A0A087X243_HUMAN Loading...

Glutathione S-transferase P

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). Participates in the formation of novel hepoxilin regioisomers. Negatively regulates CDK5 activity via p25/p35 translocation to prevent neurodegeneration.

AlphaFold DB , UniProt , Accession A0A087X243, Species HUMAN (Homo sapiens, Human), Gene GSTP1, Length 69 aa.

						>A0A087X243_HUMAN|A0A087X243|GSTP1
EAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQVSIWPHAVPSSPPSASRWTQVSPSLTTTCWTCC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	E	56.5	Low	68.1	Low	212 Å²	212	106.2 Å²	106.2	99%	0.991	57%	0.572	S	S	*	*				0	26.7	0	-55.4	-48.4	96.1	0	0	116.4
2	A	58.6	Low	68.6	Low	76 Å²	76	104.3 Å²	104.3	63%	0.628	57%	0.569	S	S	*	*			trans	-104.5	-34	175.9	0	0	0	0	0	113.7	K4	A2-K4 PolarHBondContact O-N 3.46Å
3	G	61.6	Low	69.3	Low	54 Å²	54	100.3 Å²	100.3	56%	0.557	57%	0.567	S	S	*	*	H	α-helix	trans	-77.5	-15.3	-174.4	0	0	0	0	0	115.9	Y7	G3-Y7 WeakPolarHBondContact O-CB 3.48Å; G3-Y7 PolarHBondContact O-N 3.29Å
4	K	67.1	Low	69.7	Low	145 Å²	145	100.6 Å²	100.6	63%	0.63	56%	0.561	S	S	*	*	H	α-helix	trans	-72	-41	-179.2	-178.9	-178.2	162	-172.3	0	111.5	A2 Y7 V8	A2-K4 PolarHBondContact O-N 3.46Å; K4-Y7 PolarHBondContact O-N 3.24Å; K4-V8 VanDerWaalsContact O-CG2 3.24Å; K4-V8 WeakPolarHBondContact O-CG2 3.39Å; K4-V8 PolarHBondContact O-N 3Å
5	D	67.2	Low	69.8	Low	101 Å²	101	99.1 Å²	99.1	54%	0.54	55%	0.551	S	S	.	*	H	α-helix	trans	-68.4	-42.5	-179.7	-111.3	-94.2	0	0	0	111.5	Y7 V8 K9	D5-Y7 VanDerWaalsContact C-N 3.34Å; D5-V8 PolarHBondContact O-N 3.01Å; D5-K9 WeakPolarHBondContact O-CG 3.41Å; D5-K9 PolarHBondContact O-N 3.06Å
6	D	72.6	Confident	70	Confident	104 Å²	104	101.6 Å²	101.6	56%	0.556	56%	0.555	S	S	*	*	H	α-helix	trans	-65.9	-37.1	174.6	-69.5	-57.8	0	0	0	112.1	K9 A10	D6-K9 PolarHBondContact O-N 3.35Å; D6-A10 WeakPolarHBondContact O-CB 3.2Å; D6-A10 PolarHBondContact O-N 2.96Å
7	Y	66.6	Low	70.2	Confident	142 Å²	142	99.8 Å²	99.8	56%	0.557	55%	0.549	S	S	*	.	H	α-helix	trans	-63.7	-44.9	173.6	-177	-100.3	0	0	0	111.9	G3 K4 D5 K9 A10 L11	G3-Y7 WeakPolarHBondContact O-CB 3.48Å; G3-Y7 PolarHBondContact O-N 3.29Å; K4-Y7 PolarHBondContact O-N 3.24Å; D5-Y7 VanDerWaalsContact C-N 3.34Å; Y7-K9 VanDerWaalsContact C-N 3.29Å; Y7-K9 PolarHBondContact O-N 3.11Å; Y7-A10 PolarHBondContact O-N 2.97Å; Y7-L11 HydrophobicContact CD1-CD1 4.4Å; Y7-L11 HydrophobicContact CE1-CD1 3.71Å; Y7-L11 WeakPolarHBondContact O-CB 3.39Å; Y7-L11 PolarHBondContact O-N 3.05Å
8	V	74	Confident	70.1	Confident	81 Å²	81	100.1 Å²	100.1	49%	0.491	54%	0.544	S	S	.	.	H	α-helix	trans	-64.4	-34.1	176.6	172.4	0	0	0	0	111.4	K4 D5 L11 P12	K4-V8 VanDerWaalsContact O-CG2 3.24Å; K4-V8 WeakPolarHBondContact O-CG2 3.39Å; K4-V8 PolarHBondContact O-N 3Å; D5-V8 PolarHBondContact O-N 3.01Å; V8-L11 WeakPolarHBondContact O-CB 3.1Å; V8-P12 WeakPolarHBondContact O-CD 3.38Å
9	K	75.6	Confident	70	Confident	149 Å²	149	101.2 Å²	101.2	65%	0.648	55%	0.545	S	S	*	.	H	α-helix	trans	-73	-31.5	174.9	-73.1	175.4	-175.4	173.2	0	113.5	D5 D6 Y7 P12	D5-K9 WeakPolarHBondContact O-CG 3.41Å; D5-K9 PolarHBondContact O-N 3.06Å; D6-K9 PolarHBondContact O-N 3.35Å; Y7-K9 VanDerWaalsContact C-N 3.29Å; Y7-K9 PolarHBondContact O-N 3.11Å; K9-P12 WeakPolarHBondContact O-CD 3.37Å
10	A	74.9	Confident	69.9	Low	48 Å²	48	100 Å²	100	40%	0.397	54%	0.542	S	S	.	.	H	α-helix	trans	-81	-22.2	176.4	0	0	0	0	0	113	D6 Y7 G13 Q14	D6-A10 WeakPolarHBondContact O-CB 3.2Å; D6-A10 PolarHBondContact O-N 2.96Å; Y7-A10 PolarHBondContact O-N 2.97Å; A10-G13 PolarHBondContact O-N 2.77Å; A10-G13 VanDerWaalsContact O-N 3.16Å; A10-Q14 PolarHBondContact O-N 3.28Å
11	L	74.2	Confident	69.8	Low	56 Å²	56	98.6 Å²	98.6	29%	0.293	53%	0.533	S	S	.	.	H	α-helix	trans	-55.5	-44.9	-175.9	-154.5	73.2	0	0	0	114.3	Y7 V8 G13 Q14 L15	Y7-L11 HydrophobicContact CD1-CD1 4.4Å; Y7-L11 HydrophobicContact CE1-CD1 3.71Å; Y7-L11 WeakPolarHBondContact O-CB 3.39Å; Y7-L11 PolarHBondContact O-N 3.05Å; V8-L11 WeakPolarHBondContact O-CB 3.1Å; L11-G13 VanDerWaalsContact C-N 3.26Å; L11-G13 PolarHBondContact O-N 3.15Å; L11-Q14 PolarHBondContact O-N 3.35Å; L11-Q14 VanDerWaalsContact O-N 3.12Å; L11-L15 HydrophobicContact CD2-CD1 4.26Å; L11-L15 HydrophobicContact CG-CD1 3.93Å; L11-L15 HydrophobicContact CG-CG 4.35Å; L11-L15 WeakPolarHBondContact O-CB 3.46Å; L11-L15 VanDerWaalsContact O-CG 3.27Å; L11-L15 WeakPolarHBondContact O-CG 3.23Å; L11-L15 PolarHBondContact O-N 2.9Å
12	P	73.9	Confident	70.2	Confident	83 Å²	83	91.4 Å²	91.4	54%	0.539	50%	0.502	S	S	.	.	H	α-helix	trans	-61.7	-34.6	179.4	-21.6	33.5	0	0	0	112.7	V8 K9 L15 K16	V8-P12 WeakPolarHBondContact O-CD 3.38Å; K9-P12 WeakPolarHBondContact O-CD 3.37Å; P12-L15 PolarHBondContact O-N 2.87Å; P12-K16 PolarHBondContact O-N 2.94Å
13	G	78.1	Confident	70.5	Confident	53 Å²	53	92 Å²	92	55%	0.546	50%	0.501	S	S	.	.	H	α-helix	trans	-70	-37.8	175.8	0	0	0	0	0	112.5	A10 L11 L15	A10-G13 PolarHBondContact O-N 2.77Å; A10-G13 VanDerWaalsContact O-N 3.16Å; L11-G13 VanDerWaalsContact C-N 3.26Å; L11-G13 PolarHBondContact O-N 3.15Å; G13-L15 VanDerWaalsContact C-N 3.32Å
14	Q	74.4	Confident	70.5	Confident	104 Å²	104	96.3 Å²	96.3	49%	0.486	51%	0.507	S	S	.	.	H	α-helix	trans	-72.1	-25.2	176.7	-67.2	179.8	-37.2	0	0	112.8	A10 L11 P17 F18	A10-Q14 PolarHBondContact O-N 3.28Å; L11-Q14 PolarHBondContact O-N 3.35Å; L11-Q14 VanDerWaalsContact O-N 3.12Å; Q14-P17 WeakPolarHBondContact O-CD 3.38Å; Q14-F18 WeakPolarHBondContact O-CD2 3.49Å; Q14-F18 WeakPolarHBondContact O-CE2 3.26Å
15	L	72.4	Confident	70.2	Confident	78 Å²	78	90.7 Å²	90.7	41%	0.408	48%	0.484	S	S	.	.	H	α-helix	trans	-87.6	-21.2	-179.5	-67.5	175.9	0	0	0	114.2	L11 P12 G13 P17 F18 E19	L11-L15 HydrophobicContact CD2-CD1 4.26Å; L11-L15 HydrophobicContact CG-CD1 3.93Å; L11-L15 HydrophobicContact CG-CG 4.35Å; L11-L15 WeakPolarHBondContact O-CB 3.46Å; L11-L15 VanDerWaalsContact O-CG 3.27Å; L11-L15 WeakPolarHBondContact O-CG 3.23Å; L11-L15 PolarHBondContact O-N 2.9Å; P12-L15 PolarHBondContact O-N 2.87Å; G13-L15 VanDerWaalsContact C-N 3.32Å; L15-P17 VanDerWaalsContact C-CD 3.5Å; L15-F18 HydrophobicContact CD2-CD2 4.38Å; L15-F18 WeakPolarHBondContact O-CA 3.46Å; L15-F18 WeakPolarHBondContact O-CB 3.27Å; L15-F18 PolarHBondContact O-N 3.03Å; L15-E19 PolarHBondContact O-N 2.94Å
16	K	72.1	Confident	69.8	Low	140 Å²	140	93.1 Å²	93.1	61%	0.609	49%	0.492	S	S	*	.	H	α-helix	trans	-51.2	-44	177.6	-112.4	-171.9	177.4	-174.4	0	115.5	P12 F18 E19 T20	P12-K16 PolarHBondContact O-N 2.94Å; K16-F18 VanDerWaalsContact C-N 3.26Å; K16-F18 PolarHBondContact O-N 3.31Å; K16-E19 PolarHBondContact O-N 3.37Å; K16-T20 PolarHBondContact O-N 3.38Å; K16-T20 VanDerWaalsContact O-N 3.08Å; K16-T20 PolarHBondContact O-OG1 2.84Å
17	P	73.1	Confident	69.2	Low	71 Å²	71	91.1 Å²	91.1	46%	0.461	50%	0.495	S	S	.	.	H	α-helix	trans	-62.3	-35.5	175.8	-23.4	34.7	0	0	0	112.1	Q14 L15 T20 L21	Q14-P17 WeakPolarHBondContact O-CD 3.38Å; L15-P17 VanDerWaalsContact C-CD 3.5Å; P17-T20 PolarHBondContact O-N 2.95Å; P17-L21 WeakPolarHBondContact O-CB 3.49Å; P17-L21 VanDerWaalsContact O-CG 3.23Å; P17-L21 WeakPolarHBondContact O-CG 3.38Å; P17-L21 PolarHBondContact O-N 3.22Å
18	F	69.6	Low	68.8	Low	105 Å²	105	86.2 Å²	86.2	46%	0.461	49%	0.488	S	S	.	.	H	α-helix	trans	-71.9	-40.5	177.8	-61.1	-82.2	0	0	0	111.7	Q14 L15 K16 T20 L21 L22 I32	Q14-F18 WeakPolarHBondContact O-CD2 3.49Å; Q14-F18 WeakPolarHBondContact O-CE2 3.26Å; L15-F18 HydrophobicContact CD2-CD2 4.38Å; L15-F18 WeakPolarHBondContact O-CA 3.46Å; L15-F18 WeakPolarHBondContact O-CB 3.27Å; L15-F18 PolarHBondContact O-N 3.03Å; K16-F18 VanDerWaalsContact C-N 3.26Å; K16-F18 PolarHBondContact O-N 3.31Å; F18-T20 VanDerWaalsContact C-N 3.28Å; F18-T20 PolarHBondContact O-N 3.22Å; F18-L21 PolarHBondContact O-N 2.9Å; F18-L22 WeakPolarHBondContact O-CB 3.33Å; F18-L22 VanDerWaalsContact O-CG 3.26Å; F18-L22 WeakPolarHBondContact O-CG 3.34Å; F18-L22 PolarHBondContact O-N 3.34Å; F18-I32 HydrophobicContact CB-CD1 4.04Å; F18-I32 HydrophobicContact CD1-CD1 4.01Å; F18-I32 HydrophobicContact CD1-CG1 4.43Å; F18-I32 HydrophobicContact CD1-CG2 4.33Å; F18-I32 WeakPolarHBondContact O-CD1 3.32Å
19	E	66.8	Low	68	Low	120 Å²	120	91.1 Å²	91.1	56%	0.561	50%	0.503	S	S	*	.	H	α-helix	trans	-59.7	-40	172.7	-68.9	-178.8	169.9	0	0	112.2	L15 K16 L22 S23	L15-E19 PolarHBondContact O-N 2.94Å; K16-E19 PolarHBondContact O-N 3.37Å; E19-L22 PolarHBondContact O-N 3.12Å; E19-S23 WeakPolarHBondContact O-CB 3.45Å; E19-S23 PolarHBondContact O-N 3.42Å; E19-S23 PolarHBondContact O-OG 3.47Å
20	T	69.6	Low	66.9	Low	78 Å²	78	85.3 Å²	85.3	48%	0.479	48%	0.48	S	S	.	.	H	α-helix	trans	-65.3	-44.5	176.4	-54.5	0	0	0	0	110.8	K16 P17 F18 S23 Q24	K16-T20 PolarHBondContact O-N 3.38Å; K16-T20 VanDerWaalsContact O-N 3.08Å; K16-T20 PolarHBondContact O-OG1 2.84Å; P17-T20 PolarHBondContact O-N 2.95Å; F18-T20 VanDerWaalsContact C-N 3.28Å; F18-T20 PolarHBondContact O-N 3.22Å; T20-S23 PolarHBondContact O-N 3.25Å; T20-Q24 WeakPolarHBondContact O-CG 3.24Å; T20-Q24 PolarHBondContact O-N 2.8Å
21	L	66.4	Low	65.9	Low	70 Å²	70	90.5 Å²	90.5	37%	0.366	49%	0.494	S	S	.	.	H	α-helix	trans	-66.5	-35.9	176.4	-71.1	168.2	0	0	0	112.4	P17 F18 Q24 N25 I32	P17-L21 WeakPolarHBondContact O-CB 3.49Å; P17-L21 VanDerWaalsContact O-CG 3.23Å; P17-L21 WeakPolarHBondContact O-CG 3.38Å; P17-L21 PolarHBondContact O-N 3.22Å; F18-L21 PolarHBondContact O-N 2.9Å; L21-Q24 PolarHBondContact O-N 3.24Å; L21-N25 WeakPolarHBondContact O-CB 3.48Å; L21-N25 PolarHBondContact O-N 2.97Å; L21-N25 PolarHBondContact O-ND2 3.39Å; L21-I32 HydrophobicContact CB-CD1 4.03Å; L21-I32 HydrophobicContact CB-CG2 4.26Å; L21-I32 HydrophobicContact CD1-CG2 3.98Å
22	L	65.3	Low	65.1	Low	61 Å²	61	90.4 Å²	90.4	32%	0.319	49%	0.493	S	S	.	.	H	α-helix	trans	-69.7	-39.4	175.3	-71.3	171.3	0	0	0	112.2	F18 E19 Q24 N25 G27 G28 I32	F18-L22 WeakPolarHBondContact O-CB 3.33Å; F18-L22 VanDerWaalsContact O-CG 3.26Å; F18-L22 WeakPolarHBondContact O-CG 3.34Å; F18-L22 PolarHBondContact O-N 3.34Å; E19-L22 PolarHBondContact O-N 3.12Å; L22-Q24 PolarHBondContact O-N 2.77Å; L22-N25 CarbonylContact O-C 3.6Å; L22-N25 WeakPolarHBondContact O-CA 3.47Å; L22-N25 WeakPolarHBondContact O-CB 3.4Å; L22-N25 PolarHBondContact O-N 2.93Å; L22-G27 CarbonylContact O-C 3.37Å; L22-G27 PolarHBondContact O-N 3.42Å; L22-G28 PolarHBondContact O-N 3.44Å; L22-I32 HydrophobicContact CD1-CD1 4.17Å; L22-I32 HydrophobicContact CD2-CD1 3.41Å; L22-I32 VanDerWaalsContact CD2-CD1 3.41Å; L22-I32 HydrophobicContact CD2-CG1 3.82Å; L22-I32 HydrophobicContact CG-CD1 3.38Å; L22-I32 HydrophobicContact CG-CG1 4.33Å
23	S	64.4	Low	63.9	Low	88 Å²	88	92.4 Å²	92.4	62%	0.615	50%	0.504	S	S	*	.	H	α-helix	trans	-61.1	-34.5	177.2	-60.9	0	0	0	0	111.4	E19 T20 N25	E19-S23 WeakPolarHBondContact O-CB 3.45Å; E19-S23 PolarHBondContact O-N 3.42Å; E19-S23 PolarHBondContact O-OG 3.47Å; T20-S23 PolarHBondContact O-N 3.25Å; S23-N25 VanDerWaalsContact C-N 3.32Å
24	Q	63.3	Low	62.4	Low	145 Å²	145	91.6 Å²	91.6	68%	0.678	50%	0.495	S	S	*	.	H	α-helix	trans	-76.4	-18.8	174.1	-67	172.9	-9	0	0	113	T20 L21 L22 Q26	T20-Q24 WeakPolarHBondContact O-CG 3.24Å; T20-Q24 PolarHBondContact O-N 2.8Å; L21-Q24 PolarHBondContact O-N 3.24Å; L22-Q24 PolarHBondContact O-N 2.77Å; Q24-Q26 PolarHBondContact O-N 3.01Å
25	N	59.3	Low	61.2	Low	28 Å²	28	93.8 Å²	93.8	15%	0.15	51%	0.51	C	S	.	.	T	Hydrogen-bonded Turn	trans	-96.1	58.4	178.5	-89.8	-61.9	0	0	0	111.6	L21 L22 S23 G27 G28 K29 T30	L21-N25 WeakPolarHBondContact O-CB 3.48Å; L21-N25 PolarHBondContact O-N 2.97Å; L21-N25 PolarHBondContact O-ND2 3.39Å; L22-N25 CarbonylContact O-C 3.6Å; L22-N25 WeakPolarHBondContact O-CA 3.47Å; L22-N25 WeakPolarHBondContact O-CB 3.4Å; L22-N25 PolarHBondContact O-N 2.93Å; S23-N25 VanDerWaalsContact C-N 3.32Å; N25-G27 PolarHBondContact O-N 2.95Å; N25-G27 VanDerWaalsContact O-N 3.12Å; N25-G28 PolarHBondContact O-N 3.08Å; N25-K29 PolarHBondContact O-N 3.39Å; N25-T30 WeakPolarHBondContact CA-OG1 3.44Å; N25-T30 WeakPolarHBondContact CB-OG1 3.19Å; N25-T30 PolarHBondContact O-OG1 2.96Å; N25-T30 PolarHBondContact OD1-OG1 2.95Å
26	Q	60.3	Low	60.1	Low	152 Å²	152	97.9 Å²	97.9	71%	0.71	53%	0.527	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.8	32.3	-179.2	-59.4	179.5	2.1	0	0	114.4	Q24	Q24-Q26 PolarHBondContact O-N 3.01Å
27	G	59.5	Low	59	Low	61 Å²	61	95.9 Å²	95.9	63%	0.629	53%	0.527	S	S	*	.	T	Hydrogen-bonded Turn	trans	74.9	33	-177.7	0	0	0	0	0	114.1	L22 N25	L22-G27 CarbonylContact O-C 3.37Å; L22-G27 PolarHBondContact O-N 3.42Å; N25-G27 PolarHBondContact O-N 2.95Å; N25-G27 VanDerWaalsContact O-N 3.12Å
28	G	58.8	Low	57.8	Low	40 Å²	40	96.8 Å²	96.8	41%	0.412	54%	0.535	S	S	.	.	T	Hydrogen-bonded Turn	trans	85.7	18	174.4	0	0	0	0	0	115.1	L22 N25	L22-G28 PolarHBondContact O-N 3.44Å; N25-G28 PolarHBondContact O-N 3.08Å
29	K	55.9	Low	56.9	Low	183 Å²	183	98.9 Å²	98.9	80%	0.796	55%	0.549	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.3	-14.4	173.9	-69	-168.7	177.2	-161.3	0	113.3	N25	N25-K29 PolarHBondContact O-N 3.39Å
30	T	53.3	Low	55.6	Low	27 Å²	27	102.1 Å²	102.1	17%	0.166	56%	0.556	C	S	.	*	S	Bend	trans	-116.9	147	175.3	59.1	0	0	0	0	110.1	N25	N25-T30 WeakPolarHBondContact CA-OG1 3.44Å; N25-T30 WeakPolarHBondContact CB-OG1 3.19Å; N25-T30 PolarHBondContact O-OG1 2.96Å; N25-T30 PolarHBondContact OD1-OG1 2.95Å
31	F	54	Low	54.5	Low	157 Å²	157	103.2 Å²	103.2	69%	0.689	57%	0.565	S	S	*	*			trans	-61.3	148.8	-179.6	-82.6	-94.4	0	0	0	110.9	V33 G34 V37	F31-V33 PolarHBondContact O-N 3.26Å; F31-G34 PolarHBondContact O-N 3.41Å; F31-V37 HydrophobicContact CD2-CG2 3.91Å; F31-V37 HydrophobicContact CE2-CG2 4.33Å
32	I	56.3	Low	53.6	Low	54 Å²	54	107.1 Å²	107.1	28%	0.277	58%	0.581	S	S	.	*	S	Bend	trans	-50.2	-25.2	-177.3	-62.9	-85.8	0	0	0	113.2	F18 L21 L22	F18-I32 HydrophobicContact CB-CD1 4.04Å; F18-I32 HydrophobicContact CD1-CD1 4.01Å; F18-I32 HydrophobicContact CD1-CG1 4.43Å; F18-I32 HydrophobicContact CD1-CG2 4.33Å; F18-I32 WeakPolarHBondContact O-CD1 3.32Å; L21-I32 HydrophobicContact CB-CD1 4.03Å; L21-I32 HydrophobicContact CB-CG2 4.26Å; L21-I32 HydrophobicContact CD1-CG2 3.98Å; L22-I32 HydrophobicContact CD1-CD1 4.17Å; L22-I32 HydrophobicContact CD2-CD1 3.41Å; L22-I32 VanDerWaalsContact CD2-CD1 3.41Å; L22-I32 HydrophobicContact CD2-CG1 3.82Å; L22-I32 HydrophobicContact CG-CD1 3.38Å; L22-I32 HydrophobicContact CG-CG1 4.33Å
33	V	48.5	Very low	52.9	Low	126 Å²	126	108 Å²	108	76%	0.764	60%	0.596	S	S	*	*	S	Bend	trans	-110.9	70.3	179.2	178.5	0	0	0	0	109.8	F31	F31-V33 PolarHBondContact O-N 3.26Å
34	G	46.3	Very low	52	Low	35 Å²	35	109.4 Å²	109.4	36%	0.361	60%	0.601	S	S	.	*	T	Hydrogen-bonded Turn	trans	60.1	172.8	164.8	0	0	0	0	0	116.7	F31 Q36	F31-G34 PolarHBondContact O-N 3.41Å; G34-Q36 PolarHBondContact O-N 3.48Å
35	D	50.3	Low	51.4	Low	150 Å²	150	107.8 Å²	107.8	80%	0.802	60%	0.603	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.9	34.1	-176.9	-162.7	30	0	0	0	113.7
36	Q	49.3	Very low	51.1	Low	165 Å²	165	111.9 Å²	111.9	77%	0.771	63%	0.634	S	S	*	*			trans	-122.3	76.7	176.8	-75.5	-170.6	87.2	0	0	110.2	G34 S38	G34-Q36 PolarHBondContact O-N 3.48Å; Q36-S38 PolarHBondContact O-N 3.4Å
37	V	48.3	Very low	50.9	Low	98 Å²	98	108.4 Å²	108.4	59%	0.594	63%	0.627	S	S	*	*			trans	-72	74	154	-170.9	0	0	0	0	107.1	F31 I39	F31-V37 HydrophobicContact CD2-CG2 3.91Å; F31-V37 HydrophobicContact CE2-CG2 4.33Å; V37-I39 VanDerWaalsContact C-N 3.3Å; V37-I39 PolarHBondContact O-N 2.92Å
38	S	48.3	Very low	50.5	Low	90 Å²	90	111.2 Å²	111.2	63%	0.629	63%	0.634	S	S	*	*			trans	-72.5	92.7	167.6	51.5	0	0	0	0	108.4	Q36	Q36-S38 PolarHBondContact O-N 3.4Å
39	I	50.2	Low	50.1	Low	148 Å²	148	115.5 Å²	115.5	76%	0.759	65%	0.654	S	S	*	*			trans	45.3	87.4	151.5	-44.3	171.2	0	0	0	114.4	V37	V37-I39 VanDerWaalsContact C-N 3.3Å; V37-I39 PolarHBondContact O-N 2.92Å
40	W	40.3	Very low	50	Low	189 Å²	189	112 Å²	112	72%	0.716	65%	0.653	S	S	*	*			trans	-78.3	135.7	156.6	-81.6	81.6	0	0	0	109.5	H42 A43	W40-H42 AromaticContact CE3-NE2 3.62Å; W40-H42 PolarHBondContact O-N 3.4Å; W40-A43 PolarHBondContact O-N 3.34Å
41	P	45.4	Very low	50	Low	101 Å²	101	115.2 Å²	115.2	66%	0.656	68%	0.682	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.4	25.4	-166.2	30.2	-36.6	0	0	0	115.2
42	H	47.8	Very low	49.7	Very low	151 Å²	151	113 Å²	113	70%	0.699	69%	0.686	S	S	*	*	T	Hydrogen-bonded Turn	trans	-115.1	-0.7	176	-20.7	-87.1	0	0	0	112.9	W40	W40-H42 AromaticContact CE3-NE2 3.62Å; W40-H42 PolarHBondContact O-N 3.4Å
43	A	51.5	Low	49.2	Very low	79 Å²	79	120.7 Å²	120.7	65%	0.653	71%	0.712	S	S	*	*			trans	-107	72.2	168.3	0	0	0	0	0	108.9	W40 P45	W40-A43 PolarHBondContact O-N 3.34Å; A43-P45 WeakPolarHBondContact O-CD 3.4Å
44	V	45.3	Very low	48.4	Very low	118 Å²	118	127.3 Å²	127.3	72%	0.715	72%	0.723	S	S	*	*			trans	-73.5	114.1	165.4	-179.5	0	0	0	0	106.6	S46	V44-S46 PolarHBondContact O-N 2.96Å
45	P	51.2	Low	48.2	Very low	111 Å²	111	131.1 Å²	131.1	72%	0.721	74%	0.74	S	S	*	*			trans	-66.4	107.5	166.2	26.2	-29.1	0	0	0	107	A43 S47	A43-P45 WeakPolarHBondContact O-CD 3.4Å; P45-S47 PolarHBondContact O-N 3.34Å
46	S	51.5	Low	48.2	Very low	114 Å²	114	132 Å²	132	80%	0.797	74%	0.739	S	S	*	*	S	Bend	trans	-70.4	16	176.5	53.7	0	0	0	0	113.1	V44	V44-S46 PolarHBondContact O-N 2.96Å
47	S	57.3	Low	47.7	Very low	80 Å²	80	130.6 Å²	130.6	56%	0.559	74%	0.741	S	S	*	*	S	Bend	trans	-152.2	123.4	-177.7	-57.3	0	0	0	0	110.2	P45	P45-S47 PolarHBondContact O-N 3.34Å
48	P	50.9	Low	47.5	Very low	120 Å²	120	130.5 Å²	130.5	78%	0.779	75%	0.745	S	S	*	*			trans	-66.4	131.6	167.7	27.1	-30.4	0	0	0	108.5	S50	P48-S50 PolarHBondContact O-N 2.94Å
49	P	49.7	Very low	47.5	Very low	129 Å²	129	131.2 Å²	131.2	84%	0.838	75%	0.748	S	S	*	*			trans	-64.4	114.8	172.1	23.6	-29.2	0	0	0	108.9	A51	P49-A51 PolarHBondContact O-N 3.23Å
50	S	53.7	Low	47.5	Very low	111 Å²	111	129.1 Å²	129.1	78%	0.776	75%	0.746	S	S	*	*			trans	-56.7	131.1	169.3	173.6	0	0	0	0	109.3	P48 S52	P48-S50 PolarHBondContact O-N 2.94Å; S50-S52 PolarHBondContact O-N 3.04Å
51	A	53.9	Low	47.8	Very low	93 Å²	93	127.9 Å²	127.9	77%	0.769	75%	0.753	S	S	*	*			trans	-50.6	120.9	-179.7	0	0	0	0	0	112.2	P49	P49-A51 PolarHBondContact O-N 3.23Å
52	S	47.2	Very low	47.8	Very low	111 Å²	111	128.6 Å²	128.6	78%	0.776	76%	0.755	S	S	*	*			trans	-155.4	82.1	160.1	-69.5	0	0	0	0	111.4	S50	S50-S52 PolarHBondContact O-N 3.04Å
53	R	45.4	Very low	48.2	Very low	215 Å²	215	128 Å²	128	81%	0.811	76%	0.762	S	S	*	*			trans	57.7	98.1	130.8	-167.6	-178.4	-66.3	-97.7	-2.9	117.4	T55	R53-T55 HydrophobicContact CG-CG2 4.06Å; R53-T55 PolarHBondContact O-N 3.28Å
54	W	31.6	Very low	48.2	Very low	265 Å²	265	128.8 Å²	128.8	100%	1.004	76%	0.759	S	S	*	*			trans	-66.2	94.3	158.8	-62.2	100.7	0	0	0	109.9	Q56	W54-Q56 PolarHBondContact O-N 3.12Å
55	T	44.1	Very low	48.5	Very low	115 Å²	115	128.5 Å²	128.5	71%	0.706	76%	0.761	S	S	*	*			trans	-80.7	99.2	165.9	31.1	0	0	0	0	110.1	R53	R53-T55 HydrophobicContact CG-CG2 4.06Å; R53-T55 PolarHBondContact O-N 3.28Å
56	Q	49.9	Very low	48.2	Very low	169 Å²	169	133.5 Å²	133.5	79%	0.79	77%	0.766	S	S	*	*			trans	-7.3	122.5	143.7	-176.3	175.7	-40.8	0	0	116.4	W54	W54-Q56 PolarHBondContact O-N 3.12Å
57	V	37.7	Very low	48.4	Very low	135 Å²	135	133.7 Å²	133.7	82%	0.818	76%	0.762	S	S	*	*			trans	-119	109.6	153.5	153.1	0	0	0	0	107.5
58	S	44.3	Very low	47.7	Very low	97 Å²	97	136.1 Å²	136.1	68%	0.678	78%	0.778	S	S	*	*			trans	-118.4	132.4	161.2	-57.5	0	0	0	0	107.1
59	P	48.4	Very low	47.4	Very low	105 Å²	105	140 Å²	140	68%	0.682	81%	0.805	S	S	*	*			trans	-125.6	107.9	149	30.7	-15.1	0	0	0	108.4
60	S	49.9	Very low	47.3	Very low	104 Å²	104	140.5 Å²	140.5	73%	0.727	80%	0.804	S	S	*	*			trans	46.1	99.7	155.3	64.3	0	0	0	0	117.5
61	L	46.5	Very low	46.9	Very low	163 Å²	163	142.1 Å²	142.1	85%	0.853	81%	0.805	S	S	*	*				-160.9	96.7	125	-97.6	149.6	0	0	0	107.2
62	T	46.1	Very low	46.6	Very low	115 Å²	115	144.8 Å²	144.8	71%	0.706	81%	0.807	S	S	*	*			trans	46.3	102.6	149.6	48	0	0	0	0	117.5	T64	T62-T64 PolarHBondContact O-N 3.17Å
63	T	56.4	Low	46.5	Very low	138 Å²	138	146.8 Å²	146.8	85%	0.847	81%	0.809	S	S	*	*			trans	-32.4	108.8	143.4	-58.8	0	0	0	0	111.4
64	T	52.2	Low	46.6	Very low	96 Å²	96	142.5 Å²	142.5	59%	0.589	81%	0.809	S	S	*	*			trans	-142.6	94.5	144.2	-22.7	0	0	0	0	108.6	T62 W66	T62-T64 PolarHBondContact O-N 3.17Å; T64-W66 PolarHBondContact O-N 3.16Å; T64-W66 VanDerWaalsContact O-N 3.11Å
65	C	51.1	Low	47.6	Very low	112 Å²	112	134.3 Å²	134.3	76%	0.757	80%	0.796	S	S	*	*			trans	-62.8	103.3	160.2	-170.4	0	0	0	0	106.7
66	W	45.1	Very low	47.8	Very low	217 Å²	217	135.7 Å²	135.7	82%	0.822	80%	0.802	S	S	*	*			trans	-108.3	101.2	157.2	-75.2	89.7	0	0	0	106.4	T64 C68	T64-W66 PolarHBondContact O-N 3.16Å; T64-W66 VanDerWaalsContact O-N 3.11Å; W66-C68 PolarHBondContact O-N 3.41Å
67	T	54.3	Low	47.7	Very low	117 Å²	117	133.2 Å²	133.2	72%	0.718	80%	0.803	S	S	*	*			trans	-37.9	122.8	156.1	-10.7	0	0	0	0	108.8	C69	T67-C69 PolarHBondContact O-N 2.94Å; T67-C69 VanDerWaalsContact O-N 3.15Å
68	C	44.1	Very low	48.5	Very low	132 Å²	132	133 Å²	133	89%	0.892	80%	0.802	S	S	*	*			trans	-55.5	116.1	166.5	-86.8	0	0	0	0	109.2	W66	W66-C68 PolarHBondContact O-N 3.41Å
69	C	43.8	Very low	48.9	Very low	200 Å²	200	136.3 Å²	136.3	100%	1.351	81%	0.813	S	S	*	*			trans	-117.7	0	149.8	-83.1	0	0	0	0	107.2	T67	T67-C69 PolarHBondContact O-N 2.94Å; T67-C69 VanDerWaalsContact O-N 3.15Å

Retrieved 69 of 69 residues in 68.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).