A0A087X278_HUMAN Loading...

6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2

AlphaFold DB , UniProt , Accession A0A087X278, Species HUMAN (Homo sapiens, Human), Gene PFKFB2, Length 44 aa.

						>A0A087X278_HUMAN|A0A087X278|PFKFB2
MSGASSSEQNNNSYETKTPNLRMSEKKCCWSAVTGSWLTATLNS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.4	Very low	55.4	Low	242 Å²	242	132 Å²	132	100%	1.192	80%	0.801	S	S	*	*				0	130.9	0	-77.5	160.3	95.5	0	0	107.7
2	S	45.7	Very low	55.8	Low	122 Å²	122	131.1 Å²	131.1	85%	0.853	79%	0.788	S	S	*	*			trans	6.3	124.9	173.8	-48	0	0	0	0	119.8
3	G	51.8	Low	56.4	Low	75 Å²	75	127.1 Å²	127.1	77%	0.773	77%	0.77	S	S	*	*			trans	-58.9	139.9	175	0	0	0	0	0	113.3	S5	G3-S5 PolarHBondContact O-N 3.24Å; G3-S5 VanDerWaalsContact C-N 3.26Å
4	A	53.9	Low	57.1	Low	100 Å²	100	132.9 Å²	132.9	83%	0.826	77%	0.774	S	S	*	*			trans	-80	85.7	154.9	0	0	0	0	0	106.6	S6	A4-S6 PolarHBondContact O-N 3.42Å
5	S	57.6	Low	57.5	Low	117 Å²	117	133.5 Å²	133.5	82%	0.818	77%	0.766	S	S	*	*			trans	-60.1	94.1	150.7	-73.9	0	0	0	0	105	G3 S7	G3-S5 PolarHBondContact O-N 3.24Å; G3-S5 VanDerWaalsContact C-N 3.26Å; S5-S7 PolarHBondContact O-N 2.8Å
6	S	60.7	Low	57.9	Low	106 Å²	106	132.4 Å²	132.4	74%	0.741	76%	0.763	S	S	*	*			trans	-64.3	89.1	162.8	-170.5	0	0	0	0	104.1	A4 E8	A4-S6 PolarHBondContact O-N 3.42Å; S6-E8 PolarHBondContact O-N 2.77Å
7	S	61.5	Low	58.4	Low	90 Å²	90	134.9 Å²	134.9	63%	0.629	76%	0.763	S	S	*	*			trans	-50	99.2	164	168.9	0	0	0	0	104.4	S5 Q9	S5-S7 PolarHBondContact O-N 2.8Å; S7-Q9 PolarHBondContact O-N 2.81Å
8	E	60.3	Low	59.1	Low	177 Å²	177	134.2 Å²	134.2	83%	0.827	76%	0.762	S	S	*	*			trans	-46.4	102.8	161.6	-82.6	157.5	95.5	0	0	104.3	S6 N10	S6-E8 PolarHBondContact O-N 2.77Å; E8-N10 PolarHBondContact O-N 2.84Å
9	Q	61.1	Low	59.7	Low	163 Å²	163	131.8 Å²	131.8	76%	0.762	75%	0.752	S	S	*	*			trans	-62.1	98.7	179.1	-69.7	179.4	-79.7	0	0	104.1	S7 N11	S7-Q9 PolarHBondContact O-N 2.81Å; Q9-N11 VanDerWaalsContact C-N 3.28Å; Q9-N11 PolarHBondContact O-N 2.72Å; Q9-N11 PolarHBondContact O-ND2 3.11Å
10	N	58.1	Low	60.3	Low	117 Å²	117	133.1 Å²	133.1	63%	0.626	76%	0.756	S	S	*	*			trans	-58	97.3	178.8	168.9	8.3	0	0	0	106.7	E8 N12	E8-N10 PolarHBondContact O-N 2.84Å; N10-N12 PolarHBondContact O-N 2.88Å; N10-N12 VanDerWaalsContact O-N 3.11Å; N10-N12 WeakPolarHBondContact OD1-CA 3.11Å; N10-N12 WeakPolarHBondContact OD1-CB 3.37Å; N10-N12 PolarHBondContact OD1-N 2.71Å
11	N	59.2	Low	60.6	Low	143 Å²	143	133 Å²	133	77%	0.765	75%	0.753	S	S	*	*			trans	-73.4	12.1	176.5	-67	-47.7	0	0	0	112	Q9 S13	Q9-N11 VanDerWaalsContact C-N 3.28Å; Q9-N11 PolarHBondContact O-N 2.72Å; Q9-N11 PolarHBondContact O-ND2 3.11Å; N11-S13 PolarHBondContact O-N 2.7Å
12	N	59.8	Low	62.2	Low	121 Å²	121	132.5 Å²	132.5	65%	0.647	74%	0.738	S	S	*	*			trans	-89.2	47.8	165.7	-55	-3.9	0	0	0	109.6	N10 Y14	N10-N12 PolarHBondContact O-N 2.88Å; N10-N12 VanDerWaalsContact O-N 3.11Å; N10-N12 WeakPolarHBondContact OD1-CA 3.11Å; N10-N12 WeakPolarHBondContact OD1-CB 3.37Å; N10-N12 PolarHBondContact OD1-N 2.71Å; N12-Y14 PolarHBondContact O-N 2.77Å
13	S	64.6	Low	63.2	Low	79 Å²	79	134.6 Å²	134.6	55%	0.552	74%	0.736	S	S	*	*			trans	-67.2	96.3	154	61.5	0	0	0	0	105.3	N11 E15	N11-S13 PolarHBondContact O-N 2.7Å; S13-E15 PolarHBondContact O-N 3.2Å
14	Y	65.3	Low	64.4	Low	209 Å²	209	136.6 Å²	136.6	82%	0.82	74%	0.738	S	S	*	*			trans	-63.1	63.1	153	-80.1	-93.7	0	0	0	106.6	N12 T16	N12-Y14 PolarHBondContact O-N 2.77Å; Y14-T16 PolarHBondContact O-N 2.77Å
15	E	63.1	Low	65.4	Low	141 Å²	141	140.7 Å²	140.7	66%	0.659	74%	0.741	S	S	*	*			trans	-65.6	88.8	164.6	-63.6	-153.6	121.7	0	0	104	S13 K17	S13-E15 PolarHBondContact O-N 3.2Å; E15-K17 PolarHBondContact O-N 2.93Å
16	T	63.9	Low	66.2	Low	117 Å²	117	143.2 Å²	143.2	72%	0.718	74%	0.737	S	S	*	*			trans	-66.2	82.1	162.9	-51.2	0	0	0	0	103.8	Y14 T18	Y14-T16 PolarHBondContact O-N 2.77Å; T16-T18 VanDerWaalsContact C-N 3.26Å; T16-T18 PolarHBondContact O-N 2.75Å
17	K	67.4	Low	66.9	Low	175 Å²	175	147.4 Å²	147.4	76%	0.761	74%	0.742	S	S	*	*			trans	-53.6	102.3	172.1	-79.8	-175.6	179	179.2	0	104.4	E15 P19	E15-K17 PolarHBondContact O-N 2.93Å; K17-P19 WeakPolarHBondContact O-CD 3.1Å
18	T	70.4	Confident	67.2	Low	121 Å²	121	146.5 Å²	146.5	74%	0.742	74%	0.735	S	S	*	*			trans	-62.6	111.8	-177.7	-27	0	0	0	0	103.9	T16 N20	T16-T18 VanDerWaalsContact C-N 3.26Å; T16-T18 PolarHBondContact O-N 2.75Å; T18-N20 PolarHBondContact O-N 2.9Å
19	P	71.3	Confident	67.7	Low	89 Å²	89	143.7 Å²	143.7	58%	0.578	73%	0.733	S	S	*	*			trans	-56.2	133.4	175.2	23.1	-29.8	0	0	0	105.2	K17 L21	K17-P19 WeakPolarHBondContact O-CD 3.1Å; P19-L21 HydrophobicContact CG-CD1 4.13Å; P19-L21 HydrophobicContact CG-CG 4.19Å; P19-L21 PolarHBondContact O-N 2.78Å
20	N	70.1	Confident	68	Low	157 Å²	157	146.9 Å²	146.9	84%	0.84	74%	0.738	S	S	*	*			trans	-63	75.5	177.2	-74.3	-78	0	0	0	108.6	T18 R22	T18-N20 PolarHBondContact O-N 2.9Å; N20-R22 PolarHBondContact O-N 3.18Å
21	L	68	Low	68.1	Low	131 Å²	131	145.9 Å²	145.9	69%	0.686	74%	0.741	S	S	*	*			trans	-75.3	82.8	175.3	-79.5	165.6	0	0	0	105.4	P19 M23	P19-L21 HydrophobicContact CG-CD1 4.13Å; P19-L21 HydrophobicContact CG-CG 4.19Å; P19-L21 PolarHBondContact O-N 2.78Å; L21-M23 PolarHBondContact O-N 2.61Å
22	R	73.5	Confident	68.2	Low	232 Å²	232	142.7 Å²	142.7	88%	0.875	73%	0.734	S	S	*	*			trans	-63.8	83.2	160.3	-74.1	-84	167	109.1	-5.1	106.3	N20 S24	N20-R22 PolarHBondContact O-N 3.18Å; R22-S24 PolarHBondContact O-N 2.93Å; R22-S24 VanDerWaalsContact C-N 3.31Å
23	M	66.3	Low	68.1	Low	166 Å²	166	141.6 Å²	141.6	82%	0.818	73%	0.731	S	S	*	*			trans	-61.6	100.6	166.2	-73	-104.4	-147.9	0	0	105.6	L21 E25	L21-M23 PolarHBondContact O-N 2.61Å; M23-E25 PolarHBondContact O-N 2.8Å; M23-E25 VanDerWaalsContact O-N 3.08Å
24	S	76.1	Confident	67.9	Low	117 Å²	117	142.7 Å²	142.7	82%	0.818	74%	0.735	S	S	*	*			trans	-59.5	118.1	173.3	-152	0	0	0	0	106.5	R22 K26	R22-S24 PolarHBondContact O-N 2.93Å; R22-S24 VanDerWaalsContact C-N 3.31Å; S24-K26 VanDerWaalsContact C-N 3.33Å; S24-K26 PolarHBondContact O-N 3.08Å
25	E	75	Confident	67.5	Low	186 Å²	186	134.9 Å²	134.9	87%	0.869	72%	0.718	S	S	*	*			trans	-61.2	97.3	179	-65.9	178.4	132.5	0	0	108.3	M23 K27	M23-E25 PolarHBondContact O-N 2.8Å; M23-E25 VanDerWaalsContact O-N 3.08Å; E25-K27 PolarHBondContact O-N 3.16Å; E25-K27 VanDerWaalsContact O-N 3.16Å
26	K	75.3	Confident	67.3	Low	171 Å²	171	132 Å²	132	74%	0.743	71%	0.714	S	S	*	*			trans	-68.5	113.3	167.2	63.6	-174.9	178.3	73.8	0	106.6	S24 C28	S24-K26 VanDerWaalsContact C-N 3.33Å; S24-K26 PolarHBondContact O-N 3.08Å; K26-C28 PolarHBondContact NZ-SG 3.5Å; K26-C28 PolarHBondContact O-N 3.04Å
27	K	75.4	Confident	67	Low	193 Å²	193	135.3 Å²	135.3	84%	0.839	71%	0.713	S	S	*	*			trans	-60.9	104.8	167.6	-80.6	176.4	170.9	-172.7	0	107.3	E25 C29	E25-K27 PolarHBondContact O-N 3.16Å; E25-K27 VanDerWaalsContact O-N 3.16Å; K27-C29 PolarHBondContact O-N 2.94Å
28	C	68.1	Low	66.7	Low	72 Å²	72	132.2 Å²	132.2	49%	0.486	70%	0.704	S	S	.	*			trans	-67.2	103.9	169.9	-68.4	0	0	0	0	107.3	K26 W30	K26-C28 PolarHBondContact NZ-SG 3.5Å; K26-C28 PolarHBondContact O-N 3.04Å; C28-W30 VanDerWaalsContact C-N 3.29Å; C28-W30 VanDerWaalsContact CB-CD1 3.48Å; C28-W30 PolarHBondContact O-N 2.93Å
29	C	70.6	Confident	66.2	Low	117 Å²	117	130.2 Å²	130.2	79%	0.791	69%	0.692	S	S	*	*			trans	-73	82.2	175.8	-62.9	0	0	0	0	109.8	K27 S31	K27-C29 PolarHBondContact O-N 2.94Å; C29-S31 PolarHBondContact O-N 3.16Å; C29-S31 VanDerWaalsContact O-N 3.16Å
30	W	66.5	Low	65.7	Low	231 Å²	231	129 Å²	129	88%	0.875	69%	0.689	S	S	*	*			trans	-75.8	12.9	176.5	-81.3	80.8	0	0	0	114.3	C28	C28-W30 VanDerWaalsContact C-N 3.29Å; C28-W30 VanDerWaalsContact CB-CD1 3.48Å; C28-W30 PolarHBondContact O-N 2.93Å
31	S	60.4	Low	65.4	Low	96 Å²	96	126.5 Å²	126.5	67%	0.671	68%	0.68	S	S	*	*			trans	-125.3	59.5	-175.4	-157.1	0	0	0	0	112.3	C29	C29-S31 PolarHBondContact O-N 3.16Å; C29-S31 VanDerWaalsContact O-N 3.16Å
32	A	60.9	Low	65.2	Low	75 Å²	75	126.5 Å²	126.5	62%	0.62	68%	0.68	S	S	*	*	S	Bend	trans	-108.9	-15.6	163.5	0	0	0	0	0	112.7
33	V	59	Low	64.6	Low	98 Å²	98	121.9 Å²	121.9	59%	0.594	67%	0.672	S	S	*	*	H	α-helix	trans	-97.1	-31.7	-170.6	-172.2	0	0	0	0	112.5
34	T	58.8	Low	64	Low	103 Å²	103	121.5 Å²	121.5	63%	0.632	69%	0.686	S	S	*	*	H	α-helix	trans	-81.4	-30.1	-176.9	52	0	0	0	0	113.6
35	G	57.3	Low	63.4	Low	45 Å²	45	121.8 Å²	121.8	46%	0.464	68%	0.68	S	S	.	*	H	α-helix	trans	-74	-43.5	177.1	0	0	0	0	0	113.1	T39	G35-T39 PolarHBondContact O-N 2.92Å; G35-T39 PolarHBondContact O-OG1 3.25Å
36	S	59.5	Low	62.8	Low	81 Å²	81	118.4 Å²	118.4	57%	0.566	67%	0.67	S	S	*	*	H	α-helix	trans	-77.9	-30.2	-170	-156	0	0	0	0	114.1	A40	S36-A40 PolarHBondContact O-N 3.43Å
37	W	56.3	Low	62.1	Low	185 Å²	185	115.4 Å²	115.4	70%	0.701	67%	0.666	S	S	*	*	H	α-helix	trans	-78.9	-34.2	178.1	-74.2	76.9	0	0	0	112.2	T39 A40 T41	W37-T39 VanDerWaalsContact C-N 3.31Å; W37-T39 PolarHBondContact O-N 3.49Å; W37-A40 PolarHBondContact O-N 3.42Å; W37-T41 PolarHBondContact O-N 3.44Å; W37-T41 VanDerWaalsContact O-N 3.14Å; W37-T41 PolarHBondContact O-OG1 2.8Å
38	L	62.6	Low	61.3	Low	111 Å²	111	110.9 Å²	110.9	58%	0.581	66%	0.656	S	S	*	*	H	α-helix	trans	-63.9	-38.4	177	-177.2	62.4	0	0	0	111.7	L42	L38-L42 HydrophobicContact CD1-CD1 4.29Å; L38-L42 HydrophobicContact CG-CD1 4.2Å; L38-L42 WeakPolarHBondContact O-CG 3.41Å; L38-L42 PolarHBondContact O-N 3.17Å
39	T	59.4	Low	60.9	Low	79 Å²	79	113.3 Å²	113.3	49%	0.485	67%	0.666	S	S	.	*	H	α-helix	trans	-71.2	-31.5	176.7	-10.2	0	0	0	0	112.5	G35 W37 N43	G35-T39 PolarHBondContact O-N 2.92Å; G35-T39 PolarHBondContact O-OG1 3.25Å; W37-T39 VanDerWaalsContact C-N 3.31Å; W37-T39 PolarHBondContact O-N 3.49Å; T39-N43 PolarHBondContact O-N 3.14Å; T39-N43 PolarHBondContact O-ND2 3.26Å
40	A	61.3	Low	60.2	Low	63 Å²	63	113.1 Å²	113.1	52%	0.521	66%	0.658	S	S	.	*	H	α-helix	trans	-69.3	-37.8	177.1	0	0	0	0	0	112	S36 W37	S36-A40 PolarHBondContact O-N 3.43Å; W37-A40 PolarHBondContact O-N 3.42Å
41	T	62.4	Low	59.8	Low	104 Å²	104	104.6 Å²	104.6	64%	0.638	64%	0.642	S	S	*	*	H	α-helix	trans	-73.7	-33.5	178.9	-54.1	0	0	0	0	113.2	W37 N43	W37-T41 PolarHBondContact O-N 3.44Å; W37-T41 VanDerWaalsContact O-N 3.14Å; W37-T41 PolarHBondContact O-OG1 2.8Å; T41-N43 VanDerWaalsContact C-N 3.33Å
42	L	65.1	Low	59.8	Low	132 Å²	132	105.3 Å²	105.3	69%	0.691	64%	0.64	S	S	*	*	H	α-helix	trans	-77.7	-17.6	179.6	-71.6	170	0	0	0	113.8	L38	L38-L42 HydrophobicContact CD1-CD1 4.29Å; L38-L42 HydrophobicContact CG-CD1 4.2Å; L38-L42 WeakPolarHBondContact O-CG 3.41Å; L38-L42 PolarHBondContact O-N 3.17Å
43	N	60.9	Low	59.7	Low	134 Å²	134	107.8 Å²	107.8	72%	0.717	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.3	11	179.2	-70.4	-41.7	0	0	0	113.1	T39 T41	T39-N43 PolarHBondContact O-N 3.14Å; T39-N43 PolarHBondContact O-ND2 3.26Å; T41-N43 VanDerWaalsContact C-N 3.33Å
44	S	53.3	Low	59.7	Low	159 Å²	159	108.7 Å²	108.7	100%	1.112	65%	0.646	S	S	*	*			trans	-105.4	0	176	-175.4	0	0	0	0	112.7

Retrieved 44 of 44 residues in 10.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).