A0A087X212_HUMAN Loading...

Family with sequence similarity 177 member A1

AlphaFold DB , UniProt , Accession A0A087X212, Species HUMAN (Homo sapiens, Human), Gene FAM177A1, Length 89 aa.

						>A0A087X212_HUMAN|A0A087X212|FAM177A1
MEVGLPAITLFLTSASSPVVATTMDQEPVGGVERGEAVAASGAAAAAAFGESAGQNLTLLPRLKFMARSRLAATSTSRVQAILLPQPPV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.9	Low	64.9	Low	228 Å²	228	117.3 Å²	117.3	100%	1.123	64%	0.643	S	S	*	*				0	88.2	0	32.4	173.4	68.2	0	0	106.6
2	E	57.3	Low	65.6	Low	172 Å²	172	116.4 Å²	116.4	80%	0.804	64%	0.636	S	S	*	*			trans	-102.3	84.4	-178.5	-86.3	-71.6	90.2	0	0	108
3	V	56.4	Low	66	Low	136 Å²	136	113.8 Å²	113.8	82%	0.824	63%	0.625	S	S	*	*			trans	-104	89.4	173.8	-171.2	0	0	0	0	107.2
4	G	60.6	Low	65.9	Low	22 Å²	22	111.1 Å²	111.1	23%	0.227	62%	0.619	C	S	.	*			trans	75	45.5	140.8	0	0	0	0	0	117.8	A7 I8	G4-A7 WeakPolarHBondContact O-CA 3.37Å; G4-A7 WeakPolarHBondContact O-CB 3.44Å; G4-A7 PolarHBondContact O-N 3.39Å; G4-I8 WeakPolarHBondContact O-CG1 3.3Å; G4-I8 PolarHBondContact O-N 3.29Å
5	L	62.3	Low	65.6	Low	117 Å²	117	109 Å²	109	61%	0.613	62%	0.621	S	S	*	*	H	α-helix	trans	-40.9	-44.8	155.7	-84.9	168.9	0	0	0	113.1	A7 I8 T9	L5-A7 VanDerWaalsContact C-N 3.34Å; L5-A7 PolarHBondContact O-N 3.02Å; L5-I8 PolarHBondContact O-N 3.14Å; L5-T9 PolarHBondContact O-N 2.83Å; L5-T9 PolarHBondContact O-OG1 3.38Å; L5-T9 VanDerWaalsContact O-OG1 3.05Å
6	P	67.4	Low	65.2	Low	102 Å²	102	108.1 Å²	108.1	66%	0.662	62%	0.624	S	S	*	*	H	α-helix	trans	-66	-31.3	175.1	23.6	-35	0	0	0	114.1	L10	P6-L10 VanDerWaalsContact O-CB 3.28Å; P6-L10 WeakPolarHBondContact O-CB 3.43Å; P6-L10 PolarHBondContact O-N 3.05Å
7	A	67.4	Low	64.2	Low	63 Å²	63	106.5 Å²	106.5	52%	0.521	62%	0.62	S	S	.	*	H	α-helix	trans	-72.1	-37.1	178.1	0	0	0	0	0	111.5	G4 L5 F11	G4-A7 WeakPolarHBondContact O-CA 3.37Å; G4-A7 WeakPolarHBondContact O-CB 3.44Å; G4-A7 PolarHBondContact O-N 3.39Å; L5-A7 VanDerWaalsContact C-N 3.34Å; L5-A7 PolarHBondContact O-N 3.02Å; A7-F11 VanDerWaalsContact O-CB 3.32Å; A7-F11 WeakPolarHBondContact O-CB 3.48Å; A7-F11 PolarHBondContact O-N 3.4Å
8	I	72.6	Confident	63.6	Low	93 Å²	93	106.4 Å²	106.4	48%	0.477	62%	0.624	S	S	.	*	H	α-helix	trans	-67.9	-44	175.1	-62.1	164.8	0	0	0	109.9	G4 L5 F11 L12	G4-I8 WeakPolarHBondContact O-CG1 3.3Å; G4-I8 PolarHBondContact O-N 3.29Å; L5-I8 PolarHBondContact O-N 3.14Å; I8-F11 PolarHBondContact O-N 2.99Å; I8-L12 HydrophobicContact CG2-CD1 3.84Å; I8-L12 HydrophobicContact CG2-CG 4.43Å; I8-L12 WeakPolarHBondContact O-CB 3.31Å; I8-L12 WeakPolarHBondContact O-CG 3.5Å; I8-L12 PolarHBondContact O-N 3.44Å
9	T	73.4	Confident	62.6	Low	88 Å²	88	107.9 Å²	107.9	54%	0.54	63%	0.634	S	S	.	*	H	α-helix	trans	-64.5	-40.8	176.4	-58.4	0	0	0	0	112.1	L5 F11 L12 T13	L5-T9 PolarHBondContact O-N 2.83Å; L5-T9 PolarHBondContact O-OG1 3.38Å; L5-T9 VanDerWaalsContact O-OG1 3.05Å; T9-F11 VanDerWaalsContact C-N 3.33Å; T9-L12 PolarHBondContact O-N 3.08Å; T9-T13 VanDerWaalsContact O-CB 3.3Å; T9-T13 WeakPolarHBondContact O-CB 3.49Å; T9-T13 WeakPolarHBondContact O-CG2 3.4Å; T9-T13 PolarHBondContact O-N 3.19Å
10	L	73.9	Confident	62.3	Low	115 Å²	115	108.2 Å²	108.2	60%	0.602	64%	0.637	S	S	*	*	H	α-helix	trans	-66.6	-36.1	176.5	-173	61.8	0	0	0	111.9	P6 T13 S14	P6-L10 VanDerWaalsContact O-CB 3.28Å; P6-L10 WeakPolarHBondContact O-CB 3.43Å; P6-L10 PolarHBondContact O-N 3.05Å; L10-T13 HydrophobicContact CD1-CG2 4.14Å; L10-T13 WeakPolarHBondContact O-CG2 3.46Å; L10-S14 VanDerWaalsContact O-CB 3.28Å; L10-S14 WeakPolarHBondContact O-CB 3.49Å; L10-S14 PolarHBondContact O-N 3.02Å; L10-S14 PolarHBondContact O-OG 3.4Å
11	F	71.3	Confident	61.4	Low	154 Å²	154	107.2 Å²	107.2	68%	0.675	64%	0.641	S	S	*	*	H	α-helix	trans	-69.2	-45.9	176.1	-174.8	-98.8	0	0	0	111.8	A7 I8 T9 S14 A15	A7-F11 VanDerWaalsContact O-CB 3.32Å; A7-F11 WeakPolarHBondContact O-CB 3.48Å; A7-F11 PolarHBondContact O-N 3.4Å; I8-F11 PolarHBondContact O-N 2.99Å; T9-F11 VanDerWaalsContact C-N 3.33Å; F11-S14 PolarHBondContact O-N 2.94Å; F11-A15 WeakPolarHBondContact O-CB 3.34Å; F11-A15 PolarHBondContact O-N 3.27Å
12	L	72.5	Confident	61.4	Low	107 Å²	107	101.8 Å²	101.8	56%	0.56	62%	0.621	S	S	*	*	H	α-helix	trans	-67.4	-39.5	178.3	-70.9	170.9	0	0	0	112.4	I8 T9 S14 A15 S16	I8-L12 HydrophobicContact CG2-CD1 3.84Å; I8-L12 HydrophobicContact CG2-CG 4.43Å; I8-L12 WeakPolarHBondContact O-CB 3.31Å; I8-L12 WeakPolarHBondContact O-CG 3.5Å; I8-L12 PolarHBondContact O-N 3.44Å; T9-L12 PolarHBondContact O-N 3.08Å; L12-S14 VanDerWaalsContact C-N 3.34Å; L12-A15 PolarHBondContact O-N 2.89Å; L12-S16 VanDerWaalsContact O-CB 3.23Å; L12-S16 WeakPolarHBondContact O-CB 3.49Å; L12-S16 PolarHBondContact O-N 2.99Å
13	T	71.5	Confident	61.2	Low	82 Å²	82	99.5 Å²	99.5	50%	0.503	62%	0.619	S	S	.	*	H	α-helix	trans	-67.9	-35.1	176	-158.9	0	0	0	0	111.7	T9 L10 S16 S17	T9-T13 VanDerWaalsContact O-CB 3.3Å; T9-T13 WeakPolarHBondContact O-CB 3.49Å; T9-T13 WeakPolarHBondContact O-CG2 3.4Å; T9-T13 PolarHBondContact O-N 3.19Å; L10-T13 HydrophobicContact CD1-CG2 4.14Å; L10-T13 WeakPolarHBondContact O-CG2 3.46Å; T13-S16 CarbonylContact O-C 3.6Å; T13-S16 PolarHBondContact O-N 3.34Å; T13-S17 PolarHBondContact O-N 3Å
14	S	64.8	Low	61.4	Low	77 Å²	77	101.5 Å²	101.5	54%	0.538	62%	0.621	S	S	.	*	H	α-helix	trans	-68.6	-38.9	174.1	-59.4	0	0	0	0	111.8	L10 F11 L12 S16 S17	L10-S14 VanDerWaalsContact O-CB 3.28Å; L10-S14 WeakPolarHBondContact O-CB 3.49Å; L10-S14 PolarHBondContact O-N 3.02Å; L10-S14 PolarHBondContact O-OG 3.4Å; F11-S14 PolarHBondContact O-N 2.94Å; L12-S14 VanDerWaalsContact C-N 3.34Å; S14-S16 VanDerWaalsContact C-N 3.26Å; S14-S16 PolarHBondContact O-N 2.99Å; S14-S17 PolarHBondContact O-N 3.14Å
15	A	60.7	Low	61.1	Low	79 Å²	79	107.3 Å²	107.3	65%	0.653	65%	0.647	S	S	*	*	H	α-helix	trans	-71	-23	174.6	0	0	0	0	0	112.9	F11 L12	F11-A15 WeakPolarHBondContact O-CB 3.34Å; F11-A15 PolarHBondContact O-N 3.27Å; L12-A15 PolarHBondContact O-N 2.89Å
16	S	59	Low	60.3	Low	94 Å²	94	110.3 Å²	110.3	66%	0.657	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.4	1.3	178.4	-168.9	0	0	0	0	113.5	L12 T13 S14 P18	L12-S16 VanDerWaalsContact O-CB 3.23Å; L12-S16 WeakPolarHBondContact O-CB 3.49Å; L12-S16 PolarHBondContact O-N 2.99Å; T13-S16 CarbonylContact O-C 3.6Å; T13-S16 PolarHBondContact O-N 3.34Å; S14-S16 VanDerWaalsContact C-N 3.26Å; S14-S16 PolarHBondContact O-N 2.99Å; S16-P18 WeakPolarHBondContact O-CD 3.32Å
17	S	49.3	Very low	59.2	Low	81 Å²	81	112.7 Å²	112.7	57%	0.566	66%	0.66	S	S	*	*			trans	-92	112.9	176.1	-169.6	0	0	0	0	109.3	T13 S14 V19	T13-S17 PolarHBondContact O-N 3Å; S14-S17 PolarHBondContact O-N 3.14Å; S17-V19 PolarHBondContact O-N 3.36Å; S17-V19 VanDerWaalsContact O-N 3.12Å
18	P	52.8	Low	58.5	Low	105 Å²	105	115.9 Å²	115.9	68%	0.682	68%	0.675	S	S	*	*			trans	-68.9	113.3	166.9	29.3	-28	0	0	0	105.9	S16 V20	S16-P18 WeakPolarHBondContact O-CD 3.32Å; P18-V20 VanDerWaalsContact C-N 3.28Å; P18-V20 PolarHBondContact O-N 3.27Å
19	V	45.3	Very low	57.3	Low	136 Å²	136	117.7 Å²	117.7	82%	0.824	69%	0.691	S	S	*	*			trans	-59.7	99.8	168.3	64.8	0	0	0	0	106.9	S17 A21	S17-V19 PolarHBondContact O-N 3.36Å; S17-V19 VanDerWaalsContact O-N 3.12Å; V19-A21 PolarHBondContact O-N 3.21Å
20	V	55.3	Low	56.3	Low	113 Å²	113	117.2 Å²	117.2	69%	0.685	70%	0.703	S	S	*	*			trans	-67.9	84.9	171.3	161.4	0	0	0	0	105.8	P18 T22	P18-V20 VanDerWaalsContact C-N 3.28Å; P18-V20 PolarHBondContact O-N 3.27Å; V20-T22 HydrophobicContact CG1-CG2 3.47Å; V20-T22 VanDerWaalsContact CG1-CG2 3.47Å; V20-T22 PolarHBondContact O-N 3.12Å
21	A	43.3	Very low	55.4	Low	87 Å²	87	115.1 Å²	115.1	72%	0.719	71%	0.71	S	S	*	*			trans	-73.4	87.2	161.4	0	0	0	0	0	106.1	V19 T23	V19-A21 PolarHBondContact O-N 3.21Å; A21-T23 PolarHBondContact O-N 3.19Å
22	T	53.3	Low	54.6	Low	115 Å²	115	114.5 Å²	114.5	71%	0.706	72%	0.718	S	S	*	*			trans	-59.7	88.3	162.2	59.1	0	0	0	0	107.9	V20	V20-T22 HydrophobicContact CG1-CG2 3.47Å; V20-T22 VanDerWaalsContact CG1-CG2 3.47Å; V20-T22 PolarHBondContact O-N 3.12Å
23	T	52.2	Low	53.3	Low	124 Å²	124	118.6 Å²	118.6	76%	0.761	73%	0.734	S	S	*	*			trans	-89.8	116.8	149	-159.3	0	0	0	0	105.2	A21 D25	A21-T23 PolarHBondContact O-N 3.19Å; T23-D25 PolarHBondContact O-N 2.93Å
24	M	61.4	Low	52.9	Low	177 Å²	177	126 Å²	126	87%	0.872	75%	0.753	S	S	*	*	S	Bend	trans	-59.1	139.1	178.2	-57.7	-141.2	-59	0	0	108.7
25	D	54	Low	52.6	Low	145 Å²	145	125.2 Å²	125.2	78%	0.775	76%	0.757	S	S	*	*			trans	81.9	85.5	-179.4	-149.7	-102.9	0	0	0	115.9	T23	T23-D25 PolarHBondContact O-N 2.93Å
26	Q	45.1	Very low	51.8	Low	180 Å²	180	129.6 Å²	129.6	84%	0.841	76%	0.764	S	S	*	*			trans	-154.1	111.6	137.8	-97.3	-120.6	61.5	0	0	109.4
27	E	44.5	Very low	51.3	Low	152 Å²	152	128.8 Å²	128.8	71%	0.71	76%	0.762	S	S	*	*			trans	-46.2	136.4	167.1	-77.8	-81.8	92.2	0	0	111.4	V29	E27-V29 PolarHBondContact O-N 3.31Å
28	P	52.7	Low	51.3	Low	129 Å²	129	130.5 Å²	130.5	84%	0.838	77%	0.769	S	S	*	*			trans	-78.1	76.3	173.1	33.1	-31.4	0	0	0	109
29	V	46.7	Very low	51.2	Low	132 Å²	132	129.2 Å²	129.2	80%	0.8	77%	0.767	S	S	*	*			trans	-96.8	110.8	175	100.9	0	0	0	0	110.7	E27	E27-V29 PolarHBondContact O-N 3.31Å
30	G	52.4	Low	51.5	Low	78 Å²	78	125.9 Å²	125.9	80%	0.804	75%	0.754	S	S	*	*			trans	62.1	111.2	136.8	0	0	0	0	0	118.7
31	G	56.4	Low	51.2	Low	71 Å²	71	124.4 Å²	124.4	73%	0.732	75%	0.749	S	S	*	*			trans	127.6	84.3	147.5	0	0	0	0	0	114.2	E33	G31-E33 PolarHBondContact O-N 3.43Å
32	V	53.8	Low	51.6	Low	141 Å²	141	122.2 Å²	122.2	86%	0.855	74%	0.735	S	S	*	*			trans	-71.7	76.6	155.6	179.4	0	0	0	0	107.2	R34	V32-R34 HydrophobicContact CG1-CB 4.11Å; V32-R34 PolarHBondContact O-N 3.35Å; V32-R34 VanDerWaalsContact O-N 3.08Å
33	E	45.8	Very low	51.8	Low	193 Å²	193	119.8 Å²	119.8	90%	0.902	73%	0.726	S	S	*	*			trans	-81.3	78.6	160.3	-83.9	-162.5	84.7	0	0	108.7	G31 G35	G31-E33 PolarHBondContact O-N 3.43Å; E33-G35 PolarHBondContact O-N 3.4Å; E33-G35 VanDerWaalsContact O-N 3.17Å
34	R	61.7	Low	52	Low	238 Å²	238	116.9 Å²	116.9	90%	0.898	72%	0.715	S	S	*	*			trans	-61.4	100.4	165.1	176.3	-175.7	-175.3	171.8	1.7	108.4	V32	V32-R34 HydrophobicContact CG1-CB 4.11Å; V32-R34 PolarHBondContact O-N 3.35Å; V32-R34 VanDerWaalsContact O-N 3.08Å
35	G	58.2	Low	51.6	Low	59 Å²	59	110.5 Å²	110.5	61%	0.608	69%	0.69	S	S	*	*	S	Bend	trans	-177.6	-50.7	171.4	0	0	0	0	0	117.9	E33	E33-G35 PolarHBondContact O-N 3.4Å; E33-G35 VanDerWaalsContact O-N 3.17Å
36	E	45.7	Very low	51.5	Low	172 Å²	172	106.4 Å²	106.4	80%	0.804	68%	0.677	S	S	*	*	S	Bend	trans	-112	-23.9	-158.5	-156.7	88.4	154.6	0	0	114.3
37	A	47.8	Very low	52	Low	76 Å²	76	101 Å²	101	63%	0.628	66%	0.663	S	S	*	*	H	α-helix	trans	-81.5	-19.7	-176.1	0	0	0	0	0	114.2	A39 A40 S41	A37-A39 VanDerWaalsContact C-N 3.33Å; A37-A39 PolarHBondContact O-N 3.47Å; A37-A40 PolarHBondContact O-N 3.44Å; A37-S41 WeakPolarHBondContact O-CB 3.5Å; A37-S41 PolarHBondContact O-N 2.85Å
38	V	49.4	Very low	52.6	Low	117 Å²	117	96.8 Å²	96.8	71%	0.709	65%	0.654	S	S	*	*	H	α-helix	trans	-70.5	-31.9	-176.9	-178.4	0	0	0	0	111.3	G42	V38-G42 PolarHBondContact O-N 2.9Å
39	A	49.6	Very low	52.7	Low	78 Å²	78	98.2 Å²	98.2	65%	0.645	65%	0.647	S	S	*	*	H	α-helix	trans	-68.8	-41	176	0	0	0	0	0	112.2	A37 A43	A37-A39 VanDerWaalsContact C-N 3.33Å; A37-A39 PolarHBondContact O-N 3.47Å; A39-A43 PolarHBondContact O-N 2.98Å
40	A	51.6	Low	53.1	Low	66 Å²	66	94 Å²	94	55%	0.545	63%	0.631	S	S	.	*	H	α-helix	trans	-70.2	-37.5	174.9	0	0	0	0	0	112.2	A37 G42 A43 A44	A37-A40 PolarHBondContact O-N 3.44Å; A40-G42 PolarHBondContact O-N 2.99Å; A40-A43 PolarHBondContact O-N 3.29Å; A40-A44 PolarHBondContact O-N 3.23Å; A40-A44 VanDerWaalsContact O-N 3.13Å
41	S	49.3	Very low	53.2	Low	82 Å²	82	96.8 Å²	96.8	57%	0.573	62%	0.623	S	S	*	*	H	α-helix	trans	-65.4	-34.9	175.6	-173.2	0	0	0	0	112.8	A37 A45	A37-S41 WeakPolarHBondContact O-CB 3.5Å; A37-S41 PolarHBondContact O-N 2.85Å; S41-A45 WeakPolarHBondContact O-CB 3.5Å; S41-A45 PolarHBondContact O-N 3.48Å; S41-A45 VanDerWaalsContact O-N 3.13Å
42	G	52.9	Low	53.1	Low	42 Å²	42	96.6 Å²	96.6	43%	0.433	61%	0.611	S	S	.	*	H	α-helix	trans	-70.6	-38.6	176.4	0	0	0	0	0	113.2	V38 A40 A45 A46	V38-G42 PolarHBondContact O-N 2.9Å; A40-G42 PolarHBondContact O-N 2.99Å; G42-A45 PolarHBondContact O-N 3.49Å; G42-A46 WeakPolarHBondContact O-CB 3.49Å; G42-A46 PolarHBondContact O-N 3.29Å
43	A	56.1	Low	53.2	Low	63 Å²	63	92.8 Å²	92.8	52%	0.521	59%	0.594	S	S	.	*	H	α-helix	trans	-68.8	-40.9	177.2	0	0	0	0	0	112.5	A39 A40 A46 A47	A39-A43 PolarHBondContact O-N 2.98Å; A40-A43 PolarHBondContact O-N 3.29Å; A43-A46 PolarHBondContact O-N 3.07Å; A43-A47 WeakPolarHBondContact O-CB 3.37Å; A43-A47 PolarHBondContact O-N 2.89Å
44	A	56.4	Low	53.8	Low	64 Å²	64	85.3 Å²	85.3	53%	0.529	57%	0.569	S	S	.	*	H	α-helix	trans	-65.8	-39.6	175.1	0	0	0	0	0	112.2	A40 A47 A48	A40-A44 PolarHBondContact O-N 3.23Å; A40-A44 VanDerWaalsContact O-N 3.13Å; A44-A47 PolarHBondContact O-N 3.11Å; A44-A48 PolarHBondContact O-N 2.81Å
45	A	52.9	Low	53.7	Low	42 Å²	42	79.2 Å²	79.2	35%	0.347	55%	0.551	S	S	.	*	H	α-helix	trans	-63.8	-44.5	173.1	0	0	0	0	0	111.5	S41 G42 A47 A48 F49	S41-A45 WeakPolarHBondContact O-CB 3.5Å; S41-A45 PolarHBondContact O-N 3.48Å; S41-A45 VanDerWaalsContact O-N 3.13Å; G42-A45 PolarHBondContact O-N 3.49Å; A45-A47 VanDerWaalsContact C-N 3.32Å; A45-A47 PolarHBondContact O-N 2.95Å; A45-A48 PolarHBondContact O-N 3.2Å; A45-F49 HydrophobicContact CB-CE2 4.42Å; A45-F49 WeakPolarHBondContact O-CD2 3.38Å; A45-F49 PolarHBondContact O-N 3Å
46	A	53.5	Low	53.6	Low	60 Å²	60	81 Å²	81	50%	0.496	55%	0.547	S	S	.	.	H	α-helix	trans	-62.5	-36.1	176.4	0	0	0	0	0	112.8	G42 A43 F49 G50	G42-A46 WeakPolarHBondContact O-CB 3.49Å; G42-A46 PolarHBondContact O-N 3.29Å; A43-A46 PolarHBondContact O-N 3.07Å; A46-F49 PolarHBondContact O-N 3.12Å; A46-G50 PolarHBondContact O-N 3.3Å
47	A	55.8	Low	54.2	Low	66 Å²	66	79 Å²	79	55%	0.545	54%	0.54	S	S	.	.	H	α-helix	trans	-65.1	-42.2	173.3	0	0	0	0	0	112	A43 A44 A45 F49 G50 E51	A43-A47 WeakPolarHBondContact O-CB 3.37Å; A43-A47 PolarHBondContact O-N 2.89Å; A44-A47 PolarHBondContact O-N 3.11Å; A45-A47 VanDerWaalsContact C-N 3.32Å; A45-A47 PolarHBondContact O-N 2.95Å; A47-F49 PolarHBondContact O-N 2.91Å; A47-G50 PolarHBondContact O-N 3.17Å; A47-E51 WeakPolarHBondContact O-CB 3.32Å; A47-E51 PolarHBondContact O-N 3.47Å
48	A	57	Low	54.8	Low	64 Å²	64	80.3 Å²	80.3	53%	0.529	54%	0.541	S	S	.	.	H	α-helix	trans	-64.5	-38.2	175.1	0	0	0	0	0	112.5	A44 A45 S52	A44-A48 PolarHBondContact O-N 2.81Å; A45-A48 PolarHBondContact O-N 3.2Å; A48-S52 WeakPolarHBondContact O-CB 3.36Å; A48-S52 PolarHBondContact O-N 3.47Å; A48-S52 VanDerWaalsContact O-N 3.13Å
49	F	54	Low	55.4	Low	158 Å²	158	79.6 Å²	79.6	69%	0.693	53%	0.533	S	S	*	.	H	α-helix	trans	-68.8	-38.5	173.5	-74.1	-65.7	0	0	0	112.5	A45 A46 A47 A53	A45-F49 HydrophobicContact CB-CE2 4.42Å; A45-F49 WeakPolarHBondContact O-CD2 3.38Å; A45-F49 PolarHBondContact O-N 3Å; A46-F49 PolarHBondContact O-N 3.12Å; A47-F49 PolarHBondContact O-N 2.91Å; F49-A53 WeakPolarHBondContact O-CB 3.49Å; F49-A53 PolarHBondContact O-N 2.93Å
50	G	56	Low	56.4	Low	45 Å²	45	79.5 Å²	79.5	46%	0.464	52%	0.521	S	S	.	.	H	α-helix	trans	-66.8	-39.9	176.7	0	0	0	0	0	113.2	A46 A47 A53 G54	A46-G50 PolarHBondContact O-N 3.3Å; A47-G50 PolarHBondContact O-N 3.17Å; G50-A53 PolarHBondContact O-N 3.33Å; G50-G54 PolarHBondContact O-N 2.99Å
51	E	53	Low	57.5	Low	135 Å²	135	80.2 Å²	80.2	63%	0.631	52%	0.52	S	S	*	.	H	α-helix	trans	-68.8	-43.9	177.3	-173.5	124.5	102.1	0	0	111.5	A47 A53 G54 Q55	A47-E51 WeakPolarHBondContact O-CB 3.32Å; A47-E51 PolarHBondContact O-N 3.47Å; E51-A53 PolarHBondContact O-N 3.03Å; E51-G54 PolarHBondContact O-N 2.91Å; E51-Q55 WeakPolarHBondContact O-CB 3.38Å; E51-Q55 WeakPolarHBondContact O-CG 3.45Å; E51-Q55 PolarHBondContact O-N 3.02Å
52	S	54.3	Low	58.6	Low	67 Å²	67	84.7 Å²	84.7	47%	0.469	52%	0.524	S	S	.	.	H	α-helix	trans	-61.1	-41.5	174.4	-179.9	0	0	0	0	112.4	A48 Q55 N56	A48-S52 WeakPolarHBondContact O-CB 3.36Å; A48-S52 PolarHBondContact O-N 3.47Å; A48-S52 VanDerWaalsContact O-N 3.13Å; S52-Q55 PolarHBondContact O-N 3.5Å; S52-N56 WeakPolarHBondContact O-CB 3.37Å; S52-N56 PolarHBondContact O-N 3.24Å
53	A	56.8	Low	59.6	Low	62 Å²	62	88.7 Å²	88.7	51%	0.512	54%	0.535	S	S	.	.	H	α-helix	trans	-64.6	-39.7	175.6	0	0	0	0	0	112.5	F49 G50 E51 N56 L57	F49-A53 WeakPolarHBondContact O-CB 3.49Å; F49-A53 PolarHBondContact O-N 2.93Å; G50-A53 PolarHBondContact O-N 3.33Å; E51-A53 PolarHBondContact O-N 3.03Å; A53-N56 PolarHBondContact O-N 3.44Å; A53-L57 WeakPolarHBondContact O-CB 3.47Å; A53-L57 PolarHBondContact O-N 3.05Å
54	G	58.2	Low	60.5	Low	36 Å²	36	92 Å²	92	37%	0.371	54%	0.538	S	S	.	.	H	α-helix	trans	-68.4	-39	176.7	0	0	0	0	0	113.7	G50 E51 T58	G50-G54 PolarHBondContact O-N 2.99Å; E51-G54 PolarHBondContact O-N 2.91Å; G54-T58 PolarHBondContact O-N 3.13Å; G54-T58 PolarHBondContact O-OG1 3.41Å
55	Q	58.3	Low	61.3	Low	110 Å²	110	95.8 Å²	95.8	51%	0.514	54%	0.542	S	S	.	.	H	α-helix	trans	-64.8	-42.7	173.9	-67.4	167.2	10.1	0	0	111.3	E51 S52 T58 L59	E51-Q55 WeakPolarHBondContact O-CB 3.38Å; E51-Q55 WeakPolarHBondContact O-CG 3.45Å; E51-Q55 PolarHBondContact O-N 3.02Å; S52-Q55 PolarHBondContact O-N 3.5Å; Q55-T58 PolarHBondContact O-N 3.39Å; Q55-L59 VanDerWaalsContact O-CG 3.31Å; Q55-L59 WeakPolarHBondContact O-CG 3.31Å; Q55-L59 PolarHBondContact O-N 3.3Å
56	N	56.3	Low	62.4	Low	97 Å²	97	99.5 Å²	99.5	52%	0.519	55%	0.554	S	S	.	*	H	α-helix	trans	-66.4	-42.1	179.5	-159.2	-75.3	0	0	0	112	S52 A53 T58 L59 L60	S52-N56 WeakPolarHBondContact O-CB 3.37Å; S52-N56 PolarHBondContact O-N 3.24Å; A53-N56 PolarHBondContact O-N 3.44Å; N56-T58 PolarHBondContact O-N 2.93Å; N56-L59 PolarHBondContact O-N 2.86Å; N56-L60 WeakPolarHBondContact O-CB 3.05Å; N56-L60 PolarHBondContact O-N 3.42Å
57	L	58.3	Low	63.2	Low	128 Å²	128	99.7 Å²	99.7	67%	0.67	56%	0.556	S	S	*	*	H	α-helix	trans	-64.4	-30.3	176.8	-164.8	69.3	0	0	0	112.3	A53 P61	A53-L57 WeakPolarHBondContact O-CB 3.47Å; A53-L57 PolarHBondContact O-N 3.05Å; L57-P61 WeakPolarHBondContact O-CD 3.49Å
58	T	60.9	Low	63.8	Low	105 Å²	105	105.7 Å²	105.7	64%	0.644	56%	0.564	S	S	*	*	H	α-helix	trans	-77.8	-33.1	175.5	-57.2	0	0	0	0	112.6	G54 Q55 N56	G54-T58 PolarHBondContact O-N 3.13Å; G54-T58 PolarHBondContact O-OG1 3.41Å; Q55-T58 PolarHBondContact O-N 3.39Å; N56-T58 PolarHBondContact O-N 2.93Å
59	L	62.4	Low	64.4	Low	102 Å²	102	105.1 Å²	105.1	53%	0.534	56%	0.557	S	S	.	*	H	α-helix	trans	-80.5	-26.5	178.5	-69.6	176.1	0	0	0	113.3	Q55 N56 R62 L63	Q55-L59 VanDerWaalsContact O-CG 3.31Å; Q55-L59 WeakPolarHBondContact O-CG 3.31Å; Q55-L59 PolarHBondContact O-N 3.3Å; N56-L59 PolarHBondContact O-N 2.86Å; L59-R62 PolarHBondContact O-N 3.2Å; L59-R62 VanDerWaalsContact O-N 3.11Å; L59-L63 WeakPolarHBondContact O-CB 3.15Å; L59-L63 PolarHBondContact O-N 3.49Å
60	L	71.4	Confident	64.8	Low	75 Å²	75	107.2 Å²	107.2	39%	0.393	56%	0.56	S	S	.	*	H	α-helix	trans	-57	-47.7	-179.4	-119.1	144.7	0	0	0	113.7	N56 R62 K64	N56-L60 WeakPolarHBondContact O-CB 3.05Å; N56-L60 PolarHBondContact O-N 3.42Å; L60-R62 VanDerWaalsContact C-N 3.35Å; L60-K64 WeakPolarHBondContact O-CG 3.49Å; L60-K64 PolarHBondContact O-N 3.06Å; L60-K64 VanDerWaalsContact O-N 3.12Å
61	P	73.9	Confident	65	Low	82 Å²	82	110.9 Å²	110.9	53%	0.532	57%	0.568	S	S	.	*	H	α-helix	trans	-64.4	-38.5	173.1	-22.4	33.5	0	0	0	112.4	L57 K64 F65	L57-P61 WeakPolarHBondContact O-CD 3.49Å; P61-K64 PolarHBondContact O-N 2.96Å; P61-F65 WeakPolarHBondContact O-CB 3.44Å; P61-F65 PolarHBondContact O-N 3.5Å
62	R	73	Confident	65.2	Low	175 Å²	175	107 Å²	107	66%	0.66	56%	0.559	S	S	*	*	H	α-helix	trans	-69	-40.3	-177.4	-145.5	-176.4	-174.9	151.1	2.5	112	L59 L60 F65 M66	L59-R62 PolarHBondContact O-N 3.2Å; L59-R62 VanDerWaalsContact O-N 3.11Å; L60-R62 VanDerWaalsContact C-N 3.35Å; R62-F65 WeakPolarHBondContact O-CB 3.4Å; R62-F65 PolarHBondContact O-N 3.13Å; R62-M66 WeakPolarHBondContact O-CG 3.49Å; R62-M66 PolarHBondContact O-N 3.36Å
63	L	72.2	Confident	65.3	Low	126 Å²	126	106.9 Å²	106.9	66%	0.66	56%	0.562	S	S	*	*	H	α-helix	trans	-67.5	-41.4	174.9	-171.6	66.4	0	0	0	111.4	L59 F65 M66 A67	L59-L63 WeakPolarHBondContact O-CB 3.15Å; L59-L63 PolarHBondContact O-N 3.49Å; L63-F65 VanDerWaalsContact C-N 3.3Å; L63-F65 PolarHBondContact O-N 3.13Å; L63-M66 PolarHBondContact O-N 3.44Å; L63-A67 WeakPolarHBondContact O-CB 3.42Å; L63-A67 PolarHBondContact O-N 2.94Å
64	K	75.4	Confident	65.4	Low	133 Å²	133	107.6 Å²	107.6	58%	0.578	56%	0.56	S	S	*	*	H	α-helix	trans	-59.9	-39.8	171.8	-81.5	179	179.4	174.5	0	111.9	L60 P61 R68	L60-K64 WeakPolarHBondContact O-CG 3.49Å; L60-K64 PolarHBondContact O-N 3.06Å; L60-K64 VanDerWaalsContact O-N 3.12Å; P61-K64 PolarHBondContact O-N 2.96Å; K64-R68 WeakPolarHBondContact O-CB 3.36Å; K64-R68 VanDerWaalsContact O-CG 3.32Å; K64-R68 WeakPolarHBondContact O-CG 3.4Å; K64-R68 PolarHBondContact O-N 3.49Å
65	F	73.8	Confident	65.1	Low	143 Å²	143	109.1 Å²	109.1	63%	0.627	57%	0.565	S	S	*	*	H	α-helix	trans	-66.2	-41.7	176.3	-175.6	-94.7	0	0	0	112.4	P61 R62 L63 R68 S69	P61-F65 WeakPolarHBondContact O-CB 3.44Å; P61-F65 PolarHBondContact O-N 3.5Å; R62-F65 WeakPolarHBondContact O-CB 3.4Å; R62-F65 PolarHBondContact O-N 3.13Å; L63-F65 VanDerWaalsContact C-N 3.3Å; L63-F65 PolarHBondContact O-N 3.13Å; F65-R68 PolarHBondContact O-N 3.44Å; F65-S69 WeakPolarHBondContact O-CB 3.38Å; F65-S69 PolarHBondContact O-N 2.68Å; F65-S69 PolarHBondContact O-OG 2.92Å
66	M	75.6	Confident	64.9	Low	121 Å²	121	107.5 Å²	107.5	60%	0.596	56%	0.563	S	S	*	*	H	α-helix	trans	-65.7	-43.3	175.5	-74.1	-166.9	169.3	0	0	112.4	R62 L63 R68 S69 R70	R62-M66 WeakPolarHBondContact O-CG 3.49Å; R62-M66 PolarHBondContact O-N 3.36Å; L63-M66 PolarHBondContact O-N 3.44Å; M66-R68 VanDerWaalsContact C-N 3.34Å; M66-R68 PolarHBondContact O-N 3.47Å; M66-S69 PolarHBondContact O-N 3.35Å; M66-R70 WeakPolarHBondContact O-CB 3.35Å; M66-R70 PolarHBondContact O-N 3.29Å
67	A	71.3	Confident	64.7	Low	64 Å²	64	106.5 Å²	106.5	53%	0.529	56%	0.564	S	S	.	*	H	α-helix	trans	-61.5	-42.3	175.6	0	0	0	0	0	111.9	L63 R70 L71	L63-A67 WeakPolarHBondContact O-CB 3.42Å; L63-A67 PolarHBondContact O-N 2.94Å; A67-R70 PolarHBondContact O-N 3.48Å; A67-L71 PolarHBondContact O-N 2.98Å; A67-L71 VanDerWaalsContact O-N 3.07Å
68	R	68	Low	64.5	Low	191 Å²	191	109.8 Å²	109.8	72%	0.721	57%	0.567	S	S	*	*	H	α-helix	trans	-66.3	-42.8	175	-77.3	179.5	172.2	-176.2	-2.7	112.8	K64 F65 M66 R70 L71 A72	K64-R68 WeakPolarHBondContact O-CB 3.36Å; K64-R68 VanDerWaalsContact O-CG 3.32Å; K64-R68 WeakPolarHBondContact O-CG 3.4Å; K64-R68 PolarHBondContact O-N 3.49Å; F65-R68 PolarHBondContact O-N 3.44Å; M66-R68 VanDerWaalsContact C-N 3.34Å; M66-R68 PolarHBondContact O-N 3.47Å; R68-R70 VanDerWaalsContact C-N 3.33Å; R68-R70 PolarHBondContact O-N 2.9Å; R68-L71 PolarHBondContact O-N 2.9Å; R68-A72 WeakPolarHBondContact O-CB 3.28Å; R68-A72 PolarHBondContact O-N 2.88Å
69	S	68.4	Low	64.3	Low	53 Å²	53	108.8 Å²	108.8	37%	0.371	56%	0.561	S	S	.	*	H	α-helix	trans	-64.1	-38.9	176.6	-67.5	0	0	0	0	111.9	F65 M66 L71 A72 A73	F65-S69 WeakPolarHBondContact O-CB 3.38Å; F65-S69 PolarHBondContact O-N 2.68Å; F65-S69 PolarHBondContact O-OG 2.92Å; M66-S69 PolarHBondContact O-N 3.35Å; S69-L71 VanDerWaalsContact C-N 3.35Å; S69-A72 PolarHBondContact O-N 3.42Å; S69-A73 WeakPolarHBondContact O-CB 3.32Å; S69-A73 PolarHBondContact O-N 3Å
70	R	63.3	Low	63.9	Low	201 Å²	201	109.5 Å²	109.5	76%	0.758	56%	0.561	S	S	*	*	H	α-helix	trans	-65.3	-39	175.9	-162.2	-179.6	-171.5	-164.7	2.9	111.8	M66 A67 R68 T74	M66-R70 WeakPolarHBondContact O-CB 3.35Å; M66-R70 PolarHBondContact O-N 3.29Å; A67-R70 PolarHBondContact O-N 3.48Å; R68-R70 VanDerWaalsContact C-N 3.33Å; R68-R70 PolarHBondContact O-N 2.9Å; R70-T74 WeakPolarHBondContact O-CG2 3Å; R70-T74 PolarHBondContact O-N 3.02Å; R70-T74 PolarHBondContact O-OG1 3.31Å
71	L	60.6	Low	63.2	Low	122 Å²	122	109.3 Å²	109.3	64%	0.639	57%	0.571	S	S	*	*	H	α-helix	trans	-68.6	-36.1	174.2	-172.2	64.5	0	0	0	112.2	A67 R68 S69 T74 S75	A67-L71 PolarHBondContact O-N 2.98Å; A67-L71 VanDerWaalsContact O-N 3.07Å; R68-L71 PolarHBondContact O-N 2.9Å; S69-L71 VanDerWaalsContact C-N 3.35Å; L71-T74 WeakPolarHBondContact CA-OG1 3.39Å; L71-T74 PolarHBondContact O-OG1 3.39Å; L71-S75 WeakPolarHBondContact O-CB 3.48Å; L71-S75 PolarHBondContact O-N 2.97Å
72	A	57.4	Low	62.5	Low	54 Å²	54	112.3 Å²	112.3	45%	0.446	58%	0.581	S	S	.	*	H	α-helix	trans	-65.5	-45.5	175.3	0	0	0	0	0	111.3	R68 S69 T74 S75 T76	R68-A72 WeakPolarHBondContact O-CB 3.28Å; R68-A72 PolarHBondContact O-N 2.88Å; S69-A72 PolarHBondContact O-N 3.42Å; A72-T74 VanDerWaalsContact C-N 3.33Å; A72-T74 PolarHBondContact O-N 3.42Å; A72-S75 WeakPolarHBondContact O-CB 3.4Å; A72-S75 PolarHBondContact O-N 3.47Å; A72-S75 VanDerWaalsContact O-N 3.14Å; A72-T76 PolarHBondContact O-N 2.96Å; A72-T76 PolarHBondContact O-OG1 3.19Å
73	A	56.3	Low	61.8	Low	65 Å²	65	110.7 Å²	110.7	54%	0.537	58%	0.584	S	S	.	*	H	α-helix	trans	-62.2	-36.7	177.9	0	0	0	0	0	113	S69 S77	S69-A73 WeakPolarHBondContact O-CB 3.32Å; S69-A73 PolarHBondContact O-N 3Å; A73-S77 WeakPolarHBondContact O-CB 3.28Å; A73-S77 PolarHBondContact O-N 3.36Å
74	T	57.3	Low	61.2	Low	76 Å²	76	110.4 Å²	110.4	47%	0.466	58%	0.583	S	S	.	*	H	α-helix	trans	-75.8	-28.4	175.2	56.8	0	0	0	0	112.5	R70 L71 A72 R78	R70-T74 WeakPolarHBondContact O-CG2 3Å; R70-T74 PolarHBondContact O-N 3.02Å; R70-T74 PolarHBondContact O-OG1 3.31Å; L71-T74 WeakPolarHBondContact CA-OG1 3.39Å; L71-T74 PolarHBondContact O-OG1 3.39Å; A72-T74 VanDerWaalsContact C-N 3.33Å; A72-T74 PolarHBondContact O-N 3.42Å; T74-R78 PolarHBondContact O-N 3.05Å; T74-R78 VanDerWaalsContact O-N 3.12Å
75	S	53.2	Low	60.5	Low	68 Å²	68	109.5 Å²	109.5	48%	0.476	59%	0.591	S	S	.	*	H	α-helix	trans	-68.2	-45.2	173.7	-173.5	0	0	0	0	111.9	L71 A72 S77 R78 V79	L71-S75 WeakPolarHBondContact O-CB 3.48Å; L71-S75 PolarHBondContact O-N 2.97Å; A72-S75 WeakPolarHBondContact O-CB 3.4Å; A72-S75 PolarHBondContact O-N 3.47Å; A72-S75 VanDerWaalsContact O-N 3.14Å; S75-S77 VanDerWaalsContact C-N 3.27Å; S75-S77 PolarHBondContact O-N 3.06Å; S75-R78 PolarHBondContact O-N 2.82Å; S75-V79 WeakPolarHBondContact O-CG2 3.37Å; S75-V79 PolarHBondContact O-N 2.9Å; S75-V79 VanDerWaalsContact O-N 3.08Å
76	T	53.8	Low	60	Low	76 Å²	76	111.4 Å²	111.4	47%	0.466	60%	0.602	S	S	.	*	H	α-helix	trans	-64.3	-35.1	176.9	-16	0	0	0	0	111.6	A72 Q80	A72-T76 PolarHBondContact O-N 2.96Å; A72-T76 PolarHBondContact O-OG1 3.19Å; T76-Q80 WeakPolarHBondContact O-CB 3.44Å; T76-Q80 VanDerWaalsContact O-CG 3.3Å; T76-Q80 WeakPolarHBondContact O-CG 3.23Å; T76-Q80 PolarHBondContact O-N 3.12Å
77	S	52.8	Low	59.5	Low	76 Å²	76	111 Å²	111	53%	0.531	61%	0.608	S	S	.	*	H	α-helix	trans	-66.1	-38.4	175.2	178.5	0	0	0	0	112.8	A73 S75 A81	A73-S77 WeakPolarHBondContact O-CB 3.28Å; A73-S77 PolarHBondContact O-N 3.36Å; S75-S77 VanDerWaalsContact C-N 3.27Å; S75-S77 PolarHBondContact O-N 3.06Å; S77-A81 WeakPolarHBondContact O-CB 3.45Å; S77-A81 PolarHBondContact O-N 2.87Å
78	R	53.2	Low	59.3	Low	197 Å²	197	114 Å²	114	74%	0.743	62%	0.622	S	S	*	*	H	α-helix	trans	-69.9	-40.5	175.2	-87.1	-170.1	177.3	-178.8	-0.3	113.2	T74 S75 Q80 A81 I82	T74-R78 PolarHBondContact O-N 3.05Å; T74-R78 VanDerWaalsContact O-N 3.12Å; S75-R78 PolarHBondContact O-N 2.82Å; R78-Q80 VanDerWaalsContact C-N 3.34Å; R78-A81 PolarHBondContact O-N 3.03Å; R78-I82 WeakPolarHBondContact O-CD1 3.33Å; R78-I82 VanDerWaalsContact O-CG1 3.31Å; R78-I82 WeakPolarHBondContact O-CG1 3.36Å; R78-I82 PolarHBondContact O-N 3.29Å
79	V	57.1	Low	59.2	Low	84 Å²	84	115.2 Å²	115.2	51%	0.509	65%	0.65	S	S	.	*	H	α-helix	trans	-66.4	-39.6	178.2	176.4	0	0	0	0	110.7	S75 I82 L83	S75-V79 WeakPolarHBondContact O-CG2 3.37Å; S75-V79 PolarHBondContact O-N 2.9Å; S75-V79 VanDerWaalsContact O-N 3.08Å; V79-I82 PolarHBondContact O-N 2.87Å; V79-L83 PolarHBondContact O-N 3.17Å; V79-L83 VanDerWaalsContact O-N 3.14Å
80	Q	53.8	Low	58.7	Low	117 Å²	117	118.4 Å²	118.4	55%	0.547	66%	0.664	S	S	.	*	H	α-helix	trans	-67.8	-39.2	175	-72.5	176.9	35.5	0	0	112.6	T76 R78 I82 L83 L84	T76-Q80 WeakPolarHBondContact O-CB 3.44Å; T76-Q80 VanDerWaalsContact O-CG 3.3Å; T76-Q80 WeakPolarHBondContact O-CG 3.23Å; T76-Q80 PolarHBondContact O-N 3.12Å; R78-Q80 VanDerWaalsContact C-N 3.34Å; Q80-I82 VanDerWaalsContact C-N 3.26Å; Q80-I82 PolarHBondContact O-N 2.8Å; Q80-L83 PolarHBondContact O-N 3.08Å; Q80-L84 WeakPolarHBondContact O-CB 3.37Å; Q80-L84 WeakPolarHBondContact O-CD1 3.3Å; Q80-L84 PolarHBondContact O-N 3.48Å
81	A	56.6	Low	58.5	Low	72 Å²	72	114 Å²	114	60%	0.595	66%	0.659	S	S	*	*	H	α-helix	trans	-64.7	-28	177.4	0	0	0	0	0	113.6	S77 R78	S77-A81 WeakPolarHBondContact O-CB 3.45Å; S77-A81 PolarHBondContact O-N 2.87Å; R78-A81 PolarHBondContact O-N 3.03Å
82	I	59.1	Low	58.4	Low	144 Å²	144	113.6 Å²	113.6	74%	0.738	66%	0.661	S	S	*	*	H	α-helix	trans	-84.2	-31.4	177.1	-62.9	165.1	0	0	0	111.2	R78 V79 Q80	R78-I82 WeakPolarHBondContact O-CD1 3.33Å; R78-I82 VanDerWaalsContact O-CG1 3.31Å; R78-I82 WeakPolarHBondContact O-CG1 3.36Å; R78-I82 PolarHBondContact O-N 3.29Å; V79-I82 PolarHBondContact O-N 2.87Å; Q80-I82 VanDerWaalsContact C-N 3.26Å; Q80-I82 PolarHBondContact O-N 2.8Å
83	L	58.8	Low	58.4	Low	141 Å²	141	117.1 Å²	117.1	74%	0.738	67%	0.673	S	S	*	*	H	α-helix	trans	-85.9	-11.3	179.6	-113.9	94.7	0	0	0	114.6	V79 Q80 P85	V79-L83 PolarHBondContact O-N 3.17Å; V79-L83 VanDerWaalsContact O-N 3.14Å; Q80-L83 PolarHBondContact O-N 3.08Å; L83-P85 WeakPolarHBondContact O-CD 3.43Å
84	L	58.5	Low	58.6	Low	121 Å²	121	120.3 Å²	120.3	63%	0.634	68%	0.682	S	S	*	*	S	Bend	trans	-76	116.9	178.5	-103	145.9	0	0	0	109.9	Q80 Q86	Q80-L84 WeakPolarHBondContact O-CB 3.37Å; Q80-L84 WeakPolarHBondContact O-CD1 3.3Å; Q80-L84 PolarHBondContact O-N 3.48Å; L84-Q86 PolarHBondContact O-N 2.89Å
85	P	61.1	Low	58.6	Low	114 Å²	114	123.3 Å²	123.3	74%	0.74	70%	0.696	S	S	*	*	P	Polyproline II helix	trans	-64.6	131.6	172.5	9.7	-2.7	0	0	0	109	L83	L83-P85 WeakPolarHBondContact O-CD 3.43Å
86	Q	63.9	Low	59	Low	183 Å²	183	127.2 Å²	127.2	86%	0.855	71%	0.712	S	S	*	*	P	Polyproline II helix	trans	-61.5	132.2	174.6	-66.4	-164.6	-34.1	0	0	109.5	L84	L84-Q86 PolarHBondContact O-N 2.89Å
87	P	65.1	Low	59.4	Low	111 Å²	111	131.2 Å²	131.2	72%	0.721	73%	0.731	S	S	*	*	P	Polyproline II helix	trans	-64	132.7	176.5	25.6	-31.7	0	0	0	109.4	V89	P87-V89 PolarHBondContact O-N 2.91Å
88	P	66.9	Low	60	Low	128 Å²	128	135.8 Å²	135.8	83%	0.831	75%	0.747	S	S	*	*	P	Polyproline II helix	trans	-65.8	128.3	175.8	26.5	-30.7	0	0	0	109.3
89	V	65.7	Low	60.6	Low	217 Å²	217	130.2 Å²	130.2	100%	1.315	75%	0.748	S	S	*	*			trans	-75	0	168.4	-71.8	0	0	0	0	111.4	P87	P87-V89 PolarHBondContact O-N 2.91Å

Retrieved 89 of 89 residues in 15.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).