A0A087X261_HUMAN Loading...

26S proteasome complex subunit SEM1

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins.

AlphaFold DB , UniProt , Accession A0A087X261, Species HUMAN (Homo sapiens, Human), Gene SEM1, Length 58 aa.

						>A0A087X261_HUMAN|A0A087X261|SEM1
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.6	Very low	55.3	Low	242 Å²	242	141.3 Å²	141.3	100%	1.192	74%	0.737	S	S	*	*				0	95.2	0	-64.4	-66.3	-166.8	0	0	106.7
2	S	50.3	Low	55.8	Low	117 Å²	117	138.8 Å²	138.8	82%	0.818	73%	0.725	S	S	*	*			trans	-80.5	114.7	172.3	-81.4	0	0	0	0	108.2
3	E	53.9	Low	56.1	Low	192 Å²	192	134.6 Å²	134.6	90%	0.897	70%	0.703	S	S	*	*			trans	-111.8	122.8	159.4	-154.7	91.4	84.8	0	0	107.4
4	K	46.5	Very low	56.4	Low	177 Å²	177	134.4 Å²	134.4	77%	0.77	70%	0.697	S	S	*	*	P	Polyproline II helix	trans	-72.9	129.1	-172.2	-59.5	177.8	179.1	71.7	0	108.2	Q6	K4-Q6 PolarHBondContact O-N 3.4Å; K4-Q6 VanDerWaalsContact O-N 3.08Å
5	K	56.4	Low	56.5	Low	200 Å²	200	133.5 Å²	133.5	87%	0.87	69%	0.688	S	S	*	*	P	Polyproline II helix	trans	-50.8	119.6	162	-76.1	-174	166.3	80.1	0	106.5
6	Q	61	Low	56.9	Low	162 Å²	162	132.1 Å²	132.1	76%	0.757	68%	0.682	S	S	*	*	P	Polyproline II helix	trans	-47.5	139	169.1	-62.2	-83.6	-69.4	0	0	107	K4 V8	K4-Q6 PolarHBondContact O-N 3.4Å; K4-Q6 VanDerWaalsContact O-N 3.08Å; Q6-V8 PolarHBondContact O-N 3.46Å
7	P	55.8	Low	57.4	Low	122 Å²	122	131.4 Å²	131.4	79%	0.792	68%	0.679	S	S	*	*			trans	-56.8	110	170.8	26	-31.2	0	0	0	105.7	D9	P7-D9 PolarHBondContact O-N 2.85Å; P7-D9 VanDerWaalsContact O-N 3.13Å
8	V	61.5	Low	58.2	Low	91 Å²	91	131.6 Å²	131.6	55%	0.552	68%	0.677	S	S	*	*			trans	-59.7	121.8	176.8	-164.6	0	0	0	0	104.5	Q6 L10 L13	Q6-V8 PolarHBondContact O-N 3.46Å; V8-L10 PolarHBondContact O-N 2.91Å; V8-L13 HydrophobicContact CB-CD1 4.08Å; V8-L13 HydrophobicContact CG1-CD1 3.62Å; V8-L13 HydrophobicContact CG1-CD2 4.13Å; V8-L13 HydrophobicContact CG1-CG 3.92Å
9	D	62.7	Low	58.5	Low	109 Å²	109	133.7 Å²	133.7	58%	0.583	68%	0.681	S	S	*	*			trans	-62.3	108.7	-176.1	-165.2	7	0	0	0	107	P7 G11 L12 L13	P7-D9 PolarHBondContact O-N 2.85Å; P7-D9 VanDerWaalsContact O-N 3.13Å; D9-G11 PolarHBondContact O-N 3.14Å; D9-L12 HydrophobicContact CB-CB 4.39Å; D9-L12 HydrophobicContact CB-CD1 4.21Å; D9-L12 WeakPolarHBondContact O-CB 3.3Å; D9-L12 PolarHBondContact O-N 3.13Å; D9-L12 VanDerWaalsContact O-N 3.11Å; D9-L13 PolarHBondContact O-N 3.44Å
10	L	58.7	Low	59	Low	115 Å²	115	135 Å²	135	60%	0.602	68%	0.684	S	S	*	*	H	α-helix	trans	-65	-24.8	-171.3	-69.5	166.2	0	0	0	110.8	V8 L13 E14	V8-L10 PolarHBondContact O-N 2.91Å; L10-L13 HydrophobicContact CD2-CD1 4.35Å; L10-L13 PolarHBondContact O-N 3.19Å; L10-E14 WeakPolarHBondContact O-CB 3.44Å; L10-E14 VanDerWaalsContact O-CG 3.3Å; L10-E14 WeakPolarHBondContact O-CG 3.46Å; L10-E14 PolarHBondContact O-N 3.45Å
11	G	61.5	Low	59.5	Low	27 Å²	27	136.5 Å²	136.5	28%	0.278	69%	0.689	S	S	.	*	H	α-helix	trans	-58.6	-50.6	170.8	0	0	0	0	0	111.7	D9 L13 E14 E15	D9-G11 PolarHBondContact O-N 3.14Å; G11-L13 PolarHBondContact O-N 3.43Å; G11-L13 VanDerWaalsContact O-N 3.13Å; G11-E14 PolarHBondContact O-N 3.49Å; G11-E14 VanDerWaalsContact O-N 3.13Å; G11-E15 WeakPolarHBondContact O-CB 3.09Å; G11-E15 WeakPolarHBondContact O-CG 3.37Å; G11-E15 PolarHBondContact O-N 3.42Å
12	L	61.9	Low	60.7	Low	112 Å²	112	132.3 Å²	132.3	59%	0.586	66%	0.664	S	S	*	*	H	α-helix	trans	-61.1	-24.1	177.2	-99	155.2	0	0	0	114.3	D9 E15	D9-L12 HydrophobicContact CB-CB 4.39Å; D9-L12 HydrophobicContact CB-CD1 4.21Å; D9-L12 WeakPolarHBondContact O-CB 3.3Å; D9-L12 PolarHBondContact O-N 3.13Å; D9-L12 VanDerWaalsContact O-N 3.11Å; L12-E15 PolarHBondContact N-OE1 3.48Å
13	L	60	Low	61.7	Low	84 Å²	84	132.1 Å²	132.1	44%	0.44	66%	0.66	S	S	.	*	H	α-helix	trans	-87.1	-36.5	175.9	-65.3	176.8	0	0	0	112.1	V8 D9 L10 G11 E15 D16 D17	V8-L13 HydrophobicContact CB-CD1 4.08Å; V8-L13 HydrophobicContact CG1-CD1 3.62Å; V8-L13 HydrophobicContact CG1-CD2 4.13Å; V8-L13 HydrophobicContact CG1-CG 3.92Å; D9-L13 PolarHBondContact O-N 3.44Å; L10-L13 HydrophobicContact CD2-CD1 4.35Å; L10-L13 PolarHBondContact O-N 3.19Å; G11-L13 PolarHBondContact O-N 3.43Å; G11-L13 VanDerWaalsContact O-N 3.13Å; L13-E15 VanDerWaalsContact C-N 3.32Å; L13-D16 PolarHBondContact O-N 2.9Å; L13-D17 PolarHBondContact O-N 3.25Å
14	E	59.6	Low	62.4	Low	132 Å²	132	127.8 Å²	127.8	62%	0.617	66%	0.657	S	S	*	*	H	α-helix	trans	-68.8	-33	173.8	-71.7	171.8	-168	0	0	111.2	L10 G11 D16 D17 E18	L10-E14 WeakPolarHBondContact O-CB 3.44Å; L10-E14 VanDerWaalsContact O-CG 3.3Å; L10-E14 WeakPolarHBondContact O-CG 3.46Å; L10-E14 PolarHBondContact O-N 3.45Å; G11-E14 PolarHBondContact O-N 3.49Å; G11-E14 VanDerWaalsContact O-N 3.13Å; E14-D16 VanDerWaalsContact C-N 3.33Å; E14-D16 PolarHBondContact O-N 3.13Å; E14-D17 PolarHBondContact O-N 3.13Å; E14-E18 PolarHBondContact O-N 3.24Å
15	E	58.7	Low	63.3	Low	120 Å²	120	126.2 Å²	126.2	56%	0.561	65%	0.652	S	S	*	*	H	α-helix	trans	-63.6	-33.6	173.5	-71.4	165.8	-126.9	0	0	112.9	G11 L12 L13	G11-E15 WeakPolarHBondContact O-CB 3.09Å; G11-E15 WeakPolarHBondContact O-CG 3.37Å; G11-E15 PolarHBondContact O-N 3.42Å; L12-E15 PolarHBondContact N-OE1 3.48Å; L13-E15 VanDerWaalsContact C-N 3.32Å
16	D	61.4	Low	63.6	Low	112 Å²	112	124 Å²	124	60%	0.599	65%	0.65	S	S	*	*	H	α-helix	trans	-74.2	-36	179	-153.1	29.2	0	0	0	111.1	L13 E14	L13-D16 PolarHBondContact O-N 2.9Å; E14-D16 VanDerWaalsContact C-N 3.33Å; E14-D16 PolarHBondContact O-N 3.13Å
17	D	66.3	Low	63.6	Low	119 Å²	119	125.5 Å²	125.5	64%	0.636	65%	0.649	S	S	*	*	H	α-helix	trans	-70.6	-32.7	175	-80.2	-19.8	0	0	0	112.5	L13 E14 F19 E20	L13-D17 PolarHBondContact O-N 3.25Å; E14-D17 PolarHBondContact O-N 3.13Å; D17-F19 VanDerWaalsContact C-N 3.31Å; D17-F19 PolarHBondContact O-N 3.44Å; D17-E20 PolarHBondContact O-N 2.96Å
18	E	71.4	Confident	63.5	Low	136 Å²	136	123.2 Å²	123.2	64%	0.636	64%	0.64	S	S	*	*	H	α-helix	trans	-73.9	-20.9	-179	-163.4	158.8	-163.9	0	0	112.6	E14	E14-E18 PolarHBondContact O-N 3.24Å
19	F	64.6	Low	63.2	Low	172 Å²	172	121.9 Å²	121.9	75%	0.754	65%	0.645	S	S	*	*	H	α-helix	trans	-77.9	-25.4	174.9	-156.1	-100.1	0	0	0	112.8	D17 E21	D17-F19 VanDerWaalsContact C-N 3.31Å; D17-F19 PolarHBondContact O-N 3.44Å; F19-E21 VanDerWaalsContact C-N 3.27Å; F19-E21 PolarHBondContact O-N 3.13Å
20	E	67.8	Low	62.8	Low	158 Å²	158	123.8 Å²	123.8	74%	0.738	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.3	-6.2	175.1	-64.8	-163.3	-177.2	0	0	113.7	D17 F22	D17-E20 PolarHBondContact O-N 2.96Å; E20-F22 VanDerWaalsContact C-N 3.28Å; E20-F22 PolarHBondContact O-N 3.11Å
21	E	69.3	Low	62.6	Low	168 Å²	168	122.6 Å²	122.6	79%	0.785	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.2	-16.2	177.8	-124.2	-170.9	-166.4	0	0	113.1	F19	F19-E21 VanDerWaalsContact C-N 3.27Å; F19-E21 PolarHBondContact O-N 3.13Å
22	F	65	Low	62.4	Low	154 Å²	154	129.4 Å²	129.4	68%	0.675	67%	0.673	S	S	*	*	S	Bend	trans	-79.3	143.1	172.8	-70.8	-85.5	0	0	0	110.5	E20 A24	E20-F22 VanDerWaalsContact C-N 3.28Å; E20-F22 PolarHBondContact O-N 3.11Å; F22-A24 PolarHBondContact O-N 3.35Å; F22-A24 VanDerWaalsContact O-N 3.13Å
23	P	71.7	Confident	62.1	Low	113 Å²	113	129.4 Å²	129.4	73%	0.734	67%	0.673	S	S	*	*			trans	-55.6	125.9	173.3	23	-30.6	0	0	0	108.5	E25	P23-E25 PolarHBondContact O-N 2.84Å
24	A	67.6	Low	62	Low	100 Å²	100	132.3 Å²	132.3	83%	0.826	69%	0.685	S	S	*	*			trans	-52.6	112.3	175.9	0	0	0	0	0	108.3	F22 D26	F22-A24 PolarHBondContact O-N 3.35Å; F22-A24 VanDerWaalsContact O-N 3.13Å; A24-D26 PolarHBondContact O-N 3.08Å; A24-D26 VanDerWaalsContact O-N 3.14Å
25	E	66.9	Low	61.9	Low	144 Å²	144	130.5 Å²	130.5	67%	0.673	68%	0.679	S	S	*	*			trans	-64.4	117.3	172.1	-155.9	120.8	167.2	0	0	105.6	P23 W27	P23-E25 PolarHBondContact O-N 2.84Å; E25-W27 PolarHBondContact O-N 2.69Å
26	D	62.9	Low	61.8	Low	154 Å²	154	126.7 Å²	126.7	82%	0.824	67%	0.669	S	S	*	*			trans	-70.5	83.4	174.8	-141.3	-36.8	0	0	0	105.3	A24 A28	A24-D26 PolarHBondContact O-N 3.08Å; A24-D26 VanDerWaalsContact O-N 3.14Å; D26-A28 PolarHBondContact O-N 2.8Å
27	W	59.5	Low	61.8	Low	193 Å²	193	126.1 Å²	126.1	73%	0.731	66%	0.662	S	S	*	*			trans	-65.7	69.2	174.7	-69.3	101.5	0	0	0	108.1	E25 G29	E25-W27 PolarHBondContact O-N 2.69Å; W27-G29 PolarHBondContact O-N 2.87Å
28	A	53.9	Low	61.6	Low	75 Å²	75	124.2 Å²	124.2	62%	0.62	66%	0.655	S	S	*	*			trans	-74.3	64.7	-179.7	0	0	0	0	0	108.9	D26 L30	D26-A28 PolarHBondContact O-N 2.8Å; A28-L30 PolarHBondContact O-N 2.77Å
29	G	55.3	Low	61.3	Low	62 Å²	62	127.2 Å²	127.2	64%	0.639	66%	0.66	S	S	*	*			trans	43.6	37.4	168.5	0	0	0	0	0	114.6	W27 D31	W27-G29 PolarHBondContact O-N 2.87Å; G29-D31 PolarHBondContact O-N 3.01Å
30	L	54	Low	61	Low	149 Å²	149	124.9 Å²	124.9	78%	0.78	65%	0.652	S	S	*	*	S	Bend	trans	-76.3	92	169.6	-93.1	162.5	0	0	0	105.9	A28	A28-L30 PolarHBondContact O-N 2.77Å
31	D	55.5	Low	60.8	Low	91 Å²	91	122.7 Å²	122.7	49%	0.487	65%	0.645	S	S	.	*			trans	52.3	74	167.5	-60.7	-62.3	0	0	0	113.9	G29 D33 E34	G29-D31 PolarHBondContact O-N 3.01Å; D31-D33 PolarHBondContact O-N 3.48Å; D31-E34 HydrophobicContact CB-CB 4.3Å; D31-E34 HydrophobicContact CB-CG 4.3Å; D31-E34 PolarHBondContact O-N 3.36Å
32	E	56.7	Low	60.4	Low	169 Å²	169	119.7 Å²	119.7	79%	0.79	64%	0.635	S	S	*	*	H	α-helix	trans	-48.7	-22.9	161.2	-82.8	177.8	174	0	0	112	A36	E32-A36 WeakPolarHBondContact O-CB 3.4Å; E32-A36 PolarHBondContact O-N 2.98Å
33	D	56.2	Low	60.6	Low	112 Å²	112	122.2 Å²	122.2	60%	0.599	64%	0.64	S	S	*	*	H	α-helix	trans	-71.1	-38.3	176.8	-59.1	-44	0	0	0	112.9	D31 H37	D31-D33 PolarHBondContact O-N 3.48Å; D33-H37 PolarHBondContact O-CD2 3.18Å; D33-H37 PolarHBondContact O-N 2.89Å; D33-H37 PolarHBondContact O-NE2 2.97Å
34	E	56.8	Low	60.1	Low	146 Å²	146	122.8 Å²	122.8	68%	0.682	64%	0.637	S	S	*	*	H	α-helix	trans	-73.5	-38.4	-178.4	-82.9	-145.9	144.9	0	0	112.9	D31 H37	D31-E34 HydrophobicContact CB-CB 4.3Å; D31-E34 HydrophobicContact CB-CG 4.3Å; D31-E34 PolarHBondContact O-N 3.36Å; E34-H37 PolarHBondContact O-N 3.44Å
35	D	57.4	Low	59.8	Low	93 Å²	93	122.9 Å²	122.9	50%	0.497	62%	0.623	S	S	.	*	H	α-helix	trans	-67.1	-44.3	176.4	-116.4	-35.2	0	0	0	109.9	H37 V38	D35-H37 VanDerWaalsContact C-N 3.27Å; D35-H37 PolarHBondContact O-N 3.46Å; D35-V38 PolarHBondContact O-N 3.18Å; D35-V38 VanDerWaalsContact O-N 3.14Å
36	A	57.8	Low	59.4	Low	41 Å²	41	121 Å²	121	34%	0.339	62%	0.618	S	S	.	*	H	α-helix	trans	-57.9	-37.5	177	0	0	0	0	0	113.1	E32 V38 W39 E40	E32-A36 WeakPolarHBondContact O-CB 3.4Å; E32-A36 PolarHBondContact O-N 2.98Å; A36-V38 VanDerWaalsContact C-N 3.29Å; A36-V38 PolarHBondContact O-N 2.79Å; A36-W39 PolarHBondContact O-N 3.31Å; A36-E40 WeakPolarHBondContact O-CG 3.22Å; A36-E40 PolarHBondContact O-N 2.95Å
37	H	60.5	Low	59.4	Low	99 Å²	99	119.5 Å²	119.5	46%	0.458	61%	0.61	S	S	.	*	H	α-helix	trans	-59.5	-35.2	177.8	-72.6	-38.9	0	0	0	113.3	D33 E34 D35 W39 D41	D33-H37 PolarHBondContact O-CD2 3.18Å; D33-H37 PolarHBondContact O-N 2.89Å; D33-H37 PolarHBondContact O-NE2 2.97Å; E34-H37 PolarHBondContact O-N 3.44Å; D35-H37 VanDerWaalsContact C-N 3.27Å; D35-H37 PolarHBondContact O-N 3.46Å; H37-W39 VanDerWaalsContact C-N 3.33Å; H37-W39 PolarHBondContact O-N 3.26Å; H37-D41 VanDerWaalsContact O-CB 3.22Å; H37-D41 WeakPolarHBondContact O-CB 3.43Å; H37-D41 PolarHBondContact O-N 3.46Å
38	V	63.5	Low	59.3	Low	79 Å²	79	115 Å²	115	48%	0.479	60%	0.603	S	S	.	*	H	α-helix	trans	-70.2	-31.2	179.5	-179.4	0	0	0	0	112	D35 A36 N42	D35-V38 PolarHBondContact O-N 3.18Å; D35-V38 VanDerWaalsContact O-N 3.14Å; A36-V38 VanDerWaalsContact C-N 3.29Å; A36-V38 PolarHBondContact O-N 2.79Å; V38-N42 WeakPolarHBondContact O-CB 3.5Å; V38-N42 VanDerWaalsContact O-CG 3.31Å; V38-N42 PolarHBondContact O-ND2 3.14Å
39	W	63.5	Low	59.5	Low	199 Å²	199	117.4 Å²	117.4	75%	0.754	60%	0.602	S	S	*	*	H	α-helix	trans	-86.5	-30.7	-179.6	-64.9	78.4	0	0	0	112.4	A36 H37	A36-W39 PolarHBondContact O-N 3.31Å; H37-W39 VanDerWaalsContact C-N 3.33Å; H37-W39 PolarHBondContact O-N 3.26Å
40	E	59.7	Low	59.8	Low	124 Å²	124	118.5 Å²	118.5	58%	0.579	59%	0.593	S	S	*	*	H	α-helix	trans	-75.4	-45.9	174.4	-69.7	-175.2	171.5	0	0	111.9	A36 N42 W43 D44	A36-E40 WeakPolarHBondContact O-CG 3.22Å; A36-E40 PolarHBondContact O-N 2.95Å; E40-N42 PolarHBondContact O-N 2.99Å; E40-W43 PolarHBondContact O-N 3.21Å; E40-D44 PolarHBondContact O-N 3.27Å
41	D	63.2	Low	60.5	Low	112 Å²	112	116.4 Å²	116.4	60%	0.599	58%	0.583	S	S	*	*	H	α-helix	trans	-65	-38.5	-178	-78.5	-13.3	0	0	0	112.3	H37 W43 D45	H37-D41 VanDerWaalsContact O-CB 3.22Å; H37-D41 WeakPolarHBondContact O-CB 3.43Å; H37-D41 PolarHBondContact O-N 3.46Å; D41-W43 VanDerWaalsContact C-N 3.32Å; D41-W43 PolarHBondContact O-N 3.42Å; D41-D45 WeakPolarHBondContact O-CB 3.38Å; D41-D45 PolarHBondContact O-N 3.36Å
42	N	61.2	Low	61	Low	105 Å²	105	118.4 Å²	118.4	56%	0.561	59%	0.587	S	S	*	*	H	α-helix	trans	-76.7	-16.2	-179.5	-71.4	-37.5	0	0	0	113.7	V38 E40	V38-N42 WeakPolarHBondContact O-CB 3.5Å; V38-N42 VanDerWaalsContact O-CG 3.31Å; V38-N42 PolarHBondContact O-ND2 3.14Å; E40-N42 PolarHBondContact O-N 2.99Å
43	W	67.9	Low	61.6	Low	207 Å²	207	112.7 Å²	112.7	78%	0.784	57%	0.566	S	S	*	*	H	α-helix	trans	-92.8	-32	178.5	-172.3	21.7	0	0	0	112.5	E40 D41	E40-W43 PolarHBondContact O-N 3.21Å; D41-W43 VanDerWaalsContact C-N 3.32Å; D41-W43 PolarHBondContact O-N 3.42Å
44	D	61.4	Low	62.2	Low	125 Å²	125	110.5 Å²	110.5	67%	0.668	55%	0.554	S	S	*	*	H	α-helix	trans	-76.1	-24.6	171.6	-93.2	-30	0	0	0	112.7	E40 D46 N47	E40-D44 PolarHBondContact O-N 3.27Å; D44-D46 VanDerWaalsContact C-N 3.35Å; D44-N47 WeakPolarHBondContact O-CB 3.4Å; D44-N47 PolarHBondContact O-N 3.01Å
45	D	61.1	Low	63	Low	101 Å²	101	109.8 Å²	109.8	54%	0.54	55%	0.551	S	S	.	*	T	Hydrogen-bonded Turn	trans	-70.7	-26.8	176.3	-158.1	24.6	0	0	0	113	D41 N47 V48 E49	D41-D45 WeakPolarHBondContact O-CB 3.38Å; D41-D45 PolarHBondContact O-N 3.36Å; D45-N47 PolarHBondContact O-N 3.15Å; D45-N47 VanDerWaalsContact O-N 3.15Å; D45-V48 PolarHBondContact O-N 3.25Å; D45-E49 PolarHBondContact O-N 3.29Å
46	D	59.7	Low	63.7	Low	105 Å²	105	111.4 Å²	111.4	56%	0.561	56%	0.559	S	S	*	*	H	α-helix	trans	-60.7	-23.2	172.3	-93.1	-16.9	0	0	0	112.6	D44	D44-D46 VanDerWaalsContact C-N 3.35Å
47	N	62	Low	64.3	Low	122 Å²	122	119.3 Å²	119.3	65%	0.652	58%	0.58	S	S	*	*	H	α-helix	trans	-76.7	-25.5	176.2	-165.2	8.3	0	0	0	112.2	D44 D45	D44-N47 WeakPolarHBondContact O-CB 3.4Å; D44-N47 PolarHBondContact O-N 3.01Å; D45-N47 PolarHBondContact O-N 3.15Å; D45-N47 VanDerWaalsContact O-N 3.15Å
48	V	59.1	Low	64.2	Low	98 Å²	98	122.2 Å²	122.2	59%	0.594	61%	0.611	S	S	*	*	H	α-helix	trans	-78.5	-30.9	175.9	-176.2	0	0	0	0	110.9	D45 D50 D51	D45-V48 PolarHBondContact O-N 3.25Å; V48-D50 VanDerWaalsContact C-N 3.26Å; V48-D50 PolarHBondContact O-N 3.33Å; V48-D51 PolarHBondContact O-N 2.86Å
49	E	57.5	Low	64.3	Low	126 Å²	126	124.4 Å²	124.4	59%	0.589	62%	0.618	S	S	*	*	H	α-helix	trans	-65.2	-23.2	174.9	-106.9	-161.4	88.3	0	0	114	D45 S53	D45-E49 PolarHBondContact O-N 3.29Å; E49-S53 WeakPolarHBondContact O-CB 3.49Å; E49-S53 PolarHBondContact O-N 2.88Å; E49-S53 VanDerWaalsContact O-N 3.14Å; E49-S53 PolarHBondContact O-OG 3.36Å
50	D	62.2	Low	64.3	Low	86 Å²	86	120.5 Å²	120.5	46%	0.46	61%	0.611	S	S	.	*	H	α-helix	trans	-68.5	-35.6	177.2	-165.3	64.2	0	0	0	111.9	V48 S53 N54	V48-D50 VanDerWaalsContact C-N 3.26Å; V48-D50 PolarHBondContact O-N 3.33Å; D50-S53 WeakPolarHBondContact O-CB 3.41Å; D50-S53 PolarHBondContact O-N 2.91Å; D50-N54 WeakPolarHBondContact O-CB 3.49Å; D50-N54 PolarHBondContact O-N 3.08Å; D50-N54 PolarHBondContact O-ND2 3.03Å; D50-N54 PolarHBondContact OD2-ND2 3.14Å
51	D	68.4	Low	64.6	Low	105 Å²	105	120.3 Å²	120.3	56%	0.561	61%	0.613	S	S	*	*	H	α-helix	trans	-72.1	-33.4	-179.2	-152.7	19.3	0	0	0	112.2	V48 N54 Q55	V48-D51 PolarHBondContact O-N 2.86Å; D51-N54 PolarHBondContact O-N 3.28Å; D51-Q55 PolarHBondContact O-N 3.46Å; D51-Q55 VanDerWaalsContact O-N 3.1Å
52	F	64.6	Low	64.6	Low	132 Å²	132	120.8 Å²	120.8	58%	0.579	61%	0.614	S	S	*	*	H	α-helix	trans	-66.2	-42.6	170.4	-171.2	-103.5	0	0	0	111.5	N54 Q55 L56	F52-N54 VanDerWaalsContact C-N 3.33Å; F52-N54 PolarHBondContact O-N 3.1Å; F52-Q55 PolarHBondContact O-N 3.45Å; F52-L56 HydrophobicContact CD1-CD1 3.85Å; F52-L56 HydrophobicContact CD1-CG 4.43Å; F52-L56 HydrophobicContact CE1-CD1 3.48Å; F52-L56 VanDerWaalsContact CE1-CD1 3.48Å; F52-L56 HydrophobicContact CE1-CG 4.19Å; F52-L56 HydrophobicContact CZ-CD1 4.16Å; F52-L56 WeakPolarHBondContact O-CG 3.43Å; F52-L56 PolarHBondContact O-N 3.29Å; F52-L56 VanDerWaalsContact O-N 3.08Å
53	S	70.7	Confident	64.8	Low	49 Å²	49	121.8 Å²	121.8	34%	0.343	62%	0.617	S	S	.	*	H	α-helix	trans	-64	-36.3	175.7	-65.5	0	0	0	0	112.7	E49 D50 L56 R57	E49-S53 WeakPolarHBondContact O-CB 3.49Å; E49-S53 PolarHBondContact O-N 2.88Å; E49-S53 VanDerWaalsContact O-N 3.14Å; E49-S53 PolarHBondContact O-OG 3.36Å; D50-S53 WeakPolarHBondContact O-CB 3.41Å; D50-S53 PolarHBondContact O-N 2.91Å; S53-L56 PolarHBondContact O-N 3.42Å; S53-R57 WeakPolarHBondContact O-CB 3.48Å; S53-R57 WeakPolarHBondContact O-CG 3.48Å; S53-R57 PolarHBondContact O-N 3.12Å; S53-R57 VanDerWaalsContact O-N 3.12Å
54	N	67.9	Low	64.6	Low	66 Å²	66	116.1 Å²	116.1	35%	0.353	61%	0.606	S	S	.	*	H	α-helix	trans	-69.1	-34.6	175.7	-72.4	-41.7	0	0	0	112.5	D50 D51 F52 R57 S58	D50-N54 WeakPolarHBondContact O-CB 3.49Å; D50-N54 PolarHBondContact O-N 3.08Å; D50-N54 PolarHBondContact O-ND2 3.03Å; D50-N54 PolarHBondContact OD2-ND2 3.14Å; D51-N54 PolarHBondContact O-N 3.28Å; F52-N54 VanDerWaalsContact C-N 3.33Å; F52-N54 PolarHBondContact O-N 3.1Å; N54-R57 PolarHBondContact O-N 3.4Å; N54-S58 PolarHBondContact O-N 3.45Å; N54-S58 PolarHBondContact O-OG 3.35Å
55	Q	73.4	Confident	64.9	Low	132 Å²	132	115.4 Å²	115.4	62%	0.617	60%	0.601	S	S	*	*	H	α-helix	trans	-68.1	-38.7	171.8	-76	179.6	31.2	0	0	112.8	D51 F52 R57 S58	D51-Q55 PolarHBondContact O-N 3.46Å; D51-Q55 VanDerWaalsContact O-N 3.1Å; F52-Q55 PolarHBondContact O-N 3.45Å; Q55-R57 VanDerWaalsContact C-N 3.28Å; Q55-R57 PolarHBondContact O-N 3.48Å; Q55-S58 PolarHBondContact O-N 3.47Å
56	L	71.9	Confident	65.2	Low	126 Å²	126	116.5 Å²	116.5	66%	0.66	61%	0.606	S	S	*	*	H	α-helix	trans	-73.1	-18.7	177.2	-69	179.7	0	0	0	113.9	F52 S53	F52-L56 HydrophobicContact CD1-CD1 3.85Å; F52-L56 HydrophobicContact CD1-CG 4.43Å; F52-L56 HydrophobicContact CE1-CD1 3.48Å; F52-L56 VanDerWaalsContact CE1-CD1 3.48Å; F52-L56 HydrophobicContact CE1-CG 4.19Å; F52-L56 HydrophobicContact CZ-CD1 4.16Å; F52-L56 WeakPolarHBondContact O-CG 3.43Å; F52-L56 PolarHBondContact O-N 3.29Å; F52-L56 VanDerWaalsContact O-N 3.08Å; S53-L56 PolarHBondContact O-N 3.42Å
57	R	71.9	Confident	65.6	Low	207 Å²	207	117.5 Å²	117.5	78%	0.781	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.3	-12.9	175.1	-84.7	175.6	151.8	167.9	-1.9	114.1	S53 N54 Q55	S53-R57 WeakPolarHBondContact O-CB 3.48Å; S53-R57 WeakPolarHBondContact O-CG 3.48Å; S53-R57 PolarHBondContact O-N 3.12Å; S53-R57 VanDerWaalsContact O-N 3.12Å; N54-R57 PolarHBondContact O-N 3.4Å; Q55-R57 VanDerWaalsContact C-N 3.28Å; Q55-R57 PolarHBondContact O-N 3.48Å
58	S	57.8	Low	66	Low	161 Å²	161	117.1 Å²	117.1	100%	1.126	61%	0.606	S	S	*	*			trans	-87.4	0	175.2	-66.3	0	0	0	0	111.8	N54 Q55	N54-S58 PolarHBondContact O-N 3.45Å; N54-S58 PolarHBondContact O-OG 3.35Å; Q55-S58 PolarHBondContact O-N 3.47Å

Retrieved 58 of 58 residues in 38.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).