4	0	0	0	107.4	F19 E20 A24	F19-F22 HydrophobicContact CD1-CD2 4.2Å; F19-F22 HydrophobicContact CD1-CE2 4.22Å; F19-F22 AromaticContact CE1-CD2 3.75Å; F19-F22 HydrophobicContact CE1-CD2 3.75Å; F19-F22 AromaticContact CE1-CE2 3.58Å; F19-F22 HydrophobicContact CE1-CE2 3.58Å; F19-F22 HydrophobicContact CZ-CE2 4.22Å; E20-F22 WeakPolarHBondContact O-CD2 3.48Å; E20-F22 PolarHBondContact O-N 3.18Å; F22-A24 PolarHBondContact O-N 3.05Å
23	P	70.5	Confident	59.2	Low	113 Å²	113	133.1 Å²	133.1	73%	0.734	70%	0.696	S	S	*	*			trans	-50.9	133.4	171.9	23.1	-32.1	0	0	0	107.7	E25	P23-E25 VanDerWaalsContact C-N 3.26Å; P23-E25 PolarHBondContact O-N 2.9Å
24	A	61.8	Low	59.2	Low	101 Å²	101	135.9 Å²	135.9	84%	0.835	71%	0.707	S	S	*	*			trans	-57.5	99.8	170.2	0	0	0	0	0	106.6	F22 D26	F22-A24 PolarHBondContact O-N 3.05Å; A24-D26 PolarHBondContact O-N 3.01Å; A24-D26 VanDerWaalsContact O-N 3.15Å
25	E	60.7	Low	59.1	Low	141 Å²	141	133.7 Å²	133.7	66%	0.659	70%	0.7	S	S	*	*			trans	-56.7	121.4	169.2	-167.6	93.6	-104.5	0	0	104.8	P23 W27	P23-E25 VanDerWaalsContact C-N 3.26Å; P23-E25 PolarHBondContact O-N 2.9Å; E25-W27 HydrophobicContact CG-CD2 4.44Å; E25-W27 HydrophobicContact CG-CZ2 4.38Å; E25-W27 PolarHBondContact O-N 3.43Å
26	D	56.5	Low	59	Low	147 Å²	147	129.9 Å²	129.9	79%	0.786	69%	0.691	S	S	*	*			trans	-71.4	80.3	178.6	-149	-48.4	0	0	0	106	A24 A28	A24-D26 PolarHBondContact O-N 3.01Å; A24-D26 VanDerWaalsContact O-N 3.15Å; D26-A28 PolarHBondContact O-N 2.79Å; D26-A28 WeakPolarHBondContact OD1-CB 3.12Å
27	W	56.8	Low	59.1	Low	171 Å²	171	128.8 Å²	128.8	65%	0.648	68%	0.682	S	S	*	*			trans	-66.2	25.2	175.8	-67.7	102	0	0	0	112.1	E25 G29	E25-W27 HydrophobicContact CG-CD2 4.44Å; E25-W27 HydrophobicContact CG-CZ2 4.38Å; E25-W27 PolarHBondContact O-N 3.43Å; W27-G29 PolarHBondContact O-N 3.34Å
28	A	54.3	Low	59	Low	86 Å²	86	125 Å²	125	71%	0.711	66%	0.664	S	S	*	*	S	Bend	trans	-69.3	76.9	175.4	0	0	0	0	0	110.4	D26	D26-A28 PolarHBondContact O-N 2.79Å; D26-A28 WeakPolarHBondContact OD1-CB 3.12Å
29	G	54.3	Low	58.7	Low	65 Å²	65	126.9 Å²	126.9	67%	0.67	66%	0.664	S	S	*	*	S	Bend	trans	98.6	35.4	158.1	0	0	0	0	0	116.4	W27	W27-G29 PolarHBondContact O-N 3.34Å
30	L	53.7	Low	58.2	Low	134 Å²	134	126.6 Å²	126.6	70%	0.702	67%	0.665	S	S	*	*	S	Bend	trans	-90.4	99.2	150.8	-78.4	170.6	0	0	0	106.8	E32	L30-E32 PolarHBondContact O-N 2.85Å
31	D	53	Low	57.7	Low	98 Å²	98	124.1 Å²	124.1	52%	0.524	66%	0.657	S	S	.	*			trans	14.9	88.8	167.4	-61.5	-73.1	0	0	0	115.4	D33 E34	D31-D33 PolarHBondContact O-N 3.18Å; D31-E34 HydrophobicContact CB-CG 4.48Å; D31-E34 PolarHBondContact O-N 3.03Å
32	E	54.4	Low	57.2	Low	177 Å²	177	120.5 Å²	120.5	83%	0.827	64%	0.644	S	S	*	*	H	α-helix	trans	-54.3	-12.6	170.8	-73	178.1	164.5	0	0	113	L30	L30-E32 PolarHBondContact O-N 2.85Å
33	D	53.7	Low	57.7	Low	113 Å²	113	125.2 Å²	125.2	60%	0.604	66%	0.658	S	S	*	*	H	α-helix	trans	-82	-33.8	177.3	-60.2	-45.2	0	0	0	112.6	D31 H37	D31-D33 PolarHBondContact O-N 3.18Å; D33-H37 PolarHBondContact O-CD2 2.91Å; D33-H37 PolarHBondContact O-NE2 2.95Å
34	E	54.4	Low	57.2	Low	146 Å²	146	126.5 Å²	126.5	68%	0.682	66%	0.658	S	S	*	*	H	α-helix	trans	-76.2	-37.8	-175.5	-80.9	-157	149.7	0	0	113.3	D31 H37	D31-E34 HydrophobicContact CB-CG 4.48Å; D31-E34 PolarHBondContact O-N 3.03Å; E34-H37 PolarHBondContact O-N 3.39Å
35	D	53.2	Low	57	Low	92 Å²	92	124.9 Å²	124.9	49%	0.492	64%	0.636	S	S	.	*	H	α-helix	trans	-71.9	-35.2	-177.7	-96.6	-37.7	0	0	0	112	H37 V38	D35-H37 VanDerWaalsContact C-N 3.3Å; D35-H37 PolarHBondContact O-N 2.9Å; D35-V38 PolarHBondContact O-N 3.42Å
36	A	54.3	Low	56.8	Low	53 Å²	53	124.2 Å²	124.2	44%	0.438	64%	0.637	S	S	.	*	H	α-helix	trans	-65.7	-33.1	176.8	0	0	0	0	0	112.6	V38 W39 E40	A36-V38 VanDerWaalsContact C-N 3.31Å; A36-V38 PolarHBondContact O-N 3.26Å; A36-W39 PolarHBondContact O-N 3.41Å; A36-E40 PolarHBondContact O-N 3.4Å
37	H	56.8	Low	56.9	Low	105 Å²	105	123.1 Å²	123.1	49%	0.486	63%	0.631	S	S	.	*	H	α-helix	trans	-65.6	-31.1	178.2	-71.5	-42.4	0	0	0	113	D33 E34 D35 W39 D41	D33-H37 PolarHBondContact O-CD2 2.91Å; D33-H37 PolarHBondContact O-NE2 2.95Å; E34-H37 PolarHBondContact O-N 3.39Å; D35-H37 VanDerWaalsContact C-N 3.3Å; D35-H37 PolarHBondContact O-N 2.9Å; H37-W39 VanDerWaalsContact C-N 3.3Å; H37-W39 PolarHBondContact O-N 2.98Å; H37-D41 VanDerWaalsContact O-CB 3.27Å; H37-D41 WeakPolarHBondContact O-CB 3.31Å; H37-D41 PolarHBondContact O-N 3.39Å
38	V	58.8	Low	56.8	Low	75 Å²	75	119.7 Å²	119.7	46%	0.455	63%	0.628	S	S	.	*	H	α-helix	trans	-69.1	-28.8	-178.7	-179.7	0	0	0	0	112.5	D35 A36 N42	D35-V38 PolarHBondContact O-N 3.42Å; A36-V38 VanDerWaalsContact C-N 3.31Å; A36-V38 PolarHBondContact O-N 3.26Å; V38-N42 VanDerWaalsContact O-CB 3.31Å; V38-N42 WeakPolarHBondContact O-CB 3.27Å; V38-N42 PolarHBondContact O-ND2 3.08Å
39	W	63	Low	56.8	Low	204 Å²	204	122.4 Å²	122.4	77%	0.773	63%	0.626	S	S	*	*	H	α-helix	trans	-94.2	-28.3	-178.4	-60.3	84.5	0	0	0	112.9	A36 H37	A36-W39 PolarHBondContact O-N 3.41Å; H37-W39 VanDerWaalsContact C-N 3.3Å; H37-W39 PolarHBondContact O-N 2.98Å
40	E	55.7	Low	57	Low	146 Å²	146	123 Å²	123	68%	0.682	62%	0.615	S	S	*	*	H	α-helix	trans	-79.7	-41.1	174	-69.5	-167	167.3	0	0	112.4	A36	A36-E40 PolarHBondContact O-N 3.4Å
41	D	60.6	Low	57.6	Low	106 Å²	106	121 Å²	121	57%	0.567	60%	0.604	S	S	*	*	H	α-helix	trans	-69.6	-40.7	179.4	-82.7	-16	0	0	0	111.5	H37 W43 D45	H37-D41 VanDerWaalsContact O-CB 3.27Å; H37-D41 WeakPolarHBondContact O-CB 3.31Å; H37-D41 PolarHBondContact O-N 3.39Å; D41-W43 VanDerWaalsContact C-N 3.3Å; D41-W43 PolarHBondContact O-N 3.29Å; D41-D45 WeakPolarHBondContact O-CB 3.12Å; D41-D45 PolarHBondContact O-N 3.39Å; D41-D45 VanDerWaalsContact O-N 3.08Å
42	N	57.3	Low	58	Low	120 Å²	120	123 Å²	123	64%	0.642	61%	0.609	S	S	*	*	H	α-helix	trans	-79.4	-5.8	-173.5	-67.7	-21.7	0	0	0	115.1	V38	V38-N42 VanDerWaalsContact O-CB 3.31Å; V38-N42 WeakPolarHBondContact O-CB 3.27Å; V38-N42 PolarHBondContact O-ND2 3.08Å
43	W	68.4	Low	58.6	Low	237 Å²	237	117.2 Å²	117.2	90%	0.898	59%	0.588	S	S	*	*	H	α-helix	trans	-101.5	-24.5	178.4	-169.3	21.4	0	0	0	113	D41	D41-W43 VanDerWaalsContact C-N 3.3Å; D41-W43 PolarHBondContact O-N 3.29Å
44	D	58.7	Low	59.1	Low	140 Å²	140	113.3 Å²	113.3	75%	0.749	57%	0.567	S	S	*	*	H	α-helix	trans	-107	-3.8	177.1	-138.2	1	0	0	0	112.7	D46	D44-D46 PolarHBondContact O-N 3.23Å
45	D	58.8	Low	59.8	Low	67 Å²	67	111.8 Å²	111.8	36%	0.358	56%	0.56	S	S	.	*			trans	-78.4	59.2	173.3	-164.4	1.6	0	0	0	112.2	D41 N47 V48	D41-D45 WeakPolarHBondContact O-CB 3.12Å; D41-D45 PolarHBondContact O-N 3.39Å; D41-D45 VanDerWaalsContact O-N 3.08Å; D45-N47 PolarHBondContact O-N 3.3Å; D45-N47 VanDerWaalsContact OD1-CB 3.3Å; D45-N47 WeakPolarHBondContact OD1-CB 3.08Å; D45-N47 PolarHBondContact OD1-N 3.29Å; D45-V48 PolarHBondContact O-N 3Å; D45-V48 PolarHBondContact OD1-N 2.9Å; D45-V48 WeakPolarHBondContact OD2-CG2 3.3Å
46	D	56.9	Low	60.4	Low	126 Å²	126	112.6 Å²	112.6	67%	0.674	56%	0.564	S	S	*	*	H	α-helix	trans	-54.8	-9.9	163	-101	-31.4	0	0	0	112.4	D44	D44-D46 PolarHBondContact O-N 3.23Å
47	N	57.3	Low	60.8	Low	124 Å²	124	116.8 Å²	116.8	66%	0.663	57%	0.568	S	S	*	*	H	α-helix	trans	-84.6	-23	-177.4	176.1	69.4	0	0	0	112.9	D45	D45-N47 PolarHBondContact O-N 3.3Å; D45-N47 VanDerWaalsContact OD1-CB 3.3Å; D45-N47 WeakPolarHBondContact OD1-CB 3.08Å; D45-N47 PolarHBondContact OD1-N 3.29Å
48	V	55.7	Low	60.9	Low	99 Å²	99	117.4 Å²	117.4	60%	0.6	57%	0.571	S	S	*	*	H	α-helix	trans	-74.8	-30.4	169.4	175.5	0	0	0	0	111.8	D45	D45-V48 PolarHBondContact O-N 3Å; D45-V48 PolarHBondContact OD1-N 2.9Å; D45-V48 WeakPolarHBondContact OD2-CG2 3.3Å
49	E	54.2	Low	61	Low	143 Å²	143	115.5 Å²	115.5	67%	0.668	57%	0.567	S	S	*	*	H	α-helix	trans	-73.4	-26.1	177.1	-133	-170.3	105.6	0	0	112.9	S53	E49-S53 WeakPolarHBondContact O-CB 3.23Å; E49-S53 PolarHBondContact O-N 2.77Å; E49-S53 PolarHBondContact O-OG 3.4Å
50	D	58.2	Low	60.7	Low	79 Å²	79	113.2 Å²	113.2	42%	0.422	56%	0.564	S	S	.	*	H	α-helix	trans	-73.4	-33.4	178.1	-166	42.2	0	0	0	112.7	S53 N54	D50-S53 PolarHBondContact O-N 2.85Å; D50-N54 WeakPolarHBondContact O-CA 3.48Å; D50-N54 WeakPolarHBondContact O-CB 3.38Å; D50-N54 PolarHBondContact O-N 3.45Å; D50-N54 PolarHBondContact O-ND2 3.49Å; D50-N54 PolarHBondContact OD1-ND2 3.38Å; D50-N54 PolarHBondContact OD1-OD1 2.76Å; D50-N54 PolarHBondContact OD2-ND2 3.03Å
51	D	66.3	Low	60.7	Low	91 Å²	91	108.8 Å²	108.8	49%	0.487	55%	0.552	S	S	.	*	H	α-helix	trans	-67.9	-40	-179	-167.3	54.2	0	0	0	112.6	N54 Q55	D51-N54 PolarHBondContact O-N 3.41Å; D51-Q55 WeakPolarHBondContact O-CB 3.42Å; D51-Q55 VanDerWaalsContact O-CG 3.23Å; D51-Q55 WeakPolarHBondContact O-CG 3.1Å; D51-Q55 PolarHBondContact O-N 3.02Å; D51-Q55 PolarHBondContact OD2-NE2 2.68Å
52	F	62	Low	60.6	Low	140 Å²	140	106.3 Å²	106.3	61%	0.614	54%	0.543	S	S	*	.	H	α-helix	trans	-67	-41.3	175.5	-156.3	-97.6	0	0	0	111.6	Q55 L56	F52-Q55 PolarHBondContact O-N 2.78Å; F52-L56 HydrophobicContact CD1-CD1 3.84Å; F52-L56 HydrophobicContact CD1-CG 4.42Å; F52-L56 HydrophobicContact CE1-CD1 3.85Å; F52-L56 HydrophobicContact CE1-CG 4.43Å; F52-L56 WeakPolarHBondContact O-CG 3.49Å; F52-L56 PolarHBondContact O-N 3.46Å
53	S	66.1	Low	60.6	Low	56 Å²	56	103.2 Å²	103.2	39%	0.392	54%	0.535	S	S	.	.	H	α-helix	trans	-65.8	-39.1	175.4	-65.1	0	0	0	0	112.3	E49 D50 L56 R57	E49-S53 WeakPolarHBondContact O-CB 3.23Å; E49-S53 PolarHBondContact O-N 2.77Å; E49-S53 PolarHBondContact O-OG 3.4Å; D50-S53 PolarHBondContact O-N 2.85Å; S53-L56 PolarHBondContact O-N 2.99Å; S53-R57 VanDerWaalsContact O-CB 3.31Å; S53-R57 WeakPolarHBondContact O-CB 3.16Å; S53-R57 PolarHBondContact O-N 2.73Å
54	N	64.8	Low	60.2	Low	30 Å²	30	94 Å²	94	16%	0.16	51%	0.512	C	S	.	.	H	α-helix	trans	-64.5	-46.4	173.7	-75.8	-34.1	0	0	0	110.6	D50 D51 L56 R57 H58	D50-N54 WeakPolarHBondContact O-CA 3.48Å; D50-N54 WeakPolarHBondContact O-CB 3.38Å; D50-N54 PolarHBondContact O-N 3.45Å; D50-N54 PolarHBondContact O-ND2 3.49Å; D50-N54 PolarHBondContact OD1-ND2 3.38Å; D50-N54 PolarHBondContact OD1-OD1 2.76Å; D50-N54 PolarHBondContact OD2-ND2 3.03Å; D51-N54 PolarHBondContact O-N 3.41Å; N54-L56 VanDerWaalsContact C-N 3.35Å; N54-L56 PolarHBondContact O-N 3.45Å; N54-R57 PolarHBondContact O-N 3.39Å; N54-R57 PolarHBondContact OD1-NH1 2.83Å; N54-R57 PolarHBondContact OD1-NH2 2.73Å; N54-H58 WeakPolarHBondContact O-CB 3.29Å; N54-H58 PolarHBondContact O-N 2.7Å; N54-H58 PolarHBondContact O-ND1 3.49Å
55	Q	68.5	Low	60.2	Low	114 Å²	114	91.6 Å²	91.6	53%	0.533	50%	0.499	S	S	.	.	H	α-helix	trans	-60.5	-42.2	176.9	-74	179	41.8	0	0	111.9	D51 F52 G59	D51-Q55 WeakPolarHBondContact O-CB 3.42Å; D51-Q55 VanDerWaalsContact O-CG 3.23Å; D51-Q55 WeakPolarHBondContact O-CG 3.1Å; D51-Q55 PolarHBondContact O-N 3.02Å; D51-Q55 PolarHBondContact OD2-NE2 2.68Å; F52-Q55 PolarHBondContact O-N 2.78Å; Q55-G59 PolarHBondContact O-N 3.31Å
56	L	65.1	Low	60.3	Low	110 Å²	110	94 Å²	94	58%	0.576	51%	0.512	S	S	*	.	H	α-helix	trans	-67.7	-40.8	176.2	-71.1	172.7	0	0	0	112.6	F52 S53 N54 G59 H60	F52-L56 HydrophobicContact CD1-CD1 3.84Å; F52-L56 HydrophobicContact CD1-CG 4.42Å; F52-L56 HydrophobicContact CE1-CD1 3.85Å; F52-L56 HydrophobicContact CE1-CG 4.43Å; F52-L56 WeakPolarHBondContact O-CG 3.49Å; F52-L56 PolarHBondContact O-N 3.46Å; S53-L56 PolarHBondContact O-N 2.99Å; N54-L56 VanDerWaalsContact C-N 3.35Å; N54-L56 PolarHBondContact O-N 3.45Å; L56-G59 PolarHBondContact O-N 2.92Å; L56-H60 WeakPolarHBondContact O-CB 3.44Å; L56-H60 PolarHBondContact O-N 2.93Å
57	R	63.9	Low	60.4	Low	140 Å²	140	93.6 Å²	93.6	53%	0.528	51%	0.506	S	S	.	.	H	α-helix	trans	-66.1	-43.2	176.3	-170.8	175.2	72.2	-110.4	1	111.8	S53 N54 H60 A61	S53-R57 VanDerWaalsContact O-CB 3.31Å; S53-R57 WeakPolarHBondContact O-CB 3.16Å; S53-R57 PolarHBondContact O-N 2.73Å; N54-R57 PolarHBondContact O-N 3.39Å; N54-R57 PolarHBondContact OD1-NH1 2.83Å; N54-R57 PolarHBondContact OD1-NH2 2.73Å; R57-H60 PolarHBondContact O-N 2.78Å; R57-A61 VanDerWaalsContact O-CB 3.29Å; R57-A61 WeakPolarHBondContact O-CB 3.33Å; R57-A61 PolarHBondContact O-N 3.38Å
58	H	59.4	Low	60.4	Low	119 Å²	119	92.6 Å²	92.6	55%	0.551	50%	0.497	S	S	*	.	H	α-helix	trans	-68	-37.3	174.4	-73.4	91.5	0	0	0	111.6	N54 S62	N54-H58 WeakPolarHBondContact O-CB 3.29Å; N54-H58 PolarHBondContact O-N 2.7Å; N54-H58 PolarHBondContact O-ND1 3.49Å; H58-S62 WeakPolarHBondContact O-CB 3.31Å; H58-S62 PolarHBondContact O-N 2.83Å; H58-S62 PolarHBondContact O-OG 2.94Å
59	G	59.3	Low	60.6	Low	35 Å²	35	95.9 Å²	95.9	36%	0.361	50%	0.503	S	S	.	.	H	α-helix	trans	-62.7	-43.1	173.5	0	0	0	0	0	112.6	Q55 L56 S62 A63	Q55-G59 PolarHBondContact O-N 3.31Å; L56-G59 PolarHBondContact O-N 2.92Å; G59-S62 WeakPolarHBondContact CA-OG 3.36Å; G59-S62 PolarHBondContact O-OG 3.4Å; G59-S62 VanDerWaalsContact O-OG 3.07Å; G59-A63 WeakPolarHBondContact O-CB 3.21Å; G59-A63 PolarHBondContact O-N 3.05Å
60	H	56.2	Low	60.7	Low	156 Å²	156	96.4 Å²	96.4	72%	0.722	51%	0.51	S	S	*	.	H	α-helix	trans	-71.5	-40.3	177.3	-169.8	-98.4	0	0	0	112.5	L56 R57 G64	L56-H60 WeakPolarHBondContact O-CB 3.44Å; L56-H60 PolarHBondContact O-N 2.93Å; R57-H60 PolarHBondContact O-N 2.78Å; H60-G64 PolarHBondContact O-N 3.07Å
61	A	57.2	Low	60.7	Low	52 Å²	52	97.5 Å²	97.5	43%	0.43	52%	0.515	S	S	.	.	H	α-helix	trans	-67.8	-41	175.4	0	0	0	0	0	112.5	R57 G64 L65	R57-A61 VanDerWaalsContact O-CB 3.29Å; R57-A61 WeakPolarHBondContact O-CB 3.33Å; R57-A61 PolarHBondContact O-N 3.38Å; A61-G64 PolarHBondContact O-N 2.87Å; A61-L65 WeakPolarHBondContact O-CB 3.38Å; A61-L65 WeakPolarHBondContact O-CG 3.48Å; A61-L65 PolarHBondContact O-N 3.31Å
62	S	57.3	Low	60.1	Low	55 Å²	55	96.7 Å²	96.7	39%	0.385	53%	0.528	S	S	.	.	H	α-helix	trans	-69.9	-39.5	177	59.7	0	0	0	0	112	H58 G59 G64 L65 L66	H58-S62 WeakPolarHBondContact O-CB 3.31Å; H58-S62 PolarHBondContact O-N 2.83Å; H58-S62 PolarHBondContact O-OG 2.94Å; G59-S62 WeakPolarHBondContact CA-OG 3.36Å; G59-S62 PolarHBondContact O-OG 3.4Å; G59-S62 VanDerWaalsContact O-OG 3.07Å; S62-G64 VanDerWaalsContact C-N 3.33Å; S62-G64 PolarHBondContact O-N 2.87Å; S62-L65 PolarHBondContact O-N 2.94Å; S62-L66 WeakPolarHBondContact O-CB 3.19Å; S62-L66 WeakPolarHBondContact O-CG 3.4Å; S62-L66 PolarHBondContact O-N 3.38Å
63	A	58.9	Low	59.9	Low	55 Å²	55	97.7 Å²	97.7	46%	0.455	54%	0.535	S	S	.	.	H	α-helix	trans	-60.9	-41	171.1	0	0	0	0	0	112	G59 L66 Q67	G59-A63 WeakPolarHBondContact O-CB 3.21Å; G59-A63 PolarHBondContact O-N 3.05Å; A63-L66 PolarHBondContact O-N 3Å; A63-Q67 WeakPolarHBondContact O-CB 3.12Å; A63-Q67 PolarHBondContact O-N 3.46Å
64	G	58.3	Low	59.3	Low	42 Å²	42	103.8 Å²	103.8	43%	0.433	56%	0.557	S	S	.	*	H	α-helix	trans	-62.8	-43.6	173.8	0	0	0	0	0	113.3	H60 A61 S62 Q67 E68	H60-G64 PolarHBondContact O-N 3.07Å; A61-G64 PolarHBondContact O-N 2.87Å; S62-G64 VanDerWaalsContact C-N 3.33Å; S62-G64 PolarHBondContact O-N 2.87Å; G64-Q67 PolarHBondContact O-N 3.49Å; G64-E68 PolarHBondContact O-N 3.18Å; G64-E68 VanDerWaalsContact O-N 3.13Å
65	L	58.8	Low	58.9	Low	91 Å²	91	105.5 Å²	105.5	48%	0.476	57%	0.569	S	S	.	*	H	α-helix	trans	-68.3	-33	176.7	-76.8	162.8	0	0	0	112.9	A61 S62 K69	A61-L65 WeakPolarHBondContact O-CB 3.38Å; A61-L65 WeakPolarHBondContact O-CG 3.48Å; A61-L65 PolarHBondContact O-N 3.31Å; S62-L65 PolarHBondContact O-N 2.94Å; L65-K69 WeakPolarHBondContact O-CB 3.26Å; L65-K69 VanDerWaalsContact O-CG 3.26Å; L65-K69 WeakPolarHBondContact O-CG 3.38Å; L65-K69 PolarHBondContact O-N 3.48Å
66	L	60.8	Low	58.4	Low	117 Å²	117	111.6 Å²	111.6	61%	0.613	59%	0.588	S	S	*	*	H	α-helix	trans	-72.5	-37	174.6	-70.6	169.3	0	0	0	111.3	S62 A63 E68 L70	S62-L66 WeakPolarHBondContact O-CB 3.19Å; S62-L66 WeakPolarHBondContact O-CG 3.4Å; S62-L66 PolarHBondContact O-N 3.38Å; A63-L66 PolarHBondContact O-N 3Å; L66-E68 VanDerWaalsContact C-N 3.34Å; L66-E68 PolarHBondContact O-N 2.97Å; L66-L70 WeakPolarHBondContact O-CB 3.46Å; L66-L70 PolarHBondContact O-N 2.96Å
67	Q	59.1	Low	57.6	Low	118 Å²	118	116.5 Å²	116.5	55%	0.551	60%	0.599	S	S	*	*	H	α-helix	trans	-60.9	-42.3	173.3	-168.9	78.3	75.2	0	0	111.5	A63 G64 L71	A63-Q67 WeakPolarHBondContact O-CB 3.12Å; A63-Q67 PolarHBondContact O-N 3.46Å; G64-Q67 PolarHBondContact O-N 3.49Å; Q67-L71 HydrophobicContact CG-CD1 4.2Å; Q67-L71 WeakPolarHBondContact O-CB 3.38Å; Q67-L71 PolarHBondContact O-N 3.13Å
68	E	57.5	Low	57.1	Low	103 Å²	103	115.4 Å²	115.4	48%	0.481	61%	0.61	S	S	.	*	H	α-helix	trans	-70.2	-44.8	179.2	-165.2	-177.8	103.2	0	0	112.3	G64 L66 L70 G72	G64-E68 PolarHBondContact O-N 3.18Å; G64-E68 VanDerWaalsContact O-N 3.13Å; L66-E68 VanDerWaalsContact C-N 3.34Å; L66-E68 PolarHBondContact O-N 2.97Å; E68-L70 VanDerWaalsContact C-N 3.35Å; E68-L70 PolarHBondContact O-N 3.22Å; E68-G72 PolarHBondContact O-N 3.37Å
69	K	59.9	Low	56.8	Low	168 Å²	168	114 Å²	114	73%	0.73	61%	0.606	S	S	*	*	H	α-helix	trans	-69.5	-29.5	178.9	-72.5	177.6	-178.5	-172.2	0	113.5	L65	L65-K69 WeakPolarHBondContact O-CB 3.26Å; L65-K69 VanDerWaalsContact O-CG 3.26Å; L65-K69 WeakPolarHBondContact O-CG 3.38Å; L65-K69 PolarHBondContact O-N 3.48Å
70	L	57.8	Low	56.8	Low	153 Å²	153	124.1 Å²	124.1	80%	0.801	63%	0.633	S	S	*	*	H	α-helix	trans	-84.3	-27.5	-179.2	-158.4	76	0	0	0	112.6	L66 E68	L66-L70 WeakPolarHBondContact O-CB 3.46Å; L66-L70 PolarHBondContact O-N 2.96Å; E68-L70 VanDerWaalsContact C-N 3.35Å; E68-L70 PolarHBondContact O-N 3.22Å
71	L	57	Low	56.6	Low	103 Å²	103	122.2 Å²	122.2	54%	0.539	63%	0.629	S	S	.	*	H	α-helix	trans	-97.7	-13.5	-177.6	-73.9	173.8	0	0	0	115.2	Q67 E73	Q67-L71 HydrophobicContact CG-CD1 4.2Å; Q67-L71 WeakPolarHBondContact O-CB 3.38Å; Q67-L71 PolarHBondContact O-N 3.13Å; L71-E73 PolarHBondContact O-N 2.86Å
72	G	54.1	Low	56.3	Low	73 Å²	73	124.3 Å²	124.3	75%	0.753	64%	0.64	S	S	*	*			trans	55	19	172.6	0	0	0	0	0	114.9	E68	E68-G72 PolarHBondContact O-N 3.37Å
73	E	57.1	Low	56.2	Low	162 Å²	162	126.7 Å²	126.7	76%	0.757	66%	0.657	S	S	*	*	S	Bend	trans	-143.4	130.2	-176.8	-69.3	-166.8	127.2	0	0	108.3	L71	L71-E73 PolarHBondContact O-N 2.86Å
74	E	53.8	Low	56.4	Low	183 Å²	183	128.9 Å²	128.9	86%	0.855	67%	0.669	S	S	*	*			trans	-57.8	135.3	-170.2	-60.6	-118.4	127.7	0	0	112.7	R76	E74-R76 PolarHBondContact O-N 2.94Å
75	P	56.9	Low	56	Low	66 Å²	66	133.9 Å²	133.9	43%	0.429	69%	0.685	S	S	.	*			trans	-71.6	98.4	176.2	27.2	-30.5	0	0	0	110	W77	P75-W77 VanDerWaalsContact C-N 3.3Å; P75-W77 PolarHBondContact O-N 2.9Å
76	R	58.7	Low	55.5	Low	243 Å²	243	136.5 Å²	136.5	92%	0.917	70%	0.695	S	S	*	*			trans	-70.6	84.5	171.4	-175.2	-175.5	163.4	105.1	-1.4	109.9	E74	E74-R76 PolarHBondContact O-N 2.94Å
77	W	48.1	Very low	54.5	Low	212 Å²	212	139.6 Å²	139.6	80%	0.803	71%	0.711	S	S	*	*			trans	-64.6	134.3	162.8	-58.2	89.7	0	0	0	109	P75 N79	P75-W77 VanDerWaalsContact C-N 3.3Å; P75-W77 PolarHBondContact O-N 2.9Å; W77-N79 PolarHBondContact O-N 3.22Å
78	P	52.2	Low	53.7	Low	117 Å²	117	138.6 Å²	138.6	76%	0.76	72%	0.715	S	S	*	*			trans	-65.8	113.1	168.3	26.3	-30	0	0	0	108	R80	P78-R80 PolarHBondContact O-N 3.05Å
79	N	53.3	Low	53.1	Low	89 Å²	89	142.4 Å²	142.4	48%	0.476	76%	0.763	S	S	.	*			trans	-62.2	118.1	-179.7	-178.4	-3.3	0	0	0	110.5	W77 N81 S82	W77-N79 PolarHBondContact O-N 3.22Å; N79-N81 VanDerWaalsContact CG-CG 3.46Å; N79-N81 PolarHBondContact ND2-ND2 2.83Å; N79-N81 PolarHBondContact ND2-OD1 3.05Å; N79-N81 PolarHBondContact O-N 3.05Å; N79-N81 VanDerWaalsContact O-N 3.11Å; N79-N81 PolarHBondContact OD1-N 3.46Å; N79-N81 VanDerWaalsContact OD1-N 3.12Å; N79-N81 PolarHBondContact OD1-ND2 2.97Å; N79-N81 PolarHBondContact OD1-OD1 3.12Å; N79-S82 WeakPolarHBondContact O-CB 3.43Å; N79-S82 PolarHBondContact O-N 3.11Å; N79-S82 PolarHBondContact O-OG 2.84Å
80	R	59.7	Low	52.7	Low	248 Å²	248	141.1 Å²	141.1	94%	0.936	77%	0.765	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.8	-11.1	-179.8	-71.4	-176.5	-145.6	-109.8	-0.5	114.5	P78 S82	P78-R80 PolarHBondContact O-N 3.05Å; R80-S82 VanDerWaalsContact C-N 3.28Å
81	N	51.6	Low	52.5	Low	116 Å²	116	140.5 Å²	140.5	62%	0.62	76%	0.763	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.4	14.1	171.7	62.9	38	0	0	0	113.7	N79 S83	N79-N81 VanDerWaalsContact CG-CG 3.46Å; N79-N81 PolarHBondContact ND2-ND2 2.83Å; N79-N81 PolarHBondContact ND2-OD1 3.05Å; N79-N81 PolarHBondContact O-N 3.05Å; N79-N81 VanDerWaalsContact O-N 3.11Å; N79-N81 PolarHBondContact OD1-N 3.46Å; N79-N81 VanDerWaalsContact OD1-N 3.12Å; N79-N81 PolarHBondContact OD1-ND2 2.97Å; N79-N81 PolarHBondContact OD1-OD1 3.12Å; N81-S83 PolarHBondContact O-N 2.68Å
82	S	50.7	Low	52.2	Low	97 Å²	97	142.6 Å²	142.6	68%	0.678	78%	0.776	S	S	*	*			trans	-78.3	42.4	166.7	-45.9	0	0	0	0	112	N79 R80	N79-S82 WeakPolarHBondContact O-CB 3.43Å; N79-S82 PolarHBondContact O-N 3.11Å; N79-S82 PolarHBondContact O-OG 2.84Å; R80-S82 VanDerWaalsContact C-N 3.28Å
83	S	55.3	Low	52.1	Low	104 Å²	104	146.6 Å²	146.6	73%	0.727	78%	0.777	S	S	*	*			trans	-98.1	127.4	153.9	-84.4	0	0	0	0	106.1	N81	N81-S83 PolarHBondContact O-N 2.68Å
84	S	63.8	Low	51.8	Low	101 Å²	101	145.7 Å²	145.7	71%	0.706	78%	0.778	S	S	*	*			trans	86.4	100.3	-174.5	-148.3	0	0	0	0	113.2
85	L	48.9	Very low	51.7	Low	147 Å²	147	143.2 Å²	143.2	77%	0.77	77%	0.773	S	S	*	*				175.5	117.9	96.3	-85.3	164.4	0	0	0	110
86	Q	48.3	Very low	51.3	Low	146 Å²	146	148.7 Å²	148.7	68%	0.682	80%	0.798	S	S	*	*			trans	62.3	104.5	139.8	-137.4	69.4	26.4	0	0	119.4	P88	Q86-P88 HydrophobicContact CG-CB 4.33Å; Q86-P88 HydrophobicContact CG-CG 3.75Å; Q86-P88 WeakPolarHBondContact O-CD 3.48Å
87	L	41.7	Very low	50.7	Low	183 Å²	183	141.5 Å²	141.5	96%	0.958	79%	0.789	S	S	*	*			trans	-97	110.5	140.9	-69.3	175.9	0	0	0	108.3
88	P	41	Very low	51	Low	97 Å²	97	135.6 Å²	135.6	63%	0.63	79%	0.787	S	S	*	*			trans	-110.3	143.3	159.7	33.4	-20.2	0	0	0	112.5	Q86	Q86-P88 HydrophobicContact CG-CB 4.33Å; Q86-P88 HydrophobicContact CG-CG 3.75Å; Q86-P88 WeakPolarHBondContact O-CD 3.48Å
89	A	45	Very low	50.8	Low	182 Å²	182	137.3 Å²	137.3	100%	1.504	79%	0.79	S	S	*	*			trans	74.7	0	167.8	0	0	0	0	0	117.7

Retrieved 89 of 89 residues in 35.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).