A0A087X229_HUMAN Loading...

Phosphodiesterase 4D interacting protein

AlphaFold DB , UniProt , Accession A0A087X229, Species HUMAN (Homo sapiens, Human), Gene PDE4DIP, Length 137 aa.

						>A0A087X229_HUMAN|A0A087X229|PDE4DIP
MEQTWTRDYFAEDDGEMVPRTSHTAAFLSDTKDRGPPVQSQIWRSGEKVPFVQTYSLRAFEKPPQQQVALLDLQSALFCSQLEIQKLQRVVRQKERQLADAKQCVQFVEAAAHESEQQKEASWKHNQELRKALQQLQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	38.2	Very low	45.5	Very low	236 Å²	236	165.3 Å²	165.3	100%	1.163	80%	0.804	S	S	*	*				0	73.7	0	-62.3	-158.3	-81.1	0	0	105.9
2	E	42.3	Very low	45.9	Very low	192 Å²	192	163.8 Å²	163.8	90%	0.897	80%	0.795	S	S	*	*				83.7	113.2	94.1	-79.1	-163.2	152.7	0	0	111.3
3	Q	44.4	Very low	46.4	Very low	153 Å²	153	163.6 Å²	163.6	72%	0.715	80%	0.8	S	S	*	*			trans	-76	139.5	-171.6	-64.3	-81.1	27.7	0	0	110.5	W5	Q3-W5 VanDerWaalsContact O-CD1 3.29Å; Q3-W5 PolarHBondContact O-N 3.21Å
4	T	46.7	Very low	46.6	Very low	132 Å²	132	161.7 Å²	161.7	81%	0.81	80%	0.795	S	S	*	*			trans	-74.2	108.8	174.6	49.2	0	0	0	0	110.6
5	W	46.6	Very low	47	Very low	208 Å²	208	155.9 Å²	155.9	79%	0.788	79%	0.794	S	S	*	*			trans	-113.3	81.2	171.4	-59.4	94.4	0	0	0	110.1	Q3	Q3-W5 VanDerWaalsContact O-CD1 3.29Å; Q3-W5 PolarHBondContact O-N 3.21Å
6	T	46.7	Very low	47.3	Very low	122 Å²	122	157.2 Å²	157.2	75%	0.748	80%	0.796	S	S	*	*			trans	-92.9	95.4	156.9	-45	0	0	0	0	105.8
7	R	47.1	Very low	47.6	Very low	169 Å²	169	159.4 Å²	159.4	64%	0.638	81%	0.805	S	S	*	*			trans	-111.1	95.6	172.7	-173.7	159.3	152.5	153.1	-17	106.7	Y9	R7-Y9 HydrophobicContact CG-CD2 3.9Å; R7-Y9 HydrophobicContact CG-CE2 3.64Å; R7-Y9 PolarHBondContact NE-OH 3.15Å; R7-Y9 PolarHBondContact NH2-OH 3.48Å; R7-Y9 PolarHBondContact O-N 3.21Å
8	D	47.3	Very low	47.7	Very low	144 Å²	144	156.1 Å²	156.1	77%	0.77	79%	0.794	S	S	*	*			trans	-58.7	113.1	173.5	-59.8	-47.2	0	0	0	109
9	Y	48.3	Very low	47.7	Very low	170 Å²	170	154.2 Å²	154.2	67%	0.667	79%	0.793	S	S	*	*			trans	-113.5	72.3	170.8	-89.7	-75.3	0	0	0	108.6	R7	R7-Y9 HydrophobicContact CG-CD2 3.9Å; R7-Y9 HydrophobicContact CG-CE2 3.64Å; R7-Y9 PolarHBondContact NE-OH 3.15Å; R7-Y9 PolarHBondContact NH2-OH 3.48Å; R7-Y9 PolarHBondContact O-N 3.21Å
10	F	47.2	Very low	47.6	Very low	196 Å²	196	158 Å²	158	86%	0.86	80%	0.797	S	S	*	*			trans	-136.3	88.1	157.6	-92.6	-86.3	0	0	0	106.7
11	A	46.2	Very low	48	Very low	96 Å²	96	155.6 Å²	155.6	79%	0.793	79%	0.79	S	S	*	*			trans	-123	108.6	158.7	0	0	0	0	0	105.3	D13	A11-D13 PolarHBondContact O-N 3.46Å
12	E	49.4	Very low	48.2	Very low	147 Å²	147	149.2 Å²	149.2	69%	0.687	77%	0.769	S	S	*	*			trans	-52.9	120.7	167.9	-53.1	-68.4	137.1	0	0	108.1
13	D	53.2	Low	48.3	Very low	162 Å²	162	149.2 Å²	149.2	87%	0.866	77%	0.769	S	S	*	*			trans	-107.4	94.1	169	-168.7	30.4	0	0	0	107.3	A11 G15	A11-D13 PolarHBondContact O-N 3.46Å; D13-G15 PolarHBondContact O-N 2.95Å
14	D	49.5	Very low	48.2	Very low	137 Å²	137	148.2 Å²	148.2	73%	0.733	77%	0.773	S	S	*	*			trans	-72.9	117.4	179.8	-66.4	-45.5	0	0	0	110.5
15	G	52.3	Low	48	Very low	75 Å²	75	145.6 Å²	145.6	77%	0.773	77%	0.765	S	S	*	*			trans	11.4	115.5	163.5	0	0	0	0	0	121.4	D13	D13-G15 PolarHBondContact O-N 2.95Å
16	E	51.4	Low	48.2	Very low	176 Å²	176	140 Å²	140	82%	0.822	76%	0.763	S	S	*	*			trans	-163.5	109.2	130.1	-129.5	-178.2	172.7	0	0	111.3	V18	E16-V18 HydrophobicContact CB-CG2 4.25Å; E16-V18 HydrophobicContact CG-CG2 4.2Å; E16-V18 PolarHBondContact O-N 3.03Å
17	M	52.2	Low	47.9	Very low	194 Å²	194	142.9 Å²	142.9	96%	0.956	77%	0.766	S	S	*	*			trans	-83.2	97.8	163.2	-81.4	-126.9	-84.3	0	0	108.4	P19	M17-P19 WeakPolarHBondContact O-CD 3.4Å
18	V	50.4	Low	47.9	Very low	101 Å²	101	143.1 Å²	143.1	61%	0.612	78%	0.779	S	S	*	*			trans	-89.6	114.1	174	-178.4	0	0	0	0	109.9	E16 R20	E16-V18 HydrophobicContact CB-CG2 4.25Å; E16-V18 HydrophobicContact CG-CG2 4.2Å; E16-V18 PolarHBondContact O-N 3.03Å; V18-R20 PolarHBondContact O-N 3.41Å
19	P	46	Very low	47.7	Very low	119 Å²	119	140.8 Å²	140.8	77%	0.773	77%	0.774	S	S	*	*			trans	-75	119.4	170.4	-6.4	23.8	0	0	0	109.5	M17 T21	M17-P19 WeakPolarHBondContact O-CD 3.4Å; P19-T21 PolarHBondContact O-N 3.11Å
20	R	46.6	Very low	47.7	Very low	231 Å²	231	139.2 Å²	139.2	87%	0.872	78%	0.777	S	S	*	*			trans	-73.2	98.9	173.8	-97	179.8	101.5	111.1	-3.9	111.3	V18	V18-R20 PolarHBondContact O-N 3.41Å
21	T	56.7	Low	47.7	Very low	107 Å²	107	135.7 Å²	135.7	66%	0.656	77%	0.772	S	S	*	*			trans	61.1	108.5	137.6	66.1	0	0	0	0	119.3	P19	P19-T21 PolarHBondContact O-N 3.11Å
22	S	40.8	Very low	47.9	Very low	103 Å²	103	140 Å²	140	72%	0.72	77%	0.772	S	S	*	*			trans	-32.4	131.1	150.4	-46.2	0	0	0	0	115.5
23	H	45.7	Very low	48	Very low	191 Å²	191	140.6 Å²	140.6	88%	0.884	78%	0.78	S	S	*	*			trans	-124.3	108.3	138.8	-77.4	-61.9	0	0	0	109.4
24	T	42.2	Very low	47.8	Very low	132 Å²	132	144.4 Å²	144.4	81%	0.81	78%	0.782	S	S	*	*			trans	-77.8	129.2	169.4	-52.6	0	0	0	0	109.3
25	A	43	Very low	48	Very low	78 Å²	78	141 Å²	141	65%	0.645	78%	0.779	S	S	*	*			trans	-164.6	112.4	139.2	0	0	0	0	0	109.6	F27	A25-F27 HydrophobicContact CB-CE2 4.23Å
26	A	50	Low	47.6	Very low	89 Å²	89	143.3 Å²	143.3	74%	0.736	78%	0.781	S	S	*	*			trans	-66.7	132.4	164.7	0	0	0	0	0	109.7
27	F	40.9	Very low	47.4	Very low	184 Å²	184	141.2 Å²	141.2	81%	0.807	78%	0.783	S	S	*	*			trans	-127.9	92.6	152.7	-73.7	-76.2	0	0	0	108.1	A25 S29	A25-F27 HydrophobicContact CB-CE2 4.23Å; F27-S29 PolarHBondContact O-N 3.39Å
28	L	46.7	Very low	46.9	Very low	174 Å²	174	138.5 Å²	138.5	91%	0.911	78%	0.777	S	S	*	*			trans	-67.3	109.7	148.3	-78.8	163.5	0	0	0	106.1
29	S	43.1	Very low	46.7	Very low	95 Å²	95	140.6 Å²	140.6	66%	0.664	78%	0.78	S	S	*	*			trans	-120.8	101.6	158.5	-68.8	0	0	0	0	107.2	F27 T31	F27-S29 PolarHBondContact O-N 3.39Å; S29-T31 PolarHBondContact O-N 3.22Å
30	D	47.4	Very low	47.1	Very low	136 Å²	136	141.1 Å²	141.1	73%	0.727	79%	0.786	S	S	*	*			trans	-48.5	116.9	158.6	175.2	37.4	0	0	0	109.6	K32	D30-K32 PolarHBondContact OD1-N 2.77Å
31	T	47.9	Very low	47.5	Very low	123 Å²	123	136.6 Å²	136.6	76%	0.755	78%	0.775	S	S	*	*			trans	-135.2	78.5	152.5	63.5	0	0	0	0	107.5	S29 D33	S29-T31 PolarHBondContact O-N 3.22Å; T31-D33 PolarHBondContact O-N 3.23Å
32	K	49.3	Very low	47.4	Very low	185 Å²	185	138.9 Å²	138.9	80%	0.804	78%	0.782	S	S	*	*			trans	-40.8	133.1	145	-108.9	170.6	172.8	173.7	0	108.9	D30	D30-K32 PolarHBondContact OD1-N 2.77Å
33	D	52.8	Low	47.6	Very low	160 Å²	160	145.2 Å²	145.2	86%	0.856	79%	0.79	S	S	*	*			trans	78.6	77.5	166.3	-155.3	39	0	0	0	117.9	T31	T31-D33 PolarHBondContact O-N 3.23Å
34	R	47.8	Very low	48.1	Very low	242 Å²	242	147 Å²	147	91%	0.913	79%	0.789	S	S	*	*			trans	-150.1	134.6	148.6	-123.2	176.3	-178.5	174.8	0.8	110.4
35	G	55.4	Low	48.5	Very low	65 Å²	65	146.5 Å²	146.5	67%	0.67	79%	0.791	S	S	*	*			trans	-61.9	-171.1	-170.1	0	0	0	0	0	117.1
36	P	43.5	Very low	49	Very low	125 Å²	125	146.5 Å²	146.5	81%	0.812	80%	0.799	S	S	*	*	S	Bend	trans	-66.4	153.8	-157.7	28.5	-34.1	0	0	0	113.3	V38	P36-V38 PolarHBondContact O-N 2.88Å
37	P	46.5	Very low	48.8	Very low	132 Å²	132	150.5 Å²	150.5	86%	0.857	80%	0.802	S	S	*	*			trans	-71.1	122.3	-162.6	28.9	-33.6	0	0	0	111.4
38	V	42.5	Very low	49.5	Very low	137 Å²	137	151.7 Å²	151.7	83%	0.83	81%	0.807	S	S	*	*			trans	-90.3	113.6	172.4	98.3	0	0	0	0	109.8	P36	P36-V38 PolarHBondContact O-N 2.88Å
39	Q	45.8	Very low	49.7	Very low	144 Å²	144	148.4 Å²	148.4	67%	0.673	79%	0.794	S	S	*	*			trans	18.8	113.9	156.2	-76.9	-175	-19.3	0	0	119.7	Q41	Q39-Q41 HydrophobicContact CB-CG 4.29Å; Q39-Q41 PolarHBondContact O-N 2.86Å
40	S	53.3	Low	50.2	Low	130 Å²	130	149 Å²	149	91%	0.909	80%	0.795	S	S	*	*			trans	-57.8	97.2	154.8	-56.9	0	0	0	0	111.4
41	Q	55.1	Low	50.6	Low	137 Å²	137	148.6 Å²	148.6	64%	0.64	79%	0.787	S	S	*	*			trans	-115.8	76.7	167.3	-65.5	-165.8	12.5	0	0	110.1	Q39	Q39-Q41 HydrophobicContact CB-CG 4.29Å; Q39-Q41 PolarHBondContact O-N 2.86Å
42	I	56.5	Low	50.9	Low	154 Å²	154	148.2 Å²	148.2	79%	0.79	78%	0.784	S	S	*	*			trans	-119.4	42.8	165.8	-139.8	158.7	0	0	0	110.5
43	W	44.4	Very low	50.9	Low	237 Å²	237	147.2 Å²	147.2	90%	0.898	78%	0.783	S	S	*	*			trans	-133.1	44.7	166.8	-72	104.7	0	0	0	111.1
44	R	55.8	Low	51	Low	227 Å²	227	142.9 Å²	142.9	86%	0.857	76%	0.762	S	S	*	*			trans	-141.8	61.5	174.4	-65	-72	-170.6	-123.3	1.7	109.7
45	S	49.7	Very low	51.3	Low	123 Å²	123	137.7 Å²	137.7	86%	0.86	74%	0.744	S	S	*	*			trans	-120	116.9	155	-168.3	0	0	0	0	108.2	E47	S45-E47 PolarHBondContact O-N 3.49Å
46	G	55	Low	51.4	Low	78 Å²	78	138.5 Å²	138.5	80%	0.804	74%	0.739	S	S	*	*			trans	-77.4	108.3	-178.8	0	0	0	0	0	110.6
47	E	44.8	Very low	51.8	Low	173 Å²	173	139.1 Å²	139.1	81%	0.808	74%	0.735	S	S	*	*			trans	-134.9	101.4	150.7	-150.5	169.2	-178.4	0	0	106.3	S45 V49	S45-E47 PolarHBondContact O-N 3.49Å; E47-V49 PolarHBondContact O-N 3.01Å
48	K	56.1	Low	52.2	Low	209 Å²	209	140.7 Å²	140.7	91%	0.909	72%	0.723	S	S	*	*			trans	-68.3	87.7	176	-80.8	176.8	178.2	-106.3	0	107.5	P50	K48-P50 VanDerWaalsContact O-CD 3.25Å; K48-P50 WeakPolarHBondContact O-CD 3.17Å
49	V	51.4	Low	52.8	Low	104 Å²	104	136.8 Å²	136.8	63%	0.63	71%	0.705	S	S	*	*			trans	-72.7	115.1	164	-160.9	0	0	0	0	106.7	E47 F51	E47-V49 PolarHBondContact O-N 3.01Å; V49-F51 HydrophobicContact CB-CB 4.33Å; V49-F51 HydrophobicContact CG1-CB 3.4Å; V49-F51 VanDerWaalsContact CG1-CB 3.4Å; V49-F51 HydrophobicContact CG1-CG 4.48Å; V49-F51 PolarHBondContact O-N 3.41Å
50	P	53.8	Low	53.1	Low	107 Å²	107	136.9 Å²	136.9	70%	0.695	70%	0.704	S	S	*	*			trans	-80.1	55.8	172.5	35.8	-32.3	0	0	0	108.5	K48	K48-P50 VanDerWaalsContact O-CD 3.25Å; K48-P50 WeakPolarHBondContact O-CD 3.17Å
51	F	54.7	Low	53.3	Low	128 Å²	128	137 Å²	137	56%	0.561	69%	0.69	S	S	*	*	S	Bend	trans	-119.9	8.7	-172.8	-166.8	-99.3	0	0	0	113.8	V49 Y55	V49-F51 HydrophobicContact CB-CB 4.33Å; V49-F51 HydrophobicContact CG1-CB 3.4Å; V49-F51 VanDerWaalsContact CG1-CB 3.4Å; V49-F51 HydrophobicContact CG1-CG 4.48Å; V49-F51 PolarHBondContact O-N 3.41Å; F51-Y55 HydrophobicContact CD2-CE2 4.25Å; F51-Y55 HydrophobicContact CE1-CE2 4.44Å; F51-Y55 HydrophobicContact CE2-CE2 4.21Å; F51-Y55 WeakPolarHBondContact CE2-OH 3.36Å; F51-Y55 HydrophobicContact CG-CE2 4.4Å; F51-Y55 HydrophobicContact CZ-CE2 4.3Å; F51-Y55 WeakPolarHBondContact CZ-OH 3.4Å; F51-Y55 WeakPolarHBondContact O-CD2 3.25Å; F51-Y55 WeakPolarHBondContact O-CE2 3.33Å
52	V	54.1	Low	53.7	Low	115 Å²	115	136.5 Å²	136.5	70%	0.697	69%	0.686	S	S	*	*	S	Bend	trans	-127.8	-19.9	172.7	-168	0	0	0	0	112.3
53	Q	50.6	Low	54.4	Low	165 Å²	165	132.4 Å²	132.4	77%	0.771	67%	0.67	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.9	-14	-174.4	-155	154.7	45.4	0	0	114.2
54	T	52.9	Low	55.9	Low	69 Å²	69	125.2 Å²	125.2	42%	0.423	65%	0.653	S	S	.	*	T	Hydrogen-bonded Turn	trans	-89.3	-16.7	-178.4	41.3	0	0	0	0	114.1
55	Y	54.7	Low	57.3	Low	133 Å²	133	120 Å²	120	52%	0.522	64%	0.639	S	S	.	*	H	α-helix	trans	-84.2	-29.5	-178.2	-60.7	-75.4	0	0	0	113	F51	F51-Y55 HydrophobicContact CD2-CE2 4.25Å; F51-Y55 HydrophobicContact CE1-CE2 4.44Å; F51-Y55 HydrophobicContact CE2-CE2 4.21Å; F51-Y55 WeakPolarHBondContact CE2-OH 3.36Å; F51-Y55 HydrophobicContact CG-CE2 4.4Å; F51-Y55 HydrophobicContact CZ-CE2 4.3Å; F51-Y55 WeakPolarHBondContact CZ-OH 3.4Å; F51-Y55 WeakPolarHBondContact O-CD2 3.25Å; F51-Y55 WeakPolarHBondContact O-CE2 3.33Å
56	S	57.6	Low	59	Low	81 Å²	81	116.5 Å²	116.5	57%	0.566	61%	0.609	S	S	*	*	H	α-helix	trans	-75.9	-25.7	-176.7	-50.7	0	0	0	0	114.2
57	L	53.2	Low	60.6	Low	139 Å²	139	119.1 Å²	119.1	73%	0.728	60%	0.6	S	S	*	*	H	α-helix	trans	-93.9	-18	-176.4	-70.5	170.7	0	0	0	113.7
58	R	54.4	Low	62.9	Low	164 Å²	164	114.8 Å²	114.8	62%	0.619	59%	0.585	S	S	*	*	H	α-helix	trans	-89.5	-21.1	179.6	-124.1	-168	-61.6	-179.9	0.8	114.4	F60 E61	R58-F60 PolarHBondContact O-N 3.29Å; R58-E61 HydrophobicContact CG-CG 4.02Å; R58-E61 WeakPolarHBondContact CG-OE1 3.39Å; R58-E61 WeakPolarHBondContact CG-OE2 3.01Å; R58-E61 PolarHBondContact O-N 2.85Å
59	A	55.1	Low	64.6	Low	55 Å²	55	107.5 Å²	107.5	46%	0.455	56%	0.564	S	S	.	*	G	3₁₀ helix	trans	-58.5	-33.3	176.9	0	0	0	0	0	111.4	Q66	A59-Q66 WeakPolarHBondContact O-CG 3.4Å; A59-Q66 PolarHBondContact O-NE2 2.87Å
60	F	52.5	Low	66.7	Low	146 Å²	146	108 Å²	108	64%	0.64	56%	0.562	S	S	*	*	G	3₁₀ helix	trans	-87.8	5.8	-178.1	-64.2	-80.4	0	0	0	115.7	R58 K62	R58-F60 PolarHBondContact O-N 3.29Å; F60-K62 PolarHBondContact O-N 2.96Å
61	E	55.8	Low	68.7	Low	134 Å²	134	107.7 Å²	107.7	63%	0.626	55%	0.554	S	S	*	*	G	3₁₀ helix	trans	-70.2	-13.4	-178.9	-75.9	-172.5	177.6	0	0	113.7	R58	R58-E61 HydrophobicContact CG-CG 4.02Å; R58-E61 WeakPolarHBondContact CG-OE1 3.39Å; R58-E61 WeakPolarHBondContact CG-OE2 3.01Å; R58-E61 PolarHBondContact O-N 2.85Å
62	K	64.1	Low	70.7	Confident	125 Å²	125	106.2 Å²	106.2	54%	0.543	55%	0.552	S	S	.	*			trans	-131.5	72.6	177.3	-59.1	-176.7	-171.1	171	0	111.1	F60 P64 Q65 Q66	F60-K62 PolarHBondContact O-N 2.96Å; K62-P64 VanDerWaalsContact C-N 3.34Å; K62-Q65 HydrophobicContact CB-CB 4.21Å; K62-Q65 HydrophobicContact CB-CG 4.41Å; K62-Q65 VanDerWaalsContact CB-OE1 3.25Å; K62-Q65 PolarHBondContact O-N 2.73Å; K62-Q66 PolarHBondContact O-N 3.46Å
63	P	72.1	Confident	72.8	Confident	69 Å²	69	105.6 Å²	105.6	45%	0.448	55%	0.545	S	S	.	.	H	α-helix	trans	-48.8	-42.5	-177.4	-10	10.5	0	0	0	115.3	Q65 Q66 Q67	P63-Q65 VanDerWaalsContact C-N 3.33Å; P63-Q65 PolarHBondContact O-N 3.37Å; P63-Q66 PolarHBondContact O-N 3.31Å; P63-Q67 WeakPolarHBondContact O-CG 3.36Å; P63-Q67 PolarHBondContact O-N 3.33Å; P63-Q67 VanDerWaalsContact O-N 3.11Å
64	P	76.1	Confident	75	Confident	85 Å²	85	104 Å²	104	55%	0.552	54%	0.537	S	S	*	.	H	α-helix	trans	-68	-32.3	-179	24.1	-32.8	0	0	0	112.8	K62 Q67 V68	K62-P64 VanDerWaalsContact C-N 3.34Å; P64-Q67 PolarHBondContact O-N 3.09Å; P64-V68 WeakPolarHBondContact O-CG2 3.21Å; P64-V68 PolarHBondContact O-N 3.19Å; P64-V68 VanDerWaalsContact O-N 3.15Å
65	Q	84.5	Confident	77.2	Confident	119 Å²	119	103.4 Å²	103.4	56%	0.556	54%	0.536	S	S	*	.	H	α-helix	trans	-76.3	-34.3	-179.4	-68.4	165.9	-1.6	0	0	111.8	K62 P63 A69	K62-Q65 HydrophobicContact CB-CB 4.21Å; K62-Q65 HydrophobicContact CB-CG 4.41Å; K62-Q65 VanDerWaalsContact CB-OE1 3.25Å; K62-Q65 PolarHBondContact O-N 2.73Å; P63-Q65 VanDerWaalsContact C-N 3.33Å; P63-Q65 PolarHBondContact O-N 3.37Å; Q65-A69 WeakPolarHBondContact O-CB 3.14Å; Q65-A69 PolarHBondContact O-N 2.78Å
66	Q	85.9	Confident	79.2	Confident	48 Å²	48	99.5 Å²	99.5	22%	0.224	53%	0.531	C	S	.	.	H	α-helix	trans	-65.8	-40.5	171.2	-72.6	-178.2	-52.8	0	0	112.2	A59 K62 P63 V68 A69 L70	A59-Q66 WeakPolarHBondContact O-CG 3.4Å; A59-Q66 PolarHBondContact O-NE2 2.87Å; K62-Q66 PolarHBondContact O-N 3.46Å; P63-Q66 PolarHBondContact O-N 3.31Å; Q66-V68 VanDerWaalsContact C-N 3.34Å; Q66-V68 PolarHBondContact O-N 3.35Å; Q66-A69 PolarHBondContact O-N 2.91Å; Q66-L70 WeakPolarHBondContact O-CB 3.49Å; Q66-L70 WeakPolarHBondContact O-CG 3.49Å; Q66-L70 PolarHBondContact O-N 3.46Å
67	Q	88.6	Confident	81.2	Confident	134 Å²	134	100.1 Å²	100.1	63%	0.626	53%	0.527	S	S	*	.	H	α-helix	trans	-62.8	-41.9	177.2	-73.5	179.5	21.9	0	0	111.8	P63 P64 L70 L71	P63-Q67 WeakPolarHBondContact O-CG 3.36Å; P63-Q67 PolarHBondContact O-N 3.33Å; P63-Q67 VanDerWaalsContact O-N 3.11Å; P64-Q67 PolarHBondContact O-N 3.09Å; Q67-L70 PolarHBondContact O-N 2.88Å; Q67-L71 PolarHBondContact O-N 3.37Å
68	V	91.8	Very high	83.4	Confident	82 Å²	82	99.9 Å²	99.9	50%	0.497	52%	0.521	S	S	.	.	H	α-helix	trans	-62.8	-48.8	173.9	174.3	0	0	0	0	110.7	P64 Q66 L70 L71 D72	P64-V68 WeakPolarHBondContact O-CG2 3.21Å; P64-V68 PolarHBondContact O-N 3.19Å; P64-V68 VanDerWaalsContact O-N 3.15Å; Q66-V68 VanDerWaalsContact C-N 3.34Å; Q66-V68 PolarHBondContact O-N 3.35Å; V68-L70 VanDerWaalsContact C-N 3.28Å; V68-L70 PolarHBondContact O-N 3.19Å; V68-L71 WeakPolarHBondContact O-CB 3.36Å; V68-L71 PolarHBondContact O-N 2.85Å; V68-L71 VanDerWaalsContact O-N 3.09Å; V68-D72 PolarHBondContact O-N 2.93Å
69	A	92.6	Very high	85.5	Confident	55 Å²	55	95.9 Å²	95.9	46%	0.455	52%	0.517	S	S	.	.	H	α-helix	trans	-60.9	-35.6	178.4	0	0	0	0	0	113.1	Q65 Q66 L73	Q65-A69 WeakPolarHBondContact O-CB 3.14Å; Q65-A69 PolarHBondContact O-N 2.78Å; Q66-A69 PolarHBondContact O-N 2.91Å; A69-L73 WeakPolarHBondContact O-CB 3.36Å; A69-L73 PolarHBondContact O-N 2.93Å
70	L	95.1	Very high	87.5	Confident	116 Å²	116	96.3 Å²	96.3	61%	0.607	52%	0.517	S	S	*	.	H	α-helix	trans	-67.9	-40.1	174.6	-74.5	170.8	0	0	0	111.9	Q66 Q67 V68 L73 Q74	Q66-L70 WeakPolarHBondContact O-CB 3.49Å; Q66-L70 WeakPolarHBondContact O-CG 3.49Å; Q66-L70 PolarHBondContact O-N 3.46Å; Q67-L70 PolarHBondContact O-N 2.88Å; V68-L70 VanDerWaalsContact C-N 3.28Å; V68-L70 PolarHBondContact O-N 3.19Å; L70-L73 PolarHBondContact O-N 3.5Å; L70-Q74 WeakPolarHBondContact O-CB 3.43Å; L70-Q74 PolarHBondContact O-N 3.27Å
71	L	96.3	Very high	89.7	Confident	99 Å²	99	94.9 Å²	94.9	52%	0.518	51%	0.512	S	S	.	.	H	α-helix	trans	-66.5	-40.8	175.7	-176.3	63.6	0	0	0	111.5	Q67 V68 Q74 S75	Q67-L71 PolarHBondContact O-N 3.37Å; V68-L71 WeakPolarHBondContact O-CB 3.36Å; V68-L71 PolarHBondContact O-N 2.85Å; V68-L71 VanDerWaalsContact O-N 3.09Å; L71-Q74 PolarHBondContact O-N 3.32Å; L71-S75 WeakPolarHBondContact O-CB 3.39Å; L71-S75 PolarHBondContact O-N 3.4Å; L71-S75 PolarHBondContact O-OG 2.94Å
72	D	97	Very high	91.8	Very high	98 Å²	98	91.6 Å²	91.6	52%	0.524	50%	0.498	S	S	.	.	H	α-helix	trans	-63.1	-44.6	175.8	-70	-26.1	0	0	0	110.8	V68 S75 A76	V68-D72 PolarHBondContact O-N 2.93Å; D72-S75 PolarHBondContact O-N 3.3Å; D72-A76 WeakPolarHBondContact O-CB 3.49Å; D72-A76 PolarHBondContact O-N 2.95Å
73	L	97.4	Very high	93.4	Very high	102 Å²	102	89.8 Å²	89.8	53%	0.534	49%	0.492	S	S	.	.	H	α-helix	trans	-62.6	-44.7	176.3	-177.5	65.3	0	0	0	111.5	A69 L70 S75 A76 L77	A69-L73 WeakPolarHBondContact O-CB 3.36Å; A69-L73 PolarHBondContact O-N 2.93Å; L70-L73 PolarHBondContact O-N 3.5Å; L73-S75 VanDerWaalsContact C-N 3.32Å; L73-S75 PolarHBondContact O-N 3.47Å; L73-A76 PolarHBondContact O-N 3.31Å; L73-L77 HydrophobicContact CG-CD1 4.21Å; L73-L77 WeakPolarHBondContact O-CB 3.35Å; L73-L77 VanDerWaalsContact O-CG 3.27Å; L73-L77 WeakPolarHBondContact O-CG 3.27Å; L73-L77 PolarHBondContact O-N 2.97Å
74	Q	97.9	Very high	94.7	Very high	132 Å²	132	91 Å²	91	62%	0.617	49%	0.494	S	S	*	.	H	α-helix	trans	-61.2	-43	176.9	-175.4	179.2	70.4	0	0	111.4	L70 L71 L77 F78	L70-Q74 WeakPolarHBondContact O-CB 3.43Å; L70-Q74 PolarHBondContact O-N 3.27Å; L71-Q74 PolarHBondContact O-N 3.32Å; Q74-L77 PolarHBondContact O-N 2.99Å; Q74-F78 PolarHBondContact O-N 3.4Å
75	S	97.9	Very high	95.7	Very high	56 Å²	56	91.6 Å²	91.6	39%	0.392	49%	0.489	S	S	.	.	H	α-helix	trans	-64.1	-44.8	177.4	-57.6	0	0	0	0	111.4	L71 D72 L73 L77 F78 C79	L71-S75 WeakPolarHBondContact O-CB 3.39Å; L71-S75 PolarHBondContact O-N 3.4Å; L71-S75 PolarHBondContact O-OG 2.94Å; D72-S75 PolarHBondContact O-N 3.3Å; L73-S75 VanDerWaalsContact C-N 3.32Å; L73-S75 PolarHBondContact O-N 3.47Å; S75-L77 PolarHBondContact O-N 2.77Å; S75-F78 PolarHBondContact O-N 3.36Å; S75-C79 WeakPolarHBondContact O-CB 3.49Å; S75-C79 PolarHBondContact O-N 2.96Å; S75-C79 PolarHBondContact O-SG 3.32Å; S75-C79 VanDerWaalsContact O-SG 3.32Å
76	A	98.3	Very high	96.4	Very high	51 Å²	51	90.4 Å²	90.4	42%	0.421	48%	0.482	S	S	.	.	H	α-helix	trans	-62.9	-40.3	176.9	0	0	0	0	0	112.4	D72 L73 C79 S80	D72-A76 WeakPolarHBondContact O-CB 3.49Å; D72-A76 PolarHBondContact O-N 2.95Å; L73-A76 PolarHBondContact O-N 3.31Å; A76-C79 PolarHBondContact O-N 3.43Å; A76-S80 WeakPolarHBondContact O-CB 3.44Å; A76-S80 PolarHBondContact O-N 3.29Å; A76-S80 PolarHBondContact O-OG 3.06Å
77	L	98.6	Very high	97	Very high	94 Å²	94	92.5 Å²	92.5	49%	0.492	49%	0.494	S	S	.	.	H	α-helix	trans	-62.9	-45.8	175.1	-75.3	171.6	0	0	0	111.3	L73 Q74 S75 S80 Q81	L73-L77 HydrophobicContact CG-CD1 4.21Å; L73-L77 WeakPolarHBondContact O-CB 3.35Å; L73-L77 VanDerWaalsContact O-CG 3.27Å; L73-L77 WeakPolarHBondContact O-CG 3.27Å; L73-L77 PolarHBondContact O-N 2.97Å; Q74-L77 PolarHBondContact O-N 2.99Å; S75-L77 PolarHBondContact O-N 2.77Å; L77-S80 PolarHBondContact O-N 3.47Å; L77-Q81 WeakPolarHBondContact O-CB 3.36Å; L77-Q81 VanDerWaalsContact O-CG 3.26Å; L77-Q81 WeakPolarHBondContact O-CG 3.26Å; L77-Q81 PolarHBondContact O-N 2.94Å
78	F	98.6	Very high	97.5	Very high	133 Å²	133	91.2 Å²	91.2	58%	0.583	49%	0.488	S	S	*	.	H	α-helix	trans	-61.5	-48	177.1	178.9	-98.9	0	0	0	111.8	Q74 S75 S80 Q81 L82	Q74-F78 PolarHBondContact O-N 3.4Å; S75-F78 PolarHBondContact O-N 3.36Å; F78-S80 VanDerWaalsContact C-N 3.32Å; F78-S80 PolarHBondContact O-N 3.34Å; F78-Q81 PolarHBondContact O-N 3Å; F78-L82 PolarHBondContact O-N 3.21Å
79	C	98.6	Very high	97.8	Very high	80 Å²	80	94.7 Å²	94.7	54%	0.541	49%	0.492	S	S	.	.	H	α-helix	trans	-57.6	-45.3	176.5	-72.6	0	0	0	0	111.9	S75 A76 L82 E83	S75-C79 WeakPolarHBondContact O-CB 3.49Å; S75-C79 PolarHBondContact O-N 2.96Å; S75-C79 PolarHBondContact O-SG 3.32Å; S75-C79 VanDerWaalsContact O-SG 3.32Å; A76-C79 PolarHBondContact O-N 3.43Å; C79-L82 PolarHBondContact O-N 2.95Å; C79-E83 PolarHBondContact O-N 2.86Å
80	S	98.4	Very high	98.1	Very high	65 Å²	65	95.4 Å²	95.4	46%	0.455	49%	0.491	S	S	.	.	H	α-helix	trans	-63.7	-42.7	178.9	-57.8	0	0	0	0	112	A76 L77 F78 L82 E83 I84	A76-S80 WeakPolarHBondContact O-CB 3.44Å; A76-S80 PolarHBondContact O-N 3.29Å; A76-S80 PolarHBondContact O-OG 3.06Å; L77-S80 PolarHBondContact O-N 3.47Å; F78-S80 VanDerWaalsContact C-N 3.32Å; F78-S80 PolarHBondContact O-N 3.34Å; S80-L82 VanDerWaalsContact C-N 3.34Å; S80-L82 PolarHBondContact O-N 3.34Å; S80-E83 PolarHBondContact O-N 3.06Å; S80-I84 VanDerWaalsContact O-CG1 3.29Å; S80-I84 WeakPolarHBondContact O-CG1 3.49Å; S80-I84 PolarHBondContact O-N 3.48Å
81	Q	98.8	Very high	98.3	Very high	116 Å²	116	93.7 Å²	93.7	54%	0.542	49%	0.485	S	S	.	.	H	α-helix	trans	-62.2	-41.8	176.4	-73.2	171.7	19.5	0	0	111.8	L77 F78 I84 Q85	L77-Q81 WeakPolarHBondContact O-CB 3.36Å; L77-Q81 VanDerWaalsContact O-CG 3.26Å; L77-Q81 WeakPolarHBondContact O-CG 3.26Å; L77-Q81 PolarHBondContact O-N 2.94Å; F78-Q81 PolarHBondContact O-N 3Å; Q81-I84 PolarHBondContact O-N 3.11Å; Q81-Q85 WeakPolarHBondContact O-CG 3.33Å; Q81-Q85 PolarHBondContact O-N 3.46Å
82	L	98.8	Very high	98.4	Very high	64 Å²	64	96.7 Å²	96.7	34%	0.335	49%	0.49	S	S	.	.	H	α-helix	trans	-64	-42.6	176.3	179.8	62.1	0	0	0	111.6	F78 C79 S80 Q85 K86	F78-L82 PolarHBondContact O-N 3.21Å; C79-L82 PolarHBondContact O-N 2.95Å; S80-L82 VanDerWaalsContact C-N 3.34Å; S80-L82 PolarHBondContact O-N 3.34Å; L82-Q85 PolarHBondContact O-N 3.41Å; L82-K86 WeakPolarHBondContact O-CG 3.29Å; L82-K86 PolarHBondContact O-N 3.01Å
83	E	98.6	Very high	98.5	Very high	87 Å²	87	96.6 Å²	96.6	41%	0.407	49%	0.486	S	S	.	.	H	α-helix	trans	-63.5	-42.9	178	-167.8	56	-147.2	0	0	111.3	C79 S80 Q85 K86 L87	C79-E83 PolarHBondContact O-N 2.86Å; S80-E83 PolarHBondContact O-N 3.06Å; E83-Q85 VanDerWaalsContact C-N 3.28Å; E83-Q85 PolarHBondContact O-N 3.39Å; E83-K86 WeakPolarHBondContact O-CB 3.46Å; E83-K86 PolarHBondContact O-N 2.83Å; E83-K86 VanDerWaalsContact O-N 3.11Å; E83-K86 IonicContact OE2-NZ 3.86Å; E83-L87 HydrophobicContact CG-CD1 4.23Å; E83-L87 HydrophobicContact CG-CG 4.44Å; E83-L87 WeakPolarHBondContact O-CB 3.46Å; E83-L87 WeakPolarHBondContact O-CG 3.46Å; E83-L87 PolarHBondContact O-N 3.06Å
84	I	98.5	Very high	98.6	Very high	96 Å²	96	97.5 Å²	97.5	49%	0.492	49%	0.486	S	S	.	.	H	α-helix	trans	-55.9	-44.9	173	-70.3	164.7	0	0	0	110.7	S80 Q81 K86 L87 Q88	S80-I84 VanDerWaalsContact O-CG1 3.29Å; S80-I84 WeakPolarHBondContact O-CG1 3.49Å; S80-I84 PolarHBondContact O-N 3.48Å; Q81-I84 PolarHBondContact O-N 3.11Å; I84-K86 PolarHBondContact O-N 3.16Å; I84-L87 PolarHBondContact O-N 3.32Å; I84-Q88 WeakPolarHBondContact O-CB 3.38Å; I84-Q88 VanDerWaalsContact O-CG 3.29Å; I84-Q88 WeakPolarHBondContact O-CG 3.35Å; I84-Q88 PolarHBondContact O-N 3.4Å
85	Q	98.8	Very high	98.6	Very high	97 Å²	97	96.9 Å²	96.9	45%	0.453	48%	0.483	S	S	.	.	H	α-helix	trans	-65	-38.4	177.8	-72.6	-173.7	1.7	0	0	113	Q81 L82 E83 R89	Q81-Q85 WeakPolarHBondContact O-CG 3.33Å; Q81-Q85 PolarHBondContact O-N 3.46Å; L82-Q85 PolarHBondContact O-N 3.41Å; E83-Q85 VanDerWaalsContact C-N 3.28Å; E83-Q85 PolarHBondContact O-N 3.39Å; Q85-R89 WeakPolarHBondContact O-CG 3.49Å; Q85-R89 PolarHBondContact O-N 3.24Å
86	K	98.6	Very high	98.6	Very high	94 Å²	94	101 Å²	101	41%	0.409	49%	0.49	S	S	.	.	H	α-helix	trans	-64.4	-48	175.4	-72.1	174.4	-177	170.8	0	110.8	L82 E83 I84 Q88 R89 V90	L82-K86 WeakPolarHBondContact O-CG 3.29Å; L82-K86 PolarHBondContact O-N 3.01Å; E83-K86 WeakPolarHBondContact O-CB 3.46Å; E83-K86 PolarHBondContact O-N 2.83Å; E83-K86 VanDerWaalsContact O-N 3.11Å; E83-K86 IonicContact OE2-NZ 3.86Å; I84-K86 PolarHBondContact O-N 3.16Å; K86-Q88 VanDerWaalsContact C-N 3.3Å; K86-Q88 PolarHBondContact O-N 3.48Å; K86-R89 WeakPolarHBondContact O-CB 3.29Å; K86-R89 PolarHBondContact O-N 2.88Å; K86-V90 WeakPolarHBondContact O-CG2 3.49Å; K86-V90 PolarHBondContact O-N 3.13Å
87	L	98.7	Very high	98.6	Very high	92 Å²	92	102.6 Å²	102.6	48%	0.482	49%	0.488	S	S	.	.	H	α-helix	trans	-60.8	-40.4	178.5	-68.3	176.2	0	0	0	111.4	E83 I84 R89 V90 V91	E83-L87 HydrophobicContact CG-CD1 4.23Å; E83-L87 HydrophobicContact CG-CG 4.44Å; E83-L87 WeakPolarHBondContact O-CB 3.46Å; E83-L87 WeakPolarHBondContact O-CG 3.46Å; E83-L87 PolarHBondContact O-N 3.06Å; I84-L87 PolarHBondContact O-N 3.32Å; L87-R89 VanDerWaalsContact C-N 3.29Å; L87-R89 PolarHBondContact O-N 2.92Å; L87-V90 PolarHBondContact O-N 2.97Å; L87-V90 VanDerWaalsContact O-N 3.13Å; L87-V91 WeakPolarHBondContact O-CG2 3.4Å; L87-V91 PolarHBondContact O-N 2.85Å
88	Q	98.8	Very high	98.7	Very high	106 Å²	106	102.7 Å²	102.7	50%	0.495	49%	0.489	S	S	.	.	H	α-helix	trans	-58.4	-38.8	173.6	-77.2	175.3	-12.6	0	0	112.9	I84 K86 R92	I84-Q88 WeakPolarHBondContact O-CB 3.38Å; I84-Q88 VanDerWaalsContact O-CG 3.29Å; I84-Q88 WeakPolarHBondContact O-CG 3.35Å; I84-Q88 PolarHBondContact O-N 3.4Å; K86-Q88 VanDerWaalsContact C-N 3.3Å; K86-Q88 PolarHBondContact O-N 3.48Å; Q88-R92 WeakPolarHBondContact O-CG 3.39Å; Q88-R92 PolarHBondContact O-N 3.04Å; Q88-R92 VanDerWaalsContact O-N 3.08Å
89	R	98.6	Very high	98.7	Very high	156 Å²	156	98.8 Å²	98.8	59%	0.589	48%	0.481	S	S	*	.	H	α-helix	trans	-66	-42.9	175.3	-67.2	175.3	-166.1	152.6	6.3	111.3	Q85 K86 L87 R92 Q93	Q85-R89 WeakPolarHBondContact O-CG 3.49Å; Q85-R89 PolarHBondContact O-N 3.24Å; K86-R89 WeakPolarHBondContact O-CB 3.29Å; K86-R89 PolarHBondContact O-N 2.88Å; L87-R89 VanDerWaalsContact C-N 3.29Å; L87-R89 PolarHBondContact O-N 2.92Å; R89-R92 PolarHBondContact O-N 3.31Å; R89-Q93 WeakPolarHBondContact O-CB 3.43Å; R89-Q93 PolarHBondContact O-N 3.35Å
90	V	98.7	Very high	98.7	Very high	70 Å²	70	99.3 Å²	99.3	42%	0.424	48%	0.478	S	S	.	.	H	α-helix	trans	-63.1	-45	178	175.5	0	0	0	0	110.7	K86 L87 R92 Q93 K94	K86-V90 WeakPolarHBondContact O-CG2 3.49Å; K86-V90 PolarHBondContact O-N 3.13Å; L87-V90 PolarHBondContact O-N 2.97Å; L87-V90 VanDerWaalsContact O-N 3.13Å; V90-R92 PolarHBondContact O-N 3.42Å; V90-Q93 WeakPolarHBondContact O-CB 3.49Å; V90-Q93 PolarHBondContact O-N 2.88Å; V90-Q93 VanDerWaalsContact O-N 3.16Å; V90-K94 HydrophobicContact CG1-CG 4.39Å; V90-K94 WeakPolarHBondContact O-CG 3.34Å; V90-K94 PolarHBondContact O-N 3.31Å
91	V	98.8	Very high	98.7	Very high	80 Å²	80	98.6 Å²	98.6	49%	0.485	48%	0.477	S	S	.	.	H	α-helix	trans	-57.6	-51.3	176.2	169.5	0	0	0	0	110.5	L87 Q93 K94 E95	L87-V91 WeakPolarHBondContact O-CG2 3.4Å; L87-V91 PolarHBondContact O-N 2.85Å; V91-Q93 PolarHBondContact O-N 3.32Å; V91-K94 PolarHBondContact O-N 3.08Å; V91-E95 HydrophobicContact CG1-CG 4.44Å; V91-E95 WeakPolarHBondContact O-CG 3.37Å; V91-E95 PolarHBondContact O-N 3.26Å
92	R	98.8	Very high	98.7	Very high	162 Å²	162	99 Å²	99	61%	0.611	48%	0.476	S	S	*	.	H	α-helix	trans	-60	-35.1	177.6	-71.1	179.7	-176.2	-153	2.1	113	Q88 R89 V90 R96	Q88-R92 WeakPolarHBondContact O-CG 3.39Å; Q88-R92 PolarHBondContact O-N 3.04Å; Q88-R92 VanDerWaalsContact O-N 3.08Å; R89-R92 PolarHBondContact O-N 3.31Å; V90-R92 PolarHBondContact O-N 3.42Å; R92-R96 PolarHBondContact O-N 2.96Å; R92-R96 PolarHBondContact O-NH1 3.16Å; R92-R96 VanDerWaalsContact O-NH1 3.16Å
93	Q	98.8	Very high	98.6	Very high	95 Å²	95	102 Å²	102	44%	0.444	49%	0.489	S	S	.	.	H	α-helix	trans	-67.2	-43.3	175	-179.8	-178.2	-4.7	0	0	111.2	R89 V90 V91 R96 Q97	R89-Q93 WeakPolarHBondContact O-CB 3.43Å; R89-Q93 PolarHBondContact O-N 3.35Å; V90-Q93 WeakPolarHBondContact O-CB 3.49Å; V90-Q93 PolarHBondContact O-N 2.88Å; V90-Q93 VanDerWaalsContact O-N 3.16Å; V91-Q93 PolarHBondContact O-N 3.32Å; Q93-R96 PolarHBondContact O-N 3.24Å; Q93-Q97 WeakPolarHBondContact O-CG 3.37Å; Q93-Q97 PolarHBondContact O-N 3.25Å
94	K	98.6	Very high	98.6	Very high	122 Å²	122	101.8 Å²	101.8	53%	0.53	50%	0.496	S	S	.	.	H	α-helix	trans	-66.9	-36.9	178.7	-71	-72.1	168.7	-164.9	0	112.3	V90 V91 Q97 L98	V90-K94 HydrophobicContact CG1-CG 4.39Å; V90-K94 WeakPolarHBondContact O-CG 3.34Å; V90-K94 PolarHBondContact O-N 3.31Å; V91-K94 PolarHBondContact O-N 3.08Å; K94-Q97 PolarHBondContact O-N 3.32Å; K94-L98 WeakPolarHBondContact O-CB 3.37Å; K94-L98 PolarHBondContact O-N 3.43Å
95	E	98.7	Very high	98.6	Very high	118 Å²	118	100.8 Å²	100.8	55%	0.551	50%	0.495	S	S	*	.	H	α-helix	trans	-60.5	-44	172.8	-72.2	171.5	161.4	0	0	111.9	V91 L98 A99	V91-E95 HydrophobicContact CG1-CG 4.44Å; V91-E95 WeakPolarHBondContact O-CG 3.37Å; V91-E95 PolarHBondContact O-N 3.26Å; E95-L98 PolarHBondContact O-N 3.31Å; E95-A99 PolarHBondContact O-N 2.95Å
96	R	98.8	Very high	98.6	Very high	143 Å²	143	102.1 Å²	102.1	54%	0.54	50%	0.501	S	S	.	.	H	α-helix	trans	-62.4	-48.4	173.7	-73.2	-172.2	-65.1	-82.6	1.6	111.8	R92 Q93 L98 A99 D100	R92-R96 PolarHBondContact O-N 2.96Å; R92-R96 PolarHBondContact O-NH1 3.16Å; R92-R96 VanDerWaalsContact O-NH1 3.16Å; Q93-R96 PolarHBondContact O-N 3.24Å; R96-L98 PolarHBondContact O-N 3.5Å; R96-A99 WeakPolarHBondContact O-CB 3.41Å; R96-A99 PolarHBondContact O-N 2.94Å; R96-D100 VanDerWaalsContact O-CG 3.25Å; R96-D100 PolarHBondContact O-N 2.91Å
97	Q	98.4	Very high	98.6	Very high	84 Å²	84	104.9 Å²	104.9	39%	0.393	51%	0.513	S	S	.	.	H	α-helix	trans	-57.4	-39.3	177	-73.4	-179.5	-15.6	0	0	112.3	Q93 K94 A101	Q93-Q97 WeakPolarHBondContact O-CG 3.37Å; Q93-Q97 PolarHBondContact O-N 3.25Å; K94-Q97 PolarHBondContact O-N 3.32Å; Q97-A101 VanDerWaalsContact O-CB 3.29Å; Q97-A101 WeakPolarHBondContact O-CB 3.29Å; Q97-A101 PolarHBondContact O-N 2.97Å
98	L	98.7	Very high	98.6	Very high	97 Å²	97	105 Å²	105	51%	0.508	52%	0.518	S	S	.	.	H	α-helix	trans	-66.9	-40.7	176.4	179.6	62.3	0	0	0	111.7	K94 E95 R96 K102	K94-L98 WeakPolarHBondContact O-CB 3.37Å; K94-L98 PolarHBondContact O-N 3.43Å; E95-L98 PolarHBondContact O-N 3.31Å; R96-L98 PolarHBondContact O-N 3.5Å; L98-K102 HydrophobicContact CG-CD 4.37Å; L98-K102 WeakPolarHBondContact O-CB 3.41Å; L98-K102 VanDerWaalsContact O-CG 3.27Å; L98-K102 WeakPolarHBondContact O-CG 3.27Å; L98-K102 PolarHBondContact O-N 3.1Å
99	A	98.6	Very high	98.6	Very high	50 Å²	50	105.1 Å²	105.1	41%	0.413	52%	0.518	S	S	.	.	H	α-helix	trans	-62.6	-46.8	175.7	0	0	0	0	0	111.4	E95 R96 A101 K102 Q103	E95-A99 PolarHBondContact O-N 2.95Å; R96-A99 WeakPolarHBondContact O-CB 3.41Å; R96-A99 PolarHBondContact O-N 2.94Å; A99-A101 PolarHBondContact O-N 3.27Å; A99-K102 PolarHBondContact O-N 3.47Å; A99-Q103 PolarHBondContact O-N 3.32Å
100	D	98.6	Very high	98.6	Very high	91 Å²	91	100.4 Å²	100.4	49%	0.487	51%	0.513	S	S	.	.	H	α-helix	trans	-61.4	-45.5	178	-60.5	-21.4	0	0	0	110.9	R96 K102 Q103 C104	R96-D100 VanDerWaalsContact O-CG 3.25Å; R96-D100 PolarHBondContact O-N 2.91Å; D100-K102 VanDerWaalsContact C-N 3.33Å; D100-K102 PolarHBondContact O-N 3.05Å; D100-Q103 PolarHBondContact O-N 3.27Å; D100-C104 PolarHBondContact O-N 3.38Å; D100-C104 PolarHBondContact O-SG 3.45Å; D100-C104 VanDerWaalsContact O-SG 3.41Å
101	A	98.4	Very high	98.6	Very high	51 Å²	51	99 Å²	99	42%	0.421	51%	0.509	S	S	.	.	H	α-helix	trans	-61.2	-40.6	177.6	0	0	0	0	0	112.3	Q97 A99 Q103 C104 V105	Q97-A101 VanDerWaalsContact O-CB 3.29Å; Q97-A101 WeakPolarHBondContact O-CB 3.29Å; Q97-A101 PolarHBondContact O-N 2.97Å; A99-A101 PolarHBondContact O-N 3.27Å; A101-Q103 VanDerWaalsContact C-N 3.34Å; A101-Q103 PolarHBondContact O-N 3.36Å; A101-C104 PolarHBondContact O-N 3.01Å; A101-V105 WeakPolarHBondContact O-CG2 3.44Å; A101-V105 PolarHBondContact O-N 3.04Å
102	K	98.6	Very high	98.6	Very high	123 Å²	123	98 Å²	98	54%	0.535	51%	0.509	S	S	.	.	H	α-helix	trans	-62.2	-41.9	175.2	-75.8	172.8	178.5	-178.6	0	111.7	L98 A99 D100 V105 Q106	L98-K102 HydrophobicContact CG-CD 4.37Å; L98-K102 WeakPolarHBondContact O-CB 3.41Å; L98-K102 VanDerWaalsContact O-CG 3.27Å; L98-K102 WeakPolarHBondContact O-CG 3.27Å; L98-K102 PolarHBondContact O-N 3.1Å; A99-K102 PolarHBondContact O-N 3.47Å; D100-K102 VanDerWaalsContact C-N 3.33Å; D100-K102 PolarHBondContact O-N 3.05Å; K102-V105 PolarHBondContact O-N 3.41Å; K102-Q106 WeakPolarHBondContact O-CG 3.37Å; K102-Q106 PolarHBondContact O-N 3.33Å
103	Q	98.6	Very high	98.6	Very high	127 Å²	127	95.9 Å²	95.9	59%	0.593	51%	0.505	S	S	*	.	H	α-helix	trans	-64.6	-42.2	175.5	-70.8	-178.2	-37.4	0	0	111.8	A99 D100 A101 V105 Q106 F107	A99-Q103 PolarHBondContact O-N 3.32Å; D100-Q103 PolarHBondContact O-N 3.27Å; A101-Q103 VanDerWaalsContact C-N 3.34Å; A101-Q103 PolarHBondContact O-N 3.36Å; Q103-V105 VanDerWaalsContact C-N 3.34Å; Q103-V105 PolarHBondContact O-N 2.9Å; Q103-Q106 PolarHBondContact O-N 3.04Å; Q103-F107 PolarHBondContact O-N 3.18Å
104	C	98.4	Very high	98.5	Very high	83 Å²	83	97.9 Å²	97.9	56%	0.561	52%	0.515	S	S	*	.	H	α-helix	trans	-59.2	-44.3	174.7	-71.4	0	0	0	0	111.9	D100 A101 F107 V108	D100-C104 PolarHBondContact O-N 3.38Å; D100-C104 PolarHBondContact O-SG 3.45Å; D100-C104 VanDerWaalsContact O-SG 3.41Å; A101-C104 PolarHBondContact O-N 3.01Å; C104-F107 PolarHBondContact O-N 3.05Å; C104-V108 WeakPolarHBondContact O-CG2 3.41Å; C104-V108 PolarHBondContact O-N 2.91Å
105	V	98.6	Very high	98.5	Very high	76 Å²	76	95.9 Å²	95.9	46%	0.461	52%	0.516	S	S	.	.	H	α-helix	trans	-60.8	-48.2	177	169.2	0	0	0	0	110.8	A101 K102 Q103 F107 V108 E109	A101-V105 WeakPolarHBondContact O-CG2 3.44Å; A101-V105 PolarHBondContact O-N 3.04Å; K102-V105 PolarHBondContact O-N 3.41Å; Q103-V105 VanDerWaalsContact C-N 3.34Å; Q103-V105 PolarHBondContact O-N 2.9Å; V105-F107 VanDerWaalsContact C-N 3.26Å; V105-F107 PolarHBondContact O-N 3.4Å; V105-V108 PolarHBondContact O-N 2.87Å; V105-V108 VanDerWaalsContact O-N 3.1Å; V105-E109 HydrophobicContact CG1-CG 4.2Å; V105-E109 WeakPolarHBondContact CG1-OE1 3.49Å; V105-E109 WeakPolarHBondContact O-CG 3.38Å; V105-E109 PolarHBondContact O-N 2.93Å
106	Q	98.5	Very high	98.5	Very high	124 Å²	124	95.7 Å²	95.7	58%	0.579	52%	0.515	S	S	*	.	H	α-helix	trans	-57.3	-40.3	178	-73.9	175.9	-5.4	0	0	112.6	K102 Q103 A110	K102-Q106 WeakPolarHBondContact O-CG 3.37Å; K102-Q106 PolarHBondContact O-N 3.33Å; Q103-Q106 PolarHBondContact O-N 3.04Å; Q106-A110 WeakPolarHBondContact O-CB 3.38Å; Q106-A110 PolarHBondContact O-N 3.47Å
107	F	98.6	Very high	98.5	Very high	152 Å²	152	95.3 Å²	95.3	67%	0.667	52%	0.519	S	S	*	.	H	α-helix	trans	-64.9	-44.6	176.8	180	-95.9	0	0	0	111.9	Q103 C104 V105 A110 A111	Q103-F107 PolarHBondContact O-N 3.18Å; C104-F107 PolarHBondContact O-N 3.05Å; V105-F107 VanDerWaalsContact C-N 3.26Å; V105-F107 PolarHBondContact O-N 3.4Å; F107-A110 PolarHBondContact O-N 3.25Å; F107-A111 WeakPolarHBondContact O-CB 3.38Å; F107-A111 PolarHBondContact O-N 3.38Å
108	V	98.6	Very high	98.4	Very high	96 Å²	96	97 Å²	97	58%	0.582	53%	0.528	S	S	*	.	H	α-helix	trans	-65	-41.3	178.7	172.2	0	0	0	0	111.2	C104 V105 A111 A112	C104-V108 WeakPolarHBondContact O-CG2 3.41Å; C104-V108 PolarHBondContact O-N 2.91Å; V105-V108 PolarHBondContact O-N 2.87Å; V105-V108 VanDerWaalsContact O-N 3.1Å; V108-A111 PolarHBondContact O-N 2.96Å; V108-A112 WeakPolarHBondContact O-CB 3.46Å; V108-A112 PolarHBondContact O-N 3.03Å
109	E	98.5	Very high	98.4	Very high	107 Å²	107	99.2 Å²	99.2	50%	0.5	53%	0.533	S	S	.	.	H	α-helix	trans	-61.5	-45.6	175.2	-72.7	173.4	168.1	0	0	111.5	V105 A111 A112 H113	V105-E109 HydrophobicContact CG1-CG 4.2Å; V105-E109 WeakPolarHBondContact CG1-OE1 3.49Å; V105-E109 WeakPolarHBondContact O-CG 3.38Å; V105-E109 PolarHBondContact O-N 2.93Å; E109-A111 PolarHBondContact O-N 3.37Å; E109-A112 PolarHBondContact O-N 2.96Å; E109-H113 PolarHBondContact O-CD2 3.49Å; E109-H113 PolarHBondContact O-N 3.49Å
110	A	98.4	Very high	98.4	Very high	58 Å²	58	101.3 Å²	101.3	48%	0.479	53%	0.534	S	S	.	.	H	α-helix	trans	-60.5	-45.4	176.4	0	0	0	0	0	111.9	Q106 F107 A112 H113 E114	Q106-A110 WeakPolarHBondContact O-CB 3.38Å; Q106-A110 PolarHBondContact O-N 3.47Å; F107-A110 PolarHBondContact O-N 3.25Å; A110-A112 VanDerWaalsContact C-N 3.32Å; A110-A112 PolarHBondContact O-N 3.36Å; A110-H113 PolarHBondContact O-N 3.34Å; A110-E114 PolarHBondContact O-N 2.96Å
111	A	98.4	Very high	98.4	Very high	41 Å²	41	99.5 Å²	99.5	34%	0.339	53%	0.532	S	S	.	.	H	α-helix	trans	-63.9	-36.5	177.3	0	0	0	0	0	112.4	F107 V108 E109 E114 S115	F107-A111 WeakPolarHBondContact O-CB 3.38Å; F107-A111 PolarHBondContact O-N 3.38Å; V108-A111 PolarHBondContact O-N 2.96Å; E109-A111 PolarHBondContact O-N 3.37Å; A111-E114 PolarHBondContact O-N 3.03Å; A111-S115 WeakPolarHBondContact O-CB 3.48Å; A111-S115 PolarHBondContact O-N 3.24Å
112	A	98.3	Very high	98.4	Very high	59 Å²	59	99.2 Å²	99.2	49%	0.488	53%	0.527	S	S	.	.	H	α-helix	trans	-64.8	-45.3	175.6	0	0	0	0	0	111.5	V108 E109 A110 S115 E116	V108-A112 WeakPolarHBondContact O-CB 3.46Å; V108-A112 PolarHBondContact O-N 3.03Å; E109-A112 PolarHBondContact O-N 2.96Å; A110-A112 VanDerWaalsContact C-N 3.32Å; A110-A112 PolarHBondContact O-N 3.36Å; A112-S115 PolarHBondContact O-N 3.3Å; A112-E116 PolarHBondContact O-N 3.25Å
113	H	98.5	Very high	98.3	Very high	117 Å²	117	100.5 Å²	100.5	54%	0.542	53%	0.528	S	S	.	.	H	α-helix	trans	-62.4	-43.6	175.6	-75.9	-53.1	0	0	0	112.5	E109 A110 S115 E116 Q117	E109-H113 PolarHBondContact O-CD2 3.49Å; E109-H113 PolarHBondContact O-N 3.49Å; A110-H113 PolarHBondContact O-N 3.34Å; H113-S115 VanDerWaalsContact C-N 3.35Å; H113-S115 PolarHBondContact O-N 2.99Å; H113-E116 PolarHBondContact O-N 2.98Å; H113-Q117 WeakPolarHBondContact O-CG 3.41Å; H113-Q117 PolarHBondContact O-N 2.94Å
114	E	98.3	Very high	98.3	Very high	137 Å²	137	99 Å²	99	64%	0.64	52%	0.52	S	S	*	.	H	α-helix	trans	-61.3	-44.6	176	-175.1	176.5	-161.6	0	0	111.3	A110 A111 E116 Q117 Q118	A110-E114 PolarHBondContact O-N 2.96Å; A111-E114 PolarHBondContact O-N 3.03Å; E114-E116 VanDerWaalsContact C-N 3.29Å; E114-E116 PolarHBondContact O-N 3.2Å; E114-Q117 PolarHBondContact O-N 2.77Å; E114-Q118 WeakPolarHBondContact O-CB 3.38Å; E114-Q118 PolarHBondContact O-N 2.74Å
115	S	98.1	Very high	98.3	Very high	80 Å²	80	100.6 Å²	100.6	56%	0.559	52%	0.519	S	S	*	.	H	α-helix	trans	-61.4	-37.7	176.2	-177.6	0	0	0	0	112.4	A111 A112 H113 K119	A111-S115 WeakPolarHBondContact O-CB 3.48Å; A111-S115 PolarHBondContact O-N 3.24Å; A112-S115 PolarHBondContact O-N 3.3Å; H113-S115 VanDerWaalsContact C-N 3.35Å; H113-S115 PolarHBondContact O-N 2.99Å; S115-K119 WeakPolarHBondContact O-CB 3.26Å; S115-K119 PolarHBondContact O-N 3.43Å
116	E	98.2	Very high	98.3	Very high	113 Å²	113	100.6 Å²	100.6	53%	0.528	52%	0.516	S	S	.	.	H	α-helix	trans	-67	-47	177.1	-177.4	166	-144.7	0	0	111.4	A112 H113 E114 Q118 K119 E120	A112-E116 PolarHBondContact O-N 3.25Å; H113-E116 PolarHBondContact O-N 2.98Å; E114-E116 VanDerWaalsContact C-N 3.29Å; E114-E116 PolarHBondContact O-N 3.2Å; E116-Q118 VanDerWaalsContact C-N 3.32Å; E116-Q118 PolarHBondContact O-N 2.91Å; E116-K119 WeakPolarHBondContact O-CB 3.36Å; E116-K119 PolarHBondContact O-N 3.37Å; E116-E120 PolarHBondContact O-N 2.83Å
117	Q	98.2	Very high	98.3	Very high	135 Å²	135	98 Å²	98	63%	0.631	50%	0.504	S	S	*	.	H	α-helix	trans	-59.3	-44.1	176	-72	177.3	-1.8	0	0	111.5	H113 E114 K119 E120 A121	H113-Q117 WeakPolarHBondContact O-CG 3.41Å; H113-Q117 PolarHBondContact O-N 2.94Å; E114-Q117 PolarHBondContact O-N 2.77Å; Q117-K119 VanDerWaalsContact C-N 3.33Å; Q117-K119 PolarHBondContact O-N 3.17Å; Q117-E120 PolarHBondContact O-N 3.46Å; Q117-A121 WeakPolarHBondContact O-CB 3.36Å; Q117-A121 PolarHBondContact O-N 3.41Å
118	Q	98.1	Very high	98.3	Very high	121 Å²	121	96.6 Å²	96.6	57%	0.565	50%	0.5	S	S	*	.	H	α-helix	trans	-63	-41.1	178.2	-175.1	59.6	24.3	0	0	111.7	E114 E116 S122	E114-Q118 WeakPolarHBondContact O-CB 3.38Å; E114-Q118 PolarHBondContact O-N 2.74Å; E116-Q118 VanDerWaalsContact C-N 3.32Å; E116-Q118 PolarHBondContact O-N 2.91Å; Q118-S122 VanDerWaalsContact O-CB 3.26Å; Q118-S122 WeakPolarHBondContact O-CB 3.33Å; Q118-S122 PolarHBondContact O-N 2.91Å; Q118-S122 PolarHBondContact O-OG 2.93Å
119	K	98.4	Very high	98.2	Very high	142 Å²	142	95.9 Å²	95.9	62%	0.617	49%	0.492	S	S	*	.	H	α-helix	trans	-63.2	-44.3	175.7	-174.3	-169.3	67.3	171.8	0	111	S115 E116 Q117 S122 W123	S115-K119 WeakPolarHBondContact O-CB 3.26Å; S115-K119 PolarHBondContact O-N 3.43Å; E116-K119 WeakPolarHBondContact O-CB 3.36Å; E116-K119 PolarHBondContact O-N 3.37Å; Q117-K119 VanDerWaalsContact C-N 3.33Å; Q117-K119 PolarHBondContact O-N 3.17Å; K119-S122 PolarHBondContact O-N 2.91Å; K119-W123 WeakPolarHBondContact O-CB 3.44Å; K119-W123 PolarHBondContact O-N 3.44Å
120	E	98.3	Very high	98.2	Very high	94 Å²	94	98.8 Å²	98.8	44%	0.439	50%	0.499	S	S	.	.	H	α-helix	trans	-65.6	-45.3	179.3	-167	-173.4	163.4	0	0	111.7	E116 Q117 S122 W123 K124	E116-E120 PolarHBondContact O-N 2.83Å; Q117-E120 PolarHBondContact O-N 3.46Å; E120-S122 VanDerWaalsContact C-N 3.32Å; E120-S122 PolarHBondContact O-N 2.87Å; E120-W123 PolarHBondContact O-N 3.2Å; E120-K124 WeakPolarHBondContact O-CG 3.34Å; E120-K124 PolarHBondContact O-N 2.95Å; E120-K124 WeakPolarHBondContact OE1-CE 3.41Å; E120-K124 IonicContact OE1-NZ 2.68Å; E120-K124 PolarHBondContact OE1-NZ 3.44Å
121	A	97.9	Very high	98.1	Very high	53 Å²	53	101.2 Å²	101.2	44%	0.438	50%	0.498	S	S	.	.	H	α-helix	trans	-58.9	-45.4	175.2	0	0	0	0	0	111.2	Q117 W123 K124 H125	Q117-A121 WeakPolarHBondContact O-CB 3.36Å; Q117-A121 PolarHBondContact O-N 3.41Å; A121-W123 VanDerWaalsContact C-N 3.33Å; A121-W123 PolarHBondContact O-N 3.42Å; A121-K124 PolarHBondContact O-N 2.68Å; A121-H125 WeakPolarHBondContact O-CB 3.34Å; A121-H125 PolarHBondContact O-N 3.05Å
122	S	98.1	Very high	98.1	Very high	46 Å²	46	101.3 Å²	101.3	32%	0.322	50%	0.499	S	S	.	.	H	α-helix	trans	-62.5	-41.1	175.9	-59.5	0	0	0	0	111.5	Q118 K119 E120 N126	Q118-S122 VanDerWaalsContact O-CB 3.26Å; Q118-S122 WeakPolarHBondContact O-CB 3.33Å; Q118-S122 PolarHBondContact O-N 2.91Å; Q118-S122 PolarHBondContact O-OG 2.93Å; K119-S122 PolarHBondContact O-N 2.91Å; E120-S122 VanDerWaalsContact C-N 3.32Å; E120-S122 PolarHBondContact O-N 2.87Å; S122-N126 WeakPolarHBondContact O-CB 3.49Å; S122-N126 PolarHBondContact O-N 3.26Å; S122-N126 PolarHBondContact O-ND2 3.13Å
123	W	98.3	Very high	98	Very high	149 Å²	149	103.3 Å²	103.3	56%	0.564	50%	0.501	S	S	*	.	H	α-helix	trans	-63.7	-45.5	178	179.8	86.7	0	0	0	111.7	K119 E120 A121 N126 Q127	K119-W123 WeakPolarHBondContact O-CB 3.44Å; K119-W123 PolarHBondContact O-N 3.44Å; E120-W123 PolarHBondContact O-N 3.2Å; A121-W123 VanDerWaalsContact C-N 3.33Å; A121-W123 PolarHBondContact O-N 3.42Å; W123-N126 PolarHBondContact O-N 2.87Å; W123-Q127 WeakPolarHBondContact O-CB 3.38Å; W123-Q127 PolarHBondContact O-N 3.31Å
124	K	98.6	Very high	97.9	Very high	96 Å²	96	104.3 Å²	104.3	42%	0.417	51%	0.506	S	S	.	.	H	α-helix	trans	-59.5	-50.3	175.9	-72.7	175.3	-177	163.5	0	111.3	E120 A121 N126 Q127 E128	E120-K124 WeakPolarHBondContact O-CG 3.34Å; E120-K124 PolarHBondContact O-N 2.95Å; E120-K124 WeakPolarHBondContact OE1-CE 3.41Å; E120-K124 IonicContact OE1-NZ 2.68Å; E120-K124 PolarHBondContact OE1-NZ 3.44Å; A121-K124 PolarHBondContact O-N 2.68Å; K124-N126 VanDerWaalsContact C-N 3.34Å; K124-N126 PolarHBondContact O-N 3.43Å; K124-Q127 WeakPolarHBondContact O-CB 3.12Å; K124-Q127 PolarHBondContact O-N 3.09Å; K124-Q127 VanDerWaalsContact O-N 3.11Å; K124-E128 WeakPolarHBondContact O-CG 3.41Å; K124-E128 PolarHBondContact O-N 3.31Å
125	H	98	Very high	97.7	Very high	117 Å²	117	105.5 Å²	105.5	54%	0.542	51%	0.512	S	S	.	.	H	α-helix	trans	-57.8	-46.7	178.1	178.6	65.1	0	0	0	112	A121 Q127 E128 L129	A121-H125 WeakPolarHBondContact O-CB 3.34Å; A121-H125 PolarHBondContact O-N 3.05Å; H125-Q127 VanDerWaalsContact C-N 3.3Å; H125-Q127 PolarHBondContact O-N 3.38Å; H125-E128 PolarHBondContact O-N 3.07Å; H125-L129 WeakPolarHBondContact O-CB 3.39Å; H125-L129 PolarHBondContact O-N 3.41Å
126	N	98.4	Very high	97.5	Very high	76 Å²	76	108.8 Å²	108.8	41%	0.406	52%	0.522	S	S	.	.	H	α-helix	trans	-64.3	-34.7	177.6	-81.8	-67.7	0	0	0	112.6	S122 W123 K124 R130	S122-N126 WeakPolarHBondContact O-CB 3.49Å; S122-N126 PolarHBondContact O-N 3.26Å; S122-N126 PolarHBondContact O-ND2 3.13Å; W123-N126 PolarHBondContact O-N 2.87Å; K124-N126 VanDerWaalsContact C-N 3.34Å; K124-N126 PolarHBondContact O-N 3.43Å; N126-R130 WeakPolarHBondContact O-CG 3.44Å; N126-R130 PolarHBondContact O-N 3.3Å
127	Q	98.2	Very high	96.4	Very high	69 Å²	69	114.1 Å²	114.1	32%	0.322	55%	0.547	S	S	.	.	H	α-helix	trans	-65.7	-45.5	176	-172.8	-171.2	12.4	0	0	111.3	W123 K124 H125 L129 R130 K131	W123-Q127 WeakPolarHBondContact O-CB 3.38Å; W123-Q127 PolarHBondContact O-N 3.31Å; K124-Q127 WeakPolarHBondContact O-CB 3.12Å; K124-Q127 PolarHBondContact O-N 3.09Å; K124-Q127 VanDerWaalsContact O-N 3.11Å; H125-Q127 VanDerWaalsContact C-N 3.3Å; H125-Q127 PolarHBondContact O-N 3.38Å; Q127-L129 VanDerWaalsContact C-N 3.34Å; Q127-R130 PolarHBondContact O-N 2.98Å; Q127-K131 WeakPolarHBondContact O-CG 3.47Å; Q127-K131 PolarHBondContact O-N 2.97Å; Q127-K131 VanDerWaalsContact O-N 3.09Å
128	E	97.8	Very high	96.3	Very high	122 Å²	122	113.1 Å²	113.1	57%	0.57	54%	0.543	S	S	*	.	H	α-helix	trans	-61.2	-44.3	176.4	-71	174.1	176	0	0	111.4	K124 H125 R130 K131 A132	K124-E128 WeakPolarHBondContact O-CG 3.41Å; K124-E128 PolarHBondContact O-N 3.31Å; H125-E128 PolarHBondContact O-N 3.07Å; E128-R130 VanDerWaalsContact C-N 3.32Å; E128-R130 PolarHBondContact O-N 3.39Å; E128-K131 WeakPolarHBondContact O-CB 3.49Å; E128-K131 PolarHBondContact O-N 2.97Å; E128-K131 VanDerWaalsContact O-N 3.13Å; E128-A132 PolarHBondContact O-N 3.49Å
129	L	97.8	Very high	96.2	Very high	82 Å²	82	112.7 Å²	112.7	43%	0.429	54%	0.542	S	S	.	.	H	α-helix	trans	-57.3	-45.6	175.7	-179.9	62.9	0	0	0	111.7	H125 Q127 K131 A132 L133	H125-L129 WeakPolarHBondContact O-CB 3.39Å; H125-L129 PolarHBondContact O-N 3.41Å; Q127-L129 VanDerWaalsContact C-N 3.34Å; L129-K131 VanDerWaalsContact C-N 3.33Å; L129-K131 PolarHBondContact O-N 3.38Å; L129-A132 PolarHBondContact O-N 3.16Å; L129-L133 HydrophobicContact CD1-CD1 4.49Å; L129-L133 HydrophobicContact CD1-CG 4.47Å; L129-L133 HydrophobicContact CG-CD1 4.24Å; L129-L133 WeakPolarHBondContact O-CG 3.35Å; L129-L133 PolarHBondContact O-N 3.48Å
130	R	97.6	Very high	96	Very high	167 Å²	167	111.1 Å²	111.1	63%	0.63	54%	0.538	S	S	*	.	H	α-helix	trans	-60.2	-42.1	176.5	-74.1	173.8	-174.5	163.8	2.4	112.1	N126 Q127 E128 L133 Q134	N126-R130 WeakPolarHBondContact O-CG 3.44Å; N126-R130 PolarHBondContact O-N 3.3Å; Q127-R130 PolarHBondContact O-N 2.98Å; E128-R130 VanDerWaalsContact C-N 3.32Å; E128-R130 PolarHBondContact O-N 3.39Å; R130-L133 PolarHBondContact O-N 3.11Å; R130-Q134 WeakPolarHBondContact O-CG 3.45Å; R130-Q134 PolarHBondContact O-N 3.39Å
131	K	97.7	Very high	95.9	Very high	109 Å²	109	112.1 Å²	112.1	47%	0.474	54%	0.544	S	S	.	.	H	α-helix	trans	-62.7	-44.7	176.2	-69.5	174.9	-178.1	174.4	0	111.3	Q127 E128 L129 L133 Q134 Q135	Q127-K131 WeakPolarHBondContact O-CG 3.47Å; Q127-K131 PolarHBondContact O-N 2.97Å; Q127-K131 VanDerWaalsContact O-N 3.09Å; E128-K131 WeakPolarHBondContact O-CB 3.49Å; E128-K131 PolarHBondContact O-N 2.97Å; E128-K131 VanDerWaalsContact O-N 3.13Å; L129-K131 VanDerWaalsContact C-N 3.33Å; L129-K131 PolarHBondContact O-N 3.38Å; K131-L133 VanDerWaalsContact C-N 3.33Å; K131-L133 PolarHBondContact O-N 3.37Å; K131-Q134 PolarHBondContact O-N 3.21Å; K131-Q135 WeakPolarHBondContact O-CG 3.46Å; K131-Q135 PolarHBondContact O-N 3.25Å
132	A	96.9	Very high	95.8	Very high	44 Å²	44	115.8 Å²	115.8	36%	0.364	55%	0.55	S	S	.	*	H	α-helix	trans	-62.3	-40.9	178.2	0	0	0	0	0	111.9	E128 L129 Q134 Q135 L136	E128-A132 PolarHBondContact O-N 3.49Å; L129-A132 PolarHBondContact O-N 3.16Å; A132-Q134 PolarHBondContact O-N 3.18Å; A132-Q135 PolarHBondContact O-N 3.46Å; A132-L136 PolarHBondContact O-N 3.25Å
133	L	96.8	Very high	95.6	Very high	101 Å²	101	120.4 Å²	120.4	53%	0.529	57%	0.565	S	S	.	*	H	α-helix	trans	-64.2	-39	175.6	-70.7	172.3	0	0	0	112.4	L129 R130 K131 Q135 L136	L129-L133 HydrophobicContact CD1-CD1 4.49Å; L129-L133 HydrophobicContact CD1-CG 4.47Å; L129-L133 HydrophobicContact CG-CD1 4.24Å; L129-L133 WeakPolarHBondContact O-CG 3.35Å; L129-L133 PolarHBondContact O-N 3.48Å; R130-L133 PolarHBondContact O-N 3.11Å; K131-L133 VanDerWaalsContact C-N 3.33Å; K131-L133 PolarHBondContact O-N 3.37Å; L133-Q135 PolarHBondContact O-N 2.95Å; L133-L136 PolarHBondContact O-N 2.91Å; L133-L136 VanDerWaalsContact O-N 3.16Å
134	Q	95.9	Very high	95.4	Very high	137 Å²	137	118.4 Å²	118.4	64%	0.64	57%	0.566	S	S	*	*	H	α-helix	trans	-63.8	-29	174.9	-76	177.1	-24.8	0	0	113	R130 K131 A132 L136	R130-Q134 WeakPolarHBondContact O-CG 3.45Å; R130-Q134 PolarHBondContact O-N 3.39Å; K131-Q134 PolarHBondContact O-N 3.21Å; A132-Q134 PolarHBondContact O-N 3.18Å; Q134-L136 VanDerWaalsContact C-N 3.26Å; Q134-L136 PolarHBondContact O-N 3.5Å
135	Q	94.8	Very high	95.2	Very high	163 Å²	163	120.1 Å²	120.1	76%	0.762	58%	0.577	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.6	-14.9	176.9	-70	176.9	-19.5	0	0	113.3	K131 A132 L133	K131-Q135 WeakPolarHBondContact O-CG 3.46Å; K131-Q135 PolarHBondContact O-N 3.25Å; A132-Q135 PolarHBondContact O-N 3.46Å; L133-Q135 PolarHBondContact O-N 2.95Å
136	L	93.5	Very high	95	Very high	149 Å²	149	120.3 Å²	120.3	78%	0.78	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.8	-4.4	-179.9	-65.4	173.6	0	0	0	113.4	A132 L133 Q134	A132-L136 PolarHBondContact O-N 3.25Å; L133-L136 PolarHBondContact O-N 2.91Å; L133-L136 VanDerWaalsContact O-N 3.16Å; Q134-L136 VanDerWaalsContact C-N 3.26Å; Q134-L136 PolarHBondContact O-N 3.5Å
137	Q	74.1	Confident	94.6	Very high	225 Å²	225	124.4 Å²	124.4	100%	1.051	60%	0.596	S	S	*	*			trans	-96	0	171.6	-83.3	-176.5	-42.6	0	0	111

Retrieved 137 of 137 residues in 117.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).