A0A087X282_HUMAN Loading...

Tax1 binding protein 3

AlphaFold DB (Q4QQV1), UniProt , Accession A0A087X282, Species HUMAN (Homo sapiens, Human), Gene TAX1BP3, Length 98 aa.

						>A0A087X282_HUMAN|A0A087X282|TAX1BP3
MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.7	Very low	69.5	Low	228 Å²	228	118.5 Å²	118.5	100%	1.123	70%	0.697	S	S	*	*				0	120.7	0	-66.2	-176.5	-161.6	0	0	107.4
2	S	56.5	Low	70.8	Confident	111 Å²	111	111.9 Å²	111.9	78%	0.776	66%	0.659	S	S	*	*			trans	-79.6	120.9	173.4	43.4	0	0	0	0	109.1	I4	S2-I4 PolarHBondContact O-N 3.26Å
3	Y	64.6	Low	72.3	Confident	171 Å²	171	108.9 Å²	108.9	67%	0.671	64%	0.642	S	S	*	*			trans	-63.9	125.5	173.5	170.5	-101.1	0	0	0	109.6	P5 V9	Y3-P5 HydrophobicContact CD1-CG 4.27Å; Y3-P5 HydrophobicContact CE1-CB 4.23Å; Y3-P5 HydrophobicContact CE1-CG 3.94Å; Y3-V9 HydrophobicContact CE2-CG2 4.31Å
4	I	77	Confident	73.7	Confident	95 Å²	95	106.2 Å²	106.2	49%	0.487	62%	0.62	S	S	.	*			trans	-102.6	113.3	173.1	-57.3	-179.2	0	0	0	107.4	S2 G6 Q7	S2-I4 PolarHBondContact O-N 3.26Å; I4-G6 PolarHBondContact O-N 2.81Å; I4-Q7 HydrophobicContact CB-CB 4.28Å; I4-Q7 PolarHBondContact O-N 2.72Å; I4-Q7 VanDerWaalsContact O-N 3.17Å
5	P	76.7	Confident	75.1	Confident	102 Å²	102	110.9 Å²	110.9	66%	0.662	62%	0.623	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.7	134.2	176.8	-25.3	33.6	0	0	0	111.8	Y3 Q7	Y3-P5 HydrophobicContact CD1-CG 4.27Å; Y3-P5 HydrophobicContact CE1-CB 4.23Å; Y3-P5 HydrophobicContact CE1-CG 3.94Å; P5-Q7 VanDerWaalsContact C-N 3.31Å; P5-Q7 PolarHBondContact O-N 3.09Å
6	G	78.5	Confident	76.3	Confident	81 Å²	81	106.6 Å²	106.6	84%	0.835	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	86.6	-11.5	179.5	0	0	0	0	0	115.1	I4	I4-G6 PolarHBondContact O-N 2.81Å
7	Q	72.7	Confident	77.5	Confident	121 Å²	121	105.7 Å²	105.7	57%	0.565	59%	0.59	S	S	*	*	S	Bend	trans	-80.6	129.4	173.5	-158.7	171.2	0.3	0	0	110	I4 P5 V9	I4-Q7 HydrophobicContact CB-CB 4.28Å; I4-Q7 PolarHBondContact O-N 2.72Å; I4-Q7 VanDerWaalsContact O-N 3.17Å; P5-Q7 VanDerWaalsContact C-N 3.31Å; P5-Q7 PolarHBondContact O-N 3.09Å; Q7-V9 PolarHBondContact O-N 3.02Å
8	P	68.8	Low	78.6	Confident	109 Å²	109	101.7 Å²	101.7	71%	0.708	57%	0.567	S	S	*	*			trans	-62.1	123.1	-179.1	21.2	-30.4	0	0	0	110.8	T10	P8-T10 PolarHBondContact O-N 2.76Å
9	V	67.4	Low	79.6	Confident	121 Å²	121	103.6 Å²	103.6	73%	0.733	57%	0.571	S	S	*	*			trans	-77.8	114.1	172.7	-178	0	0	0	0	107.6	Y3 Q7	Y3-V9 HydrophobicContact CE2-CG2 4.31Å; Q7-V9 PolarHBondContact O-N 3.02Å
10	T	73.1	Confident	80.5	Confident	119 Å²	119	99.4 Å²	99.4	73%	0.73	55%	0.546	S	S	*	.			trans	-98.8	115.8	175.9	-41.9	0	0	0	0	108.2	P8	P8-T10 PolarHBondContact O-N 2.76Å
11	A	79.8	Confident	81.3	Confident	45 Å²	45	100.2 Å²	100.2	37%	0.372	55%	0.549	S	S	.	.			trans	-113.3	140.2	176.2	0	0	0	0	0	109.9	V13 T84	A11-V13 PolarHBondContact O-N 2.71Å; A11-T84 HydrophobicContact CB-CG2 4.02Å
12	V	85.4	Confident	83.5	Confident	40 Å²	40	96.4 Å²	96.4	24%	0.242	52%	0.522	C	S	.	.			trans	-82	117.3	171	-179.8	0	0	0	0	107.6	L88 V92	V12-L88 HydrophobicContact CB-CB 4.4Å; V12-L88 HydrophobicContact CG1-CB 3.86Å; V12-V92 HydrophobicContact CB-CG2 4.41Å; V12-V92 HydrophobicContact CG1-CG2 3.81Å; V12-V92 HydrophobicContact CG2-CB 3.85Å; V12-V92 HydrophobicContact CG2-CG1 4.14Å; V12-V92 HydrophobicContact CG2-CG2 3.74Å
13	V	89.3	Confident	85.3	Confident	73 Å²	73	97 Å²	97	44%	0.442	51%	0.513	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.4	139.6	179.9	-65.2	0	0	0	0	110.9	A11 L82 V83	A11-V13 PolarHBondContact O-N 2.71Å; V13-L82 HydrophobicContact CB-CD2 4.06Å; V13-L82 HydrophobicContact CG2-CD2 3.82Å; V13-V83 CarbonylContact C-O 3.47Å; V13-V83 WeakPolarHBondContact CA-O 3.45Å
14	Q	92.1	Very high	86.8	Confident	71 Å²	71	92.1 Å²	92.1	33%	0.332	51%	0.514	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.4	132.1	168.4	-170.9	173.9	14.3	0	0	109.3	V16 L82 V83 L88	Q14-V16 HydrophobicContact CG-CG2 3.93Å; Q14-L82 WeakPolarHBondContact O-CA 3.42Å; Q14-V83 HydrophobicContact CB-CG2 3.88Å; Q14-V83 PolarHBondContact N-O 3.11Å; Q14-V83 PolarHBondContact O-N 3.19Å; Q14-L88 HydrophobicContact CB-CD1 3.57Å; Q14-L88 HydrophobicContact CG-CD1 4.29Å
15	R	94.5	Very high	87.5	Confident	177 Å²	177	95.3 Å²	95.3	67%	0.668	53%	0.527	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.2	120.9	166.9	-170.6	174.9	176.7	171.5	-3.3	108.8	L81 L82	R15-L81 CarbonylContact C-O 3.55Å; R15-L81 WeakPolarHBondContact CA-O 3.42Å; R15-L82 HydrophobicContact CB-CD2 4.33Å
16	V	94.9	Very high	88.3	Confident	42 Å²	42	94.4 Å²	94.4	26%	0.255	52%	0.517	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	130.6	178.2	-174.8	0	0	0	0	108.6	Q14 I18 R80 L81 V83	Q14-V16 HydrophobicContact CG-CG2 3.93Å; V16-I18 HydrophobicContact CG1-CD1 4.31Å; V16-I18 HydrophobicContact CG1-CG1 3.95Å; V16-R80 CarbonylContact O-C 3.59Å; V16-R80 WeakPolarHBondContact O-CA 3.4Å; V16-L81 HydrophobicContact CB-CB 4.34Å; V16-L81 PolarHBondContact N-O 3.03Å; V16-L81 PolarHBondContact O-N 3.03Å; V16-V83 HydrophobicContact CG2-CG2 4.05Å
17	E	97.4	Very high	89.1	Confident	91 Å²	91	91.6 Å²	91.6	43%	0.425	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.1	124	175.7	-174.8	157.8	153.9	0	0	109.4	H19 V78 R80	E17-H19 IonicContact OE1-NE2 3.92Å; E17-V78 HydrophobicContact CG-CG1 3.57Å; E17-R80 HydrophobicContact CB-CG 4.45Å; E17-R80 VanDerWaalsContact CD-NH2 3.32Å; E17-R80 HydrophobicContact CG-CG 4.1Å; E17-R80 IonicContact OE1-CZ 3.59Å; E17-R80 IonicContact OE1-NE 3.71Å; E17-R80 IonicContact OE1-NH2 2.81Å; E17-R80 PolarHBondContact OE1-NH2 3.3Å; E17-R80 IonicContact OE2-CZ 3.39Å; E17-R80 IonicContact OE2-NE 2.72Å; E17-R80 PolarHBondContact OE2-NE 3.35Å; E17-R80 IonicContact OE2-NH2 3.26Å; E17-R80 PolarHBondContact OE2-NH2 3Å
18	I	96.6	Very high	90.3	Very high	34 Å²	34	88.6 Å²	88.6	17%	0.174	47%	0.469	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.9	118.9	-175.7	-54.9	175.4	0	0	0	108.3	V16 L29 F31 V78 V79 L81	V16-I18 HydrophobicContact CG1-CD1 4.31Å; V16-I18 HydrophobicContact CG1-CG1 3.95Å; I18-L29 HydrophobicContact CB-CD2 4.33Å; I18-L29 HydrophobicContact CG2-CD2 3.88Å; I18-F31 HydrophobicContact CD1-CD1 4.02Å; I18-F31 HydrophobicContact CD1-CE1 3.51Å; I18-F31 HydrophobicContact CD1-CZ 4.44Å; I18-V78 WeakPolarHBondContact O-CA 3.14Å; I18-V79 PolarHBondContact N-O 3.48Å; I18-V79 PolarHBondContact O-N 3.4Å; I18-L81 HydrophobicContact CD1-CD1 3.74Å; I18-L81 HydrophobicContact CD1-CG 4.44Å
19	H	97.6	Very high	91.6	Very high	138 Å²	138	84.9 Å²	84.9	64%	0.639	44%	0.444	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.5	119.1	166.2	-69.9	-107.6	0	0	0	108.3	E17	E17-H19 IonicContact OE1-NE2 3.92Å
20	K	97.4	Very high	92.9	Very high	19 Å²	19	82.9 Å²	82.9	8%	0.083	45%	0.447	C	S	.	.	P	Polyproline II helix	trans	-65.1	138.9	179.6	-68.1	-179.1	-173.7	169.3	0	110.3	L27 I28 L29 L71 K73 E76 E77 V79	K20-L27 HydrophobicContact CB-CB 3.88Å; K20-L27 HydrophobicContact CB-CD2 4.23Å; K20-L27 HydrophobicContact CD-CB 3.62Å; K20-L27 HydrophobicContact CD-CD1 4.38Å; K20-L27 HydrophobicContact CG-CB 4.37Å; K20-I28 CarbonylContact C-O 3.45Å; K20-I28 VanDerWaalsContact CA-O 3.29Å; K20-I28 WeakPolarHBondContact CA-O 3.33Å; K20-I28 WeakPolarHBondContact CB-O 3.42Å; K20-L29 HydrophobicContact CD-CD2 4.32Å; K20-L29 HydrophobicContact CG-CD2 3.66Å; K20-L29 HydrophobicContact CG-CG 4.17Å; K20-L71 WeakPolarHBondContact CE-O 3.36Å; K20-L71 PolarHBondContact NZ-O 2.68Å; K20-K73 PolarHBondContact NZ-O 2.91Å; K20-E76 WeakPolarHBondContact CD-O 3.34Å; K20-E76 WeakPolarHBondContact CE-O 3.47Å; K20-E76 PolarHBondContact NZ-O 3.12Å; K20-E77 WeakPolarHBondContact CB-O 3.48Å; K20-E77 WeakPolarHBondContact CG-O 3.35Å; K20-E77 PolarHBondContact N-O 3.18Å; K20-V79 VanDerWaalsContact CE-CG2 3.44Å
21	L	97.2	Very high	93.9	Very high	117 Å²	117	81 Å²	81	61%	0.613	43%	0.429	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.5	133.8	172.6	-178.8	64.4	0	0	0	109.5	L27 I28	L21-L27 WeakPolarHBondContact O-CA 3.29Å; L21-I28 HydrophobicContact CB-CG1 3.9Å; L21-I28 HydrophobicContact CD2-CD1 4.3Å; L21-I28 HydrophobicContact CG-CG1 4.49Å; L21-I28 PolarHBondContact N-O 3.34Å; L21-I28 WeakPolarHBondContact O-CG1 3.36Å; L21-I28 PolarHBondContact O-N 2.82Å
22	R	96.3	Very high	94.5	Very high	147 Å²	147	83.7 Å²	83.7	56%	0.555	45%	0.445	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.6	124	173.4	-173.9	166	-69.7	-85.2	1.3	110.1	L27 E77	R22-L27 HydrophobicContact CB-CD2 4.2Å; R22-E77 IonicContact NH2-OE1 3.64Å; R22-E77 PolarHBondContact NH2-OE1 3.29Å
23	Q	95	Very high	94.9	Very high	125 Å²	125	84.3 Å²	84.3	58%	0.584	45%	0.446	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-132.2	98.2	175.7	-168.8	-177.1	37.3	0	0	108.9	E25 N26 I28	Q23-E25 PolarHBondContact O-N 3.15Å; Q23-N26 PolarHBondContact N-O 2.85Å; Q23-N26 PolarHBondContact O-N 2.93Å; Q23-I28 HydrophobicContact CB-CD1 4.38Å
24	G	94.2	Very high	95.1	Very high	67 Å²	67	82.5 Å²	82.5	69%	0.691	44%	0.443	S	S	*	.	T	Hydrogen-bonded Turn	trans	59.5	-125.3	-169	0	0	0	0	0	111	N26	G24-N26 VanDerWaalsContact C-N 3.31Å
25	E	93.2	Very high	95.1	Very high	162 Å²	162	80.2 Å²	80.2	76%	0.757	44%	0.438	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.8	-6.5	176.6	-59.8	-170	167.9	0	0	113.9	Q23	Q23-E25 PolarHBondContact O-N 3.15Å
26	N	93.6	Very high	95.1	Very high	83 Å²	83	73.3 Å²	73.3	44%	0.444	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.2	150.9	-175.1	-67.1	-40.2	0	0	0	112.3	Q23 G24 I28	Q23-N26 PolarHBondContact N-O 2.85Å; Q23-N26 PolarHBondContact O-N 2.93Å; G24-N26 VanDerWaalsContact C-N 3.31Å; N26-I28 HydrophobicContact CB-CG2 4.43Å
27	L	95.6	Very high	95.1	Very high	23 Å²	23	76.1 Å²	76.1	12%	0.12	43%	0.434	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.1	116	167.5	-70.1	173.5	0	0	0	108.1	K20 L21 R22 R74 E77	K20-L27 HydrophobicContact CB-CB 3.88Å; K20-L27 HydrophobicContact CB-CD2 4.23Å; K20-L27 HydrophobicContact CD-CB 3.62Å; K20-L27 HydrophobicContact CD-CD1 4.38Å; K20-L27 HydrophobicContact CG-CB 4.37Å; L21-L27 WeakPolarHBondContact O-CA 3.29Å; R22-L27 HydrophobicContact CB-CD2 4.2Å; L27-R74 WeakPolarHBondContact CD1-O 3.38Å; L27-E77 HydrophobicContact CD1-CG 3.94Å
28	I	96	Very high	95.1	Very high	57 Å²	57	75.6 Å²	75.6	29%	0.292	44%	0.435	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	148.4	-175.4	66.9	170.4	0	0	0	111.2	K20 L21 Q23 N26	K20-I28 CarbonylContact C-O 3.45Å; K20-I28 VanDerWaalsContact CA-O 3.29Å; K20-I28 WeakPolarHBondContact CA-O 3.33Å; K20-I28 WeakPolarHBondContact CB-O 3.42Å; L21-I28 HydrophobicContact CB-CG1 3.9Å; L21-I28 HydrophobicContact CD2-CD1 4.3Å; L21-I28 HydrophobicContact CG-CG1 4.49Å; L21-I28 PolarHBondContact N-O 3.34Å; L21-I28 WeakPolarHBondContact O-CG1 3.36Å; L21-I28 PolarHBondContact O-N 2.82Å; Q23-I28 HydrophobicContact CB-CD1 4.38Å; N26-I28 HydrophobicContact CB-CG2 4.43Å
29	L	96.4	Very high	95	Very high	32 Å²	32	78.3 Å²	78.3	17%	0.168	45%	0.447	C	S	.	.			trans	-95	-22.4	-180	-72.8	164.1	0	0	0	113.6	I18 K20 F31 L71 V79	I18-L29 HydrophobicContact CB-CD2 4.33Å; I18-L29 HydrophobicContact CG2-CD2 3.88Å; K20-L29 HydrophobicContact CD-CD2 4.32Å; K20-L29 HydrophobicContact CG-CD2 3.66Å; K20-L29 HydrophobicContact CG-CG 4.17Å; L29-F31 HydrophobicContact CB-CD1 3.63Å; L29-F31 HydrophobicContact CB-CE1 3.47Å; L29-F31 VanDerWaalsContact CB-CE1 3.47Å; L29-F31 HydrophobicContact CB-CZ 4.27Å; L29-F31 HydrophobicContact CD1-CE1 3.79Å; L29-F31 HydrophobicContact CD1-CZ 3.81Å; L29-F31 HydrophobicContact CD2-CE1 4.02Å; L29-F31 HydrophobicContact CG-CE1 3.96Å; L29-F31 HydrophobicContact CG-CZ 4.49Å; L29-L71 HydrophobicContact CD1-CB 3.78Å; L29-L71 HydrophobicContact CD1-CD2 4.05Å; L29-L71 HydrophobicContact CD1-CG 4.44Å; L29-V79 HydrophobicContact CD2-CB 3.93Å; L29-V79 HydrophobicContact CD2-CG1 4.45Å; L29-V79 HydrophobicContact CD2-CG2 3.94Å
30	G	94.7	Very high	94.8	Very high	78 Å²	78	76 Å²	76	80%	0.804	44%	0.439	S	S	*	.	S	Bend	trans	77.4	15.3	-178.2	0	0	0	0	0	115.1
31	F	94.2	Very high	94.5	Very high	80 Å²	80	80.2 Å²	80.2	35%	0.351	47%	0.469	S	S	.	.			trans	-138.6	163.9	173.2	70.2	-94.2	0	0	0	111.8	I18 L29 I33 L71 L81	I18-F31 HydrophobicContact CD1-CD1 4.02Å; I18-F31 HydrophobicContact CD1-CE1 3.51Å; I18-F31 HydrophobicContact CD1-CZ 4.44Å; L29-F31 HydrophobicContact CB-CD1 3.63Å; L29-F31 HydrophobicContact CB-CE1 3.47Å; L29-F31 VanDerWaalsContact CB-CE1 3.47Å; L29-F31 HydrophobicContact CB-CZ 4.27Å; L29-F31 HydrophobicContact CD1-CE1 3.79Å; L29-F31 HydrophobicContact CD1-CZ 3.81Å; L29-F31 HydrophobicContact CD2-CE1 4.02Å; L29-F31 HydrophobicContact CG-CE1 3.96Å; L29-F31 HydrophobicContact CG-CZ 4.49Å; F31-I33 HydrophobicContact CD2-CG2 4.07Å; F31-I33 HydrophobicContact CE2-CG2 3.6Å; F31-L71 HydrophobicContact CE2-CD1 4.41Å; F31-L71 HydrophobicContact CZ-CD1 4.49Å; F31-L71 HydrophobicContact CZ-CD2 4.04Å; F31-L81 HydrophobicContact CE1-CD1 4.36Å; F31-L81 HydrophobicContact CZ-CD1 4.06Å
32	S	93.3	Very high	94.2	Very high	101 Å²	101	78.7 Å²	78.7	71%	0.706	47%	0.468	S	S	*	.			trans	-110.2	154.7	176.8	-61.9	0	0	0	0	111
33	I	93.2	Very high	93.9	Very high	53 Å²	53	78.8 Å²	78.8	27%	0.272	47%	0.474	S	S	.	.			trans	-118.2	149.8	176.3	61.1	173	0	0	0	110.7	F31 A67 R68 L71	F31-I33 HydrophobicContact CD2-CG2 4.07Å; F31-I33 HydrophobicContact CE2-CG2 3.6Å; I33-A67 HydrophobicContact CD1-CB 4.01Å; I33-R68 HydrophobicContact CD1-CB 4.33Å; I33-L71 HydrophobicContact CD1-CD1 3.95Å; I33-L71 HydrophobicContact CG2-CD1 3.7Å
34	G	93.3	Very high	93.6	Very high	36 Å²	36	74.8 Å²	74.8	37%	0.371	46%	0.457	S	S	.	.			trans	-127.4	162.8	169.5	0	0	0	0	0	110.8
35	G	93.3	Very high	93.1	Very high	23 Å²	23	76.5 Å²	76.5	24%	0.237	46%	0.456	C	S	.	.			trans	88.5	-165.6	179.4	0	0	0	0	0	114.5	Q39 H64	G35-Q39 WeakPolarHBondContact O-CG 3.39Å; G35-H64 WeakPolarHBondContact O-CB 3.47Å; G35-H64 PolarHBondContact O-ND1 2.89Å
36	G	94.3	Very high	92.6	Very high	31 Å²	31	74.7 Å²	74.7	32%	0.32	45%	0.446	S	S	.	.			trans	122.9	147	-166.4	0	0	0	0	0	110.1	D38 Q39 V62	G36-D38 PolarHBondContact O-N 2.89Å; G36-D38 VanDerWaalsContact O-N 3.14Å; G36-Q39 PolarHBondContact O-N 2.82Å; G36-Q39 VanDerWaalsContact O-N 3.1Å; G36-V62 CarbonylContact C-O 3.54Å; G36-V62 WeakPolarHBondContact CA-O 3.36Å
37	I	94.5	Very high	91.6	Very high	101 Å²	101	74.3 Å²	74.3	52%	0.518	45%	0.45	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.9	-16.3	-177.9	66.4	176.4	0	0	0	113.4	M61 V62 T63	I37-M61 HydrophobicContact CG2-CE 4.4Å; I37-M61 HydrophobicContact CG2-SD 4.22Å; I37-V62 PolarHBondContact N-O 3.03Å; I37-T63 HydrophobicContact CD1-CG2 4.46Å; I37-T63 HydrophobicContact CG1-CG2 4.14Å
38	D	96.6	Very high	90.6	Very high	81 Å²	81	79.8 Å²	79.8	43%	0.433	48%	0.475	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97.7	3.2	179.9	64.7	-43.6	0	0	0	113.1	G36 T63 H64	G36-D38 PolarHBondContact O-N 2.89Å; G36-D38 VanDerWaalsContact O-N 3.14Å; D38-T63 HydrophobicContact CB-CG2 4.13Å; D38-T63 WeakPolarHBondContact OD1-CA 3.39Å; D38-T63 WeakPolarHBondContact OD1-CB 3.38Å; D38-H64 PolarHBondContact OD1-N 2.83Å
39	Q	95.1	Very high	89.8	Confident	90 Å²	90	80.2 Å²	80.2	42%	0.421	48%	0.477	S	S	.	.	S	Bend	trans	-110	155.3	-178.8	-56.7	-60.7	-56.7	0	0	110.7	G35 G36 P41 H64	G35-Q39 WeakPolarHBondContact O-CG 3.39Å; G36-Q39 PolarHBondContact O-N 2.82Å; G36-Q39 VanDerWaalsContact O-N 3.1Å; Q39-P41 VanDerWaalsContact O-CD 3.27Å; Q39-P41 WeakPolarHBondContact O-CD 3.16Å; Q39-H64 HydrophobicContact CG-CB 3.81Å
40	D	93.3	Very high	89.2	Confident	89 Å²	89	85 Å²	85	48%	0.476	50%	0.497	S	S	.	.			trans	-71.8	117.8	169.6	179.7	-2	0	0	0	109.8	S42 Q43	D40-S42 PolarHBondContact O-N 2.8Å; D40-S42 VanDerWaalsContact O-N 3.16Å; D40-S42 VanDerWaalsContact OD1-CB 3.29Å; D40-S42 WeakPolarHBondContact OD1-CB 3.48Å; D40-S42 PolarHBondContact OD1-N 2.88Å; D40-S42 PolarHBondContact OD1-OG 3.04Å; D40-S42 VanDerWaalsContact OD1-OG 3.07Å; D40-S42 PolarHBondContact OD2-OG 3.33Å; D40-Q43 HydrophobicContact CB-CG 3.95Å; D40-Q43 PolarHBondContact O-N 2.74Å
41	P	91.2	Very high	88.7	Confident	109 Å²	109	83.7 Å²	83.7	71%	0.708	47%	0.474	S	S	*	.	G	3₁₀ helix	trans	-58.7	-26.6	178	-23.1	34.5	0	0	0	113.7	Q39 Q43 N44	Q39-P41 VanDerWaalsContact O-CD 3.27Å; Q39-P41 WeakPolarHBondContact O-CD 3.16Å; P41-Q43 PolarHBondContact O-N 2.87Å; P41-N44 PolarHBondContact O-N 3.26Å
42	S	90.9	Very high	88.3	Confident	85 Å²	85	81.9 Å²	81.9	59%	0.594	47%	0.467	S	S	*	.	G	3₁₀ helix	trans	-65.2	-21.5	178.4	85	0	0	0	0	112.9	D40	D40-S42 PolarHBondContact O-N 2.8Å; D40-S42 VanDerWaalsContact O-N 3.16Å; D40-S42 VanDerWaalsContact OD1-CB 3.29Å; D40-S42 WeakPolarHBondContact OD1-CB 3.48Å; D40-S42 PolarHBondContact OD1-N 2.88Å; D40-S42 PolarHBondContact OD1-OG 3.04Å; D40-S42 VanDerWaalsContact OD1-OG 3.07Å; D40-S42 PolarHBondContact OD2-OG 3.33Å
43	Q	90.1	Very high	88.1	Confident	148 Å²	148	81.2 Å²	81.2	69%	0.692	45%	0.452	S	S	*	.	G	3₁₀ helix	trans	-90.7	-1.4	-179.1	-58.7	-60.6	-63.7	0	0	113.1	D40 P41 P45	D40-Q43 HydrophobicContact CB-CG 3.95Å; D40-Q43 PolarHBondContact O-N 2.74Å; P41-Q43 PolarHBondContact O-N 2.87Å; Q43-P45 WeakPolarHBondContact O-CD 3.45Å
44	N	89.3	Confident	88.2	Confident	42 Å²	42	78.7 Å²	78.7	23%	0.225	44%	0.439	C	S	.	.			trans	-87.4	108.2	-179.6	-176.3	8.1	0	0	0	111.5	P41 F46	P41-N44 PolarHBondContact O-N 3.26Å; N44-F46 PolarHBondContact O-N 2.94Å; N44-F46 PolarHBondContact OD1-N 3.34Å
45	P	84.1	Confident	88.2	Confident	103 Å²	103	78.9 Å²	78.9	67%	0.669	43%	0.432	S	S	*	.	S	Bend	trans	-74.8	-9.9	178.3	32.6	-35.9	0	0	0	113.3	Q43	Q43-P45 WeakPolarHBondContact O-CD 3.45Å
46	F	81.1	Confident	88.2	Confident	123 Å²	123	80.8 Å²	80.8	54%	0.539	45%	0.451	S	S	.	.			trans	-114.3	53.8	-174.3	-53	-66.4	0	0	0	111.9	N44	N44-F46 PolarHBondContact O-N 2.94Å; N44-F46 PolarHBondContact OD1-N 3.34Å
47	S	73.1	Confident	88.1	Confident	76 Å²	76	87.4 Å²	87.4	53%	0.531	47%	0.467	S	S	.	.			trans	-82.3	-14.7	-173.9	60.8	0	0	0	0	114.9
48	E	74.8	Confident	88.1	Confident	137 Å²	137	86.3 Å²	86.3	64%	0.64	46%	0.462	S	S	*	.	S	Bend	trans	-82.3	-33.4	-175.5	-61.9	-170.3	172.2	0	0	113.9
49	D	78.6	Confident	87.9	Confident	66 Å²	66	83.7 Å²	83.7	35%	0.353	45%	0.447	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.7	120.8	176.4	-81.5	-3.2	0	0	0	108.8	T84 R85	D49-T84 WeakPolarHBondContact CA-O 3.45Å; D49-R85 WeakPolarHBondContact OD1-CA 3.41Å; D49-R85 VanDerWaalsContact OD1-CB 3.3Å; D49-R85 WeakPolarHBondContact OD1-CB 3.3Å; D49-R85 WeakPolarHBondContact OD1-CG 3.48Å; D49-R85 IonicContact OD1-NE 3.82Å; D49-R85 IonicContact OD2-CZ 3.19Å; D49-R85 VanDerWaalsContact OD2-CZ 3.27Å; D49-R85 IonicContact OD2-NE 3.03Å; D49-R85 PolarHBondContact OD2-NE 3.35Å; D49-R85 IonicContact OD2-NH2 2.85Å; D49-R85 PolarHBondContact OD2-NH2 3.19Å
50	K	84.2	Confident	87.7	Confident	133 Å²	133	83.3 Å²	83.3	58%	0.578	45%	0.451	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-116.5	133.4	-178.4	-67.8	-176.4	-179.3	178.1	0	110.6	V83 T84	K50-V83 CarbonylContact O-C 3.59Å; K50-V83 WeakPolarHBondContact O-CA 3.44Å; K50-T84 PolarHBondContact N-O 2.96Å; K50-T84 PolarHBondContact O-N 3.38Å
51	T	83.4	Confident	87.7	Confident	51 Å²	51	85.8 Å²	85.8	31%	0.313	46%	0.462	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.2	117.6	170.8	-59.2	0	0	0	0	109	V54 M59 L81 V83	T51-V54 HydrophobicContact CG2-CG2 3.86Å; T51-M59 HydrophobicContact CG2-CG 4.22Å; T51-M59 WeakPolarHBondContact O-CB 3.46Å; T51-L81 HydrophobicContact CG2-CD2 4.23Å; T51-V83 HydrophobicContact CG2-CG1 4.39Å
52	D	85.9	Confident	87.8	Confident	41 Å²	41	81.7 Å²	81.7	22%	0.219	44%	0.435	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.1	-39.1	-179	-56.6	-60.4	0	0	0	111.1	M59 L82 T84	D52-M59 PolarHBondContact O-N 2.88Å; D52-L82 PolarHBondContact N-O 3.27Å; D52-T84 PolarHBondContact OD2-N 2.82Å; D52-T84 PolarHBondContact OD2-OG1 2.85Å
53	K	90.9	Very high	88.1	Confident	88 Å²	88	79.4 Å²	79.4	38%	0.383	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142	147.8	178.6	-54.5	-172.9	179.1	-177.7	0	113.9	W57 L81 L82	K53-W57 CarbonylContact C-O 3.53Å; K53-W57 WeakPolarHBondContact CA-O 3.46Å; K53-W57 WeakPolarHBondContact CB-O 3.35Å; K53-L81 WeakPolarHBondContact O-CA 3.15Å; K53-L82 HydrophobicContact CB-CB 4.14Å; K53-L82 HydrophobicContact CB-CD1 4.18Å; K53-L82 HydrophobicContact CD-CD1 4Å; K53-L82 HydrophobicContact CG-CD1 4.31Å; K53-L82 PolarHBondContact N-O 3.22Å; K53-L82 PolarHBondContact O-N 3.37Å
54	V	93.8	Very high	88.4	Confident	0 Å²	0	75.1 Å²	75.1	0%	0	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.5	112.2	172.8	173.8	0	0	0	0	109.2	T51 G56 W57 M59 R70 L71 V79 L81	T51-V54 HydrophobicContact CG2-CG2 3.86Å; V54-G56 PolarHBondContact O-N 2.86Å; V54-W57 PolarHBondContact N-O 2.92Å; V54-W57 WeakPolarHBondContact O-CB 3.33Å; V54-W57 PolarHBondContact O-N 2.89Å; V54-M59 HydrophobicContact CB-CG 4.1Å; V54-M59 HydrophobicContact CB-SD 3.89Å; V54-M59 HydrophobicContact CG2-CE 3.86Å; V54-M59 HydrophobicContact CG2-CG 3.6Å; V54-M59 HydrophobicContact CG2-SD 3.58Å; V54-M59 VanDerWaalsContact CG2-SD 3.58Å; V54-R70 HydrophobicContact CB-CG 4.07Å; V54-R70 HydrophobicContact CG1-CG 3.76Å; V54-L71 HydrophobicContact CB-CD2 4.49Å; V54-L71 HydrophobicContact CG1-CD2 3.82Å; V54-L71 HydrophobicContact CG1-CG 4.36Å; V54-L71 HydrophobicContact CG2-CD2 3.73Å; V54-L71 HydrophobicContact CG2-CG 4.24Å; V54-V79 HydrophobicContact CG1-CG1 4.06Å; V54-L81 HydrophobicContact CB-CD2 4.39Å; V54-L81 HydrophobicContact CG1-CD2 4.41Å; V54-L81 HydrophobicContact CG2-CD2 3.62Å
55	N	93.4	Very high	88.8	Confident	40 Å²	40	75.8 Å²	75.8	21%	0.214	40%	0.401	C	S	.	.	T	Hydrogen-bonded Turn	trans	48.3	46.4	-178	-77.1	-17.3	0	0	0	111.7	W57 R70 E76 V78 R80	N55-W57 PolarHBondContact O-N 2.79Å; N55-R70 PolarHBondContact O-NH2 2.72Å; N55-E76 PolarHBondContact ND2-OE2 2.93Å; N55-V78 PolarHBondContact ND2-O 3Å; N55-V78 VanDerWaalsContact ND2-O 3.09Å; N55-R80 PolarHBondContact N-O 3.01Å; N55-R80 WeakPolarHBondContact OD1-CB 3.13Å; N55-R80 PolarHBondContact OD1-N 3.46Å
56	G	93.6	Very high	89.4	Confident	63 Å²	63	75.8 Å²	75.8	65%	0.649	39%	0.391	S	S	*	.	T	Hydrogen-bonded Turn	trans	79.6	-11.9	-179.4	0	0	0	0	0	115.8	V54	V54-G56 PolarHBondContact O-N 2.86Å
57	W	93	Very high	90.2	Very high	170 Å²	170	70.3 Å²	70.3	64%	0.644	37%	0.369	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77.9	134.3	175.6	-85.1	63.6	0	0	0	111.3	K53 V54 N55 R70	K53-W57 CarbonylContact C-O 3.53Å; K53-W57 WeakPolarHBondContact CA-O 3.46Å; K53-W57 WeakPolarHBondContact CB-O 3.35Å; V54-W57 PolarHBondContact N-O 2.92Å; V54-W57 WeakPolarHBondContact O-CB 3.33Å; V54-W57 PolarHBondContact O-N 2.89Å; N55-W57 PolarHBondContact O-N 2.79Å; W57-R70 HydrophobicContact CB-CG 4.36Å
58	D	93.8	Very high	91.3	Very high	77 Å²	77	71.9 Å²	71.9	41%	0.412	36%	0.363	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.3	132.8	175.1	-162.2	-62.2	0	0	0	110.9	T60 V62	D58-T60 VanDerWaalsContact OD1-CB 3.3Å; D58-T60 WeakPolarHBondContact OD1-CB 3.33Å; D58-T60 WeakPolarHBondContact OD1-CG2 3.37Å; D58-T60 PolarHBondContact OD1-N 2.93Å; D58-T60 PolarHBondContact OD1-OG1 2.92Å; D58-V62 WeakPolarHBondContact O-CG1 3.09Å
59	M	92.5	Very high	92.4	Very high	27 Å²	27	71.3 Å²	71.3	13%	0.133	36%	0.359	C	S	.	.			trans	-112.4	2.2	-177.6	-62.2	-68.8	-65	0	0	112.9	T51 D52 V54 V62 A67	T51-M59 HydrophobicContact CG2-CG 4.22Å; T51-M59 WeakPolarHBondContact O-CB 3.46Å; D52-M59 PolarHBondContact O-N 2.88Å; V54-M59 HydrophobicContact CB-CG 4.1Å; V54-M59 HydrophobicContact CB-SD 3.89Å; V54-M59 HydrophobicContact CG2-CE 3.86Å; V54-M59 HydrophobicContact CG2-CG 3.6Å; V54-M59 HydrophobicContact CG2-SD 3.58Å; V54-M59 VanDerWaalsContact CG2-SD 3.58Å; M59-V62 HydrophobicContact CE-CG2 4.22Å; M59-V62 WeakPolarHBondContact O-CG2 3.41Å; M59-V62 HydrophobicContact SD-CG2 4.44Å; M59-A67 HydrophobicContact CE-CB 3.29Å
60	T	90.4	Very high	93.2	Very high	82 Å²	82	70 Å²	70	50%	0.503	35%	0.349	S	S	.	.	T	Hydrogen-bonded Turn	trans	-73.6	-30.6	-173.6	63.5	0	0	0	0	112.8	D58	D58-T60 VanDerWaalsContact OD1-CB 3.3Å; D58-T60 WeakPolarHBondContact OD1-CB 3.33Å; D58-T60 WeakPolarHBondContact OD1-CG2 3.37Å; D58-T60 PolarHBondContact OD1-N 2.93Å; D58-T60 PolarHBondContact OD1-OG1 2.92Å
61	M	92.9	Very high	93.8	Very high	141 Å²	141	64 Å²	64	70%	0.695	32%	0.323	S	S	*	.	T	Hydrogen-bonded Turn	trans	-129	53	-174.7	-66.3	-64.4	-66.1	0	0	111.6	I37	I37-M61 HydrophobicContact CG2-CE 4.4Å; I37-M61 HydrophobicContact CG2-SD 4.22Å
62	V	94.9	Very high	94.4	Very high	23 Å²	23	64.7 Å²	64.7	14%	0.139	33%	0.328	C	S	.	.			trans	-122.5	154.7	179.3	-58.2	0	0	0	0	111.7	G36 I37 D58 M59 Q66 A67	G36-V62 CarbonylContact C-O 3.54Å; G36-V62 WeakPolarHBondContact CA-O 3.36Å; I37-V62 PolarHBondContact N-O 3.03Å; D58-V62 WeakPolarHBondContact O-CG1 3.09Å; M59-V62 HydrophobicContact CE-CG2 4.22Å; M59-V62 WeakPolarHBondContact O-CG2 3.41Å; M59-V62 HydrophobicContact SD-CG2 4.44Å; V62-Q66 HydrophobicContact CB-CB 4.03Å; V62-A67 HydrophobicContact CG2-CB 3.97Å
63	T	96.8	Very high	94.9	Very high	37 Å²	37	67.4 Å²	67.4	23%	0.227	34%	0.337	C	S	.	.			trans	-72.6	160.2	168.6	70.6	0	0	0	0	111.1	I37 D38 D65 Q66 A67	I37-T63 HydrophobicContact CD1-CG2 4.46Å; I37-T63 HydrophobicContact CG1-CG2 4.14Å; D38-T63 HydrophobicContact CB-CG2 4.13Å; D38-T63 WeakPolarHBondContact OD1-CA 3.39Å; D38-T63 WeakPolarHBondContact OD1-CB 3.38Å; T63-D65 VanDerWaalsContact C-N 3.27Å; T63-D65 PolarHBondContact O-N 3.31Å; T63-Q66 WeakPolarHBondContact O-CB 3.3Å; T63-Q66 PolarHBondContact O-N 2.6Å; T63-Q66 WeakPolarHBondContact OG1-CB 3.33Å; T63-Q66 VanDerWaalsContact OG1-CG 3.26Å; T63-Q66 WeakPolarHBondContact OG1-CG 3.42Å; T63-Q66 PolarHBondContact OG1-N 3.23Å; T63-A67 PolarHBondContact O-N 3.42Å
64	H	96.1	Very high	95	Very high	57 Å²	57	71.5 Å²	71.5	26%	0.264	35%	0.35	S	S	.	.	H	α-helix	trans	-55.3	-44.5	176	-172.3	86.2	0	0	0	111.8	G35 D38 Q39 A67 R68	G35-H64 WeakPolarHBondContact O-CB 3.47Å; G35-H64 PolarHBondContact O-ND1 2.89Å; D38-H64 PolarHBondContact OD1-N 2.83Å; Q39-H64 HydrophobicContact CG-CB 3.81Å; H64-A67 WeakPolarHBondContact O-CB 3.3Å; H64-A67 PolarHBondContact O-N 2.93Å; H64-R68 WeakPolarHBondContact O-CB 3.26Å; H64-R68 PolarHBondContact O-N 3.48Å
65	D	97.5	Very high	95.1	Very high	57 Å²	57	75.9 Å²	75.9	31%	0.305	38%	0.381	S	S	.	.	H	α-helix	trans	-69.6	-33.8	-179.9	-173.4	59	0	0	0	112.6	T63 R68 K69	T63-D65 VanDerWaalsContact C-N 3.27Å; T63-D65 PolarHBondContact O-N 3.31Å; D65-R68 PolarHBondContact O-N 3.33Å; D65-R68 IonicContact OD1-CZ 3.02Å; D65-R68 VanDerWaalsContact OD1-CZ 3.24Å; D65-R68 IonicContact OD1-NE 2.71Å; D65-R68 PolarHBondContact OD1-NE 3Å; D65-R68 IonicContact OD1-NH2 3.71Å; D65-R68 PolarHBondContact OD1-NH2 3.39Å; D65-K69 WeakPolarHBondContact O-CB 3.49Å; D65-K69 VanDerWaalsContact O-CG 3.3Å; D65-K69 WeakPolarHBondContact O-CG 3.42Å; D65-K69 PolarHBondContact O-N 2.66Å; D65-K69 WeakPolarHBondContact OD2-CD 3Å; D65-K69 WeakPolarHBondContact OD2-CE 3.41Å; D65-K69 IonicContact OD2-NZ 3.66Å; D65-K69 PolarHBondContact OD2-NZ 2.87Å
66	Q	97.6	Very high	95.2	Very high	102 Å²	102	75.7 Å²	75.7	48%	0.477	38%	0.379	S	S	.	.	H	α-helix	trans	-62.3	-46.4	172	-76.9	171.4	-17.9	0	0	111.1	V62 T63 K69 R70	V62-Q66 HydrophobicContact CB-CB 4.03Å; T63-Q66 WeakPolarHBondContact O-CB 3.3Å; T63-Q66 PolarHBondContact O-N 2.6Å; T63-Q66 WeakPolarHBondContact OG1-CB 3.33Å; T63-Q66 VanDerWaalsContact OG1-CG 3.26Å; T63-Q66 WeakPolarHBondContact OG1-CG 3.42Å; T63-Q66 PolarHBondContact OG1-N 3.23Å; Q66-K69 PolarHBondContact O-N 2.95Å; Q66-R70 WeakPolarHBondContact O-CB 3.35Å; Q66-R70 PolarHBondContact O-N 2.9Å
67	A	96.5	Very high	95.3	Very high	9 Å²	9	78 Å²	78	7%	0.074	37%	0.372	C	S	.	.	H	α-helix	trans	-58.4	-49.7	175.6	0	0	0	0	0	111.5	I33 M59 V62 T63 H64 K69 R70 L71	I33-A67 HydrophobicContact CD1-CB 4.01Å; M59-A67 HydrophobicContact CE-CB 3.29Å; V62-A67 HydrophobicContact CG2-CB 3.97Å; T63-A67 PolarHBondContact O-N 3.42Å; H64-A67 WeakPolarHBondContact O-CB 3.3Å; H64-A67 PolarHBondContact O-N 2.93Å; A67-K69 PolarHBondContact O-N 3.45Å; A67-R70 PolarHBondContact O-N 3.2Å; A67-L71 WeakPolarHBondContact O-CG 3.19Å; A67-L71 PolarHBondContact O-N 3.48Å
68	R	97.2	Very high	95.5	Very high	109 Å²	109	71.4 Å²	71.4	41%	0.411	35%	0.351	S	S	.	.	H	α-helix	trans	-56.9	-50.3	177.1	-174	-165.3	68.2	82.3	-2.7	111.7	I33 H64 D65 R70 L71 T72	I33-R68 HydrophobicContact CD1-CB 4.33Å; H64-R68 WeakPolarHBondContact O-CB 3.26Å; H64-R68 PolarHBondContact O-N 3.48Å; D65-R68 PolarHBondContact O-N 3.33Å; D65-R68 IonicContact OD1-CZ 3.02Å; D65-R68 VanDerWaalsContact OD1-CZ 3.24Å; D65-R68 IonicContact OD1-NE 2.71Å; D65-R68 PolarHBondContact OD1-NE 3Å; D65-R68 IonicContact OD1-NH2 3.71Å; D65-R68 PolarHBondContact OD1-NH2 3.39Å; R68-R70 VanDerWaalsContact C-N 3.32Å; R68-R70 PolarHBondContact O-N 2.66Å; R68-L71 PolarHBondContact O-N 2.78Å; R68-T72 HydrophobicContact CG-CG2 4.49Å; R68-T72 WeakPolarHBondContact O-CB 3.42Å; R68-T72 WeakPolarHBondContact O-CG2 3.41Å; R68-T72 PolarHBondContact O-N 3.19Å; R68-T72 PolarHBondContact O-OG1 2.81Å
69	K	97.2	Very high	95.7	Very high	125 Å²	125	67.7 Å²	67.7	54%	0.543	33%	0.331	S	S	.	.	H	α-helix	trans	-59.1	-41.9	177.9	-79.6	170.5	170.8	158.3	0	111.8	D65 Q66 A67 T72 K73	D65-K69 WeakPolarHBondContact O-CB 3.49Å; D65-K69 VanDerWaalsContact O-CG 3.3Å; D65-K69 WeakPolarHBondContact O-CG 3.42Å; D65-K69 PolarHBondContact O-N 2.66Å; D65-K69 WeakPolarHBondContact OD2-CD 3Å; D65-K69 WeakPolarHBondContact OD2-CE 3.41Å; D65-K69 IonicContact OD2-NZ 3.66Å; D65-K69 PolarHBondContact OD2-NZ 2.87Å; Q66-K69 PolarHBondContact O-N 2.95Å; A67-K69 PolarHBondContact O-N 3.45Å; K69-T72 PolarHBondContact O-N 2.82Å; K69-K73 PolarHBondContact O-N 3.31Å
70	R	96.8	Very high	95.9	Very high	37 Å²	37	70.8 Å²	70.8	14%	0.14	34%	0.342	C	S	.	.	H	α-helix	trans	-63.6	-42.5	179.1	-171.9	69.2	-169	90.6	-10.2	112.1	V54 N55 W57 Q66 A67 R68 E76	V54-R70 HydrophobicContact CB-CG 4.07Å; V54-R70 HydrophobicContact CG1-CG 3.76Å; N55-R70 PolarHBondContact O-NH2 2.72Å; W57-R70 HydrophobicContact CB-CG 4.36Å; Q66-R70 WeakPolarHBondContact O-CB 3.35Å; Q66-R70 PolarHBondContact O-N 2.9Å; A67-R70 PolarHBondContact O-N 3.2Å; R68-R70 VanDerWaalsContact C-N 3.32Å; R68-R70 PolarHBondContact O-N 2.66Å; R70-E76 IonicContact CZ-OE1 2.82Å; R70-E76 IonicContact CZ-OE2 2.9Å; R70-E76 VanDerWaalsContact NH1-CD 3.33Å; R70-E76 IonicContact NH1-OE1 2.72Å; R70-E76 PolarHBondContact NH1-OE1 3.44Å; R70-E76 IonicContact NH1-OE2 3.24Å; R70-E76 PolarHBondContact NH1-OE2 2.87Å; R70-E76 IonicContact NH2-OE1 3.55Å; R70-E76 IonicContact NH2-OE2 2.66Å
71	L	96.2	Very high	96.2	Very high	8 Å²	8	67.5 Å²	67.5	4%	0.042	32%	0.321	C	S	.	.	H	α-helix	trans	-72.4	-35	179.5	-74.7	166.4	0	0	0	112.9	K20 L29 F31 I33 V54 A67 R68 V79 L81	K20-L71 WeakPolarHBondContact CE-O 3.36Å; K20-L71 PolarHBondContact NZ-O 2.68Å; L29-L71 HydrophobicContact CD1-CB 3.78Å; L29-L71 HydrophobicContact CD1-CD2 4.05Å; L29-L71 HydrophobicContact CD1-CG 4.44Å; F31-L71 HydrophobicContact CE2-CD1 4.41Å; F31-L71 HydrophobicContact CZ-CD1 4.49Å; F31-L71 HydrophobicContact CZ-CD2 4.04Å; I33-L71 HydrophobicContact CD1-CD1 3.95Å; I33-L71 HydrophobicContact CG2-CD1 3.7Å; V54-L71 HydrophobicContact CB-CD2 4.49Å; V54-L71 HydrophobicContact CG1-CD2 3.82Å; V54-L71 HydrophobicContact CG1-CG 4.36Å; V54-L71 HydrophobicContact CG2-CD2 3.73Å; V54-L71 HydrophobicContact CG2-CG 4.24Å; A67-L71 WeakPolarHBondContact O-CG 3.19Å; A67-L71 PolarHBondContact O-N 3.48Å; R68-L71 PolarHBondContact O-N 2.78Å; L71-V79 HydrophobicContact CD2-CG1 3.88Å; L71-L81 HydrophobicContact CD2-CD2 3.87Å
72	T	96	Very high	96.3	Very high	66 Å²	66	63.5 Å²	63.5	41%	0.405	30%	0.302	S	S	.	.	T	Hydrogen-bonded Turn	trans	-96.4	10.3	-173.3	57.3	0	0	0	0	114.4	R68 K69 R74	R68-T72 HydrophobicContact CG-CG2 4.49Å; R68-T72 WeakPolarHBondContact O-CB 3.42Å; R68-T72 WeakPolarHBondContact O-CG2 3.41Å; R68-T72 PolarHBondContact O-N 3.19Å; R68-T72 PolarHBondContact O-OG1 2.81Å; K69-T72 PolarHBondContact O-N 2.82Å; T72-R74 PolarHBondContact O-N 3.33Å; T72-R74 VanDerWaalsContact O-N 3.15Å
73	K	95.9	Very high	96.2	Very high	98 Å²	98	63.1 Å²	63.1	43%	0.426	30%	0.299	S	S	.	.			trans	-57.3	120.4	179.2	-165.7	175.6	172.9	-163	0	111.4	K20 K69 S75 E76	K20-K73 PolarHBondContact NZ-O 2.91Å; K69-K73 PolarHBondContact O-N 3.31Å; K73-S75 VanDerWaalsContact C-N 3.29Å; K73-S75 WeakPolarHBondContact CE-OG 3.5Å; K73-S75 PolarHBondContact O-N 3.18Å; K73-E76 HydrophobicContact CD-CG 4.19Å; K73-E76 WeakPolarHBondContact CD-OE1 3.42Å; K73-E76 IonicContact NZ-OE1 3.27Å; K73-E76 PolarHBondContact NZ-OE1 3.43Å; K73-E76 PolarHBondContact O-N 2.79Å
74	R	93.9	Very high	95.8	Very high	174 Å²	174	62.5 Å²	62.5	66%	0.657	30%	0.296	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.1	-27.8	-172.9	-71.7	-176.1	173.6	-176.6	-6.2	113.9	L27 T72 E76	L27-R74 WeakPolarHBondContact CD1-O 3.38Å; T72-R74 PolarHBondContact O-N 3.33Å; T72-R74 VanDerWaalsContact O-N 3.15Å; R74-E76 PolarHBondContact O-N 3.05Å
75	S	95.2	Very high	95.4	Very high	92 Å²	92	63.9 Å²	63.9	64%	0.643	30%	0.299	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77.3	-6.8	178.1	68.1	0	0	0	0	113.7	K73	K73-S75 VanDerWaalsContact C-N 3.29Å; K73-S75 WeakPolarHBondContact CE-OG 3.5Å; K73-S75 PolarHBondContact O-N 3.18Å
76	E	95.5	Very high	94.7	Very high	35 Å²	35	65.3 Å²	65.3	16%	0.164	30%	0.304	C	S	.	.			trans	-115.1	97.6	-177.1	-67.4	179.7	-162.5	0	0	108.8	K20 N55 R70 K73 R74 V78	K20-E76 WeakPolarHBondContact CD-O 3.34Å; K20-E76 WeakPolarHBondContact CE-O 3.47Å; K20-E76 PolarHBondContact NZ-O 3.12Å; N55-E76 PolarHBondContact ND2-OE2 2.93Å; R70-E76 IonicContact CZ-OE1 2.82Å; R70-E76 IonicContact CZ-OE2 2.9Å; R70-E76 VanDerWaalsContact NH1-CD 3.33Å; R70-E76 IonicContact NH1-OE1 2.72Å; R70-E76 PolarHBondContact NH1-OE1 3.44Å; R70-E76 IonicContact NH1-OE2 3.24Å; R70-E76 PolarHBondContact NH1-OE2 2.87Å; R70-E76 IonicContact NH2-OE1 3.55Å; R70-E76 IonicContact NH2-OE2 2.66Å; K73-E76 HydrophobicContact CD-CG 4.19Å; K73-E76 WeakPolarHBondContact CD-OE1 3.42Å; K73-E76 IonicContact NZ-OE1 3.27Å; K73-E76 PolarHBondContact NZ-OE1 3.43Å; K73-E76 PolarHBondContact O-N 2.79Å; R74-E76 PolarHBondContact O-N 3.05Å; E76-V78 VanDerWaalsContact C-N 3.27Å
77	E	96.4	Very high	94.2	Very high	111 Å²	111	64.1 Å²	64.1	52%	0.519	31%	0.307	S	S	.	.	S	Bend	trans	-73.2	-22.2	175.3	-61	-161.9	150.8	0	0	112.3	K20 R22 L27	K20-E77 WeakPolarHBondContact CB-O 3.48Å; K20-E77 WeakPolarHBondContact CG-O 3.35Å; K20-E77 PolarHBondContact N-O 3.18Å; R22-E77 IonicContact NH2-OE1 3.64Å; R22-E77 PolarHBondContact NH2-OE1 3.29Å; L27-E77 HydrophobicContact CD1-CG 3.94Å
78	V	97.1	Very high	93.7	Very high	32 Å²	32	66.1 Å²	66.1	19%	0.194	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.4	132.4	178.3	-178	0	0	0	0	110.5	E17 I18 N55 E76 R80	E17-V78 HydrophobicContact CG-CG1 3.57Å; I18-V78 WeakPolarHBondContact O-CA 3.14Å; N55-V78 PolarHBondContact ND2-O 3Å; N55-V78 VanDerWaalsContact ND2-O 3.09Å; E76-V78 VanDerWaalsContact C-N 3.27Å; V78-R80 HydrophobicContact CG1-CG 4.37Å
79	V	97.2	Very high	93.1	Very high	0 Å²	0	64.5 Å²	64.5	0%	0	31%	0.313	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.3	123.3	174.7	169.1	0	0	0	0	109.4	I18 K20 L29 V54 L71 L81	I18-V79 PolarHBondContact N-O 3.48Å; I18-V79 PolarHBondContact O-N 3.4Å; K20-V79 VanDerWaalsContact CE-CG2 3.44Å; L29-V79 HydrophobicContact CD2-CB 3.93Å; L29-V79 HydrophobicContact CD2-CG1 4.45Å; L29-V79 HydrophobicContact CD2-CG2 3.94Å; V54-V79 HydrophobicContact CG1-CG1 4.06Å; L71-V79 HydrophobicContact CD2-CG1 3.88Å; V79-L81 HydrophobicContact CG1-CD2 3.47Å; V79-L81 VanDerWaalsContact CG1-CD2 3.47Å; V79-L81 HydrophobicContact CG1-CG 4.04Å
80	R	97.4	Very high	92.5	Very high	92 Å²	92	64.1 Å²	64.1	35%	0.347	31%	0.311	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	114.3	176.2	-62.4	-179.7	174.2	87.1	11	109.3	V16 E17 N55 V78	V16-R80 CarbonylContact O-C 3.59Å; V16-R80 WeakPolarHBondContact O-CA 3.4Å; E17-R80 HydrophobicContact CB-CG 4.45Å; E17-R80 VanDerWaalsContact CD-NH2 3.32Å; E17-R80 HydrophobicContact CG-CG 4.1Å; E17-R80 IonicContact OE1-CZ 3.59Å; E17-R80 IonicContact OE1-NE 3.71Å; E17-R80 IonicContact OE1-NH2 2.81Å; E17-R80 PolarHBondContact OE1-NH2 3.3Å; E17-R80 IonicContact OE2-CZ 3.39Å; E17-R80 IonicContact OE2-NE 2.72Å; E17-R80 PolarHBondContact OE2-NE 3.35Å; E17-R80 IonicContact OE2-NH2 3.26Å; E17-R80 PolarHBondContact OE2-NH2 3Å; N55-R80 PolarHBondContact N-O 3.01Å; N55-R80 WeakPolarHBondContact OD1-CB 3.13Å; N55-R80 PolarHBondContact OD1-N 3.46Å; V78-R80 HydrophobicContact CG1-CG 4.37Å
81	L	96.1	Very high	92	Very high	12 Å²	12	64.7 Å²	64.7	6%	0.063	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.5	140.8	178.4	-51.3	178.6	0	0	0	109.6	R15 V16 I18 F31 T51 K53 V54 L71 V79 V83	R15-L81 CarbonylContact C-O 3.55Å; R15-L81 WeakPolarHBondContact CA-O 3.42Å; V16-L81 HydrophobicContact CB-CB 4.34Å; V16-L81 PolarHBondContact N-O 3.03Å; V16-L81 PolarHBondContact O-N 3.03Å; I18-L81 HydrophobicContact CD1-CD1 3.74Å; I18-L81 HydrophobicContact CD1-CG 4.44Å; F31-L81 HydrophobicContact CE1-CD1 4.36Å; F31-L81 HydrophobicContact CZ-CD1 4.06Å; T51-L81 HydrophobicContact CG2-CD2 4.23Å; K53-L81 WeakPolarHBondContact O-CA 3.15Å; V54-L81 HydrophobicContact CB-CD2 4.39Å; V54-L81 HydrophobicContact CG1-CD2 4.41Å; V54-L81 HydrophobicContact CG2-CD2 3.62Å; L71-L81 HydrophobicContact CD2-CD2 3.87Å; V79-L81 HydrophobicContact CG1-CD2 3.47Å; V79-L81 VanDerWaalsContact CG1-CD2 3.47Å; V79-L81 HydrophobicContact CG1-CG 4.04Å; L81-V83 HydrophobicContact CB-CG1 3.87Å; L81-V83 HydrophobicContact CD1-CG1 4.47Å
82	L	94.3	Very high	91.5	Very high	58 Å²	58	67.2 Å²	67.2	30%	0.304	34%	0.339	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.4	119.6	155	-83.7	161.6	0	0	0	106.9	V13 Q14 R15 D52 K53	V13-L82 HydrophobicContact CB-CD2 4.06Å; V13-L82 HydrophobicContact CG2-CD2 3.82Å; Q14-L82 WeakPolarHBondContact O-CA 3.42Å; R15-L82 HydrophobicContact CB-CD2 4.33Å; D52-L82 PolarHBondContact N-O 3.27Å; K53-L82 HydrophobicContact CB-CB 4.14Å; K53-L82 HydrophobicContact CB-CD1 4.18Å; K53-L82 HydrophobicContact CD-CD1 4Å; K53-L82 HydrophobicContact CG-CD1 4.31Å; K53-L82 PolarHBondContact N-O 3.22Å; K53-L82 PolarHBondContact O-N 3.37Å
83	V	92.5	Very high	90.9	Very high	14 Å²	14	69.8 Å²	69.8	9%	0.085	35%	0.347	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125	131.6	-177.4	-58.5	0	0	0	0	111	V13 Q14 V16 K50 T51 L81 R85	V13-V83 CarbonylContact C-O 3.47Å; V13-V83 WeakPolarHBondContact CA-O 3.45Å; Q14-V83 HydrophobicContact CB-CG2 3.88Å; Q14-V83 PolarHBondContact N-O 3.11Å; Q14-V83 PolarHBondContact O-N 3.19Å; V16-V83 HydrophobicContact CG2-CG2 4.05Å; K50-V83 CarbonylContact O-C 3.59Å; K50-V83 WeakPolarHBondContact O-CA 3.44Å; T51-V83 HydrophobicContact CG2-CG1 4.39Å; L81-V83 HydrophobicContact CB-CG1 3.87Å; L81-V83 HydrophobicContact CD1-CG1 4.47Å; V83-R85 HydrophobicContact CG2-CG 4.09Å
84	T	89.8	Confident	90.5	Very high	24 Å²	24	71.8 Å²	71.8	15%	0.147	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.3	131.1	167.3	-64	0	0	0	0	108.8	A11 D49 K50 D52	A11-T84 HydrophobicContact CB-CG2 4.02Å; D49-T84 WeakPolarHBondContact CA-O 3.45Å; K50-T84 PolarHBondContact N-O 2.96Å; K50-T84 PolarHBondContact O-N 3.38Å; D52-T84 PolarHBondContact OD2-N 2.82Å; D52-T84 PolarHBondContact OD2-OG1 2.85Å
85	R	86.8	Confident	90.2	Very high	87 Å²	87	66.8 Å²	66.8	33%	0.328	35%	0.349	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.1	129.8	178.2	-48.4	-174.2	104	166.9	7.1	110	D49 V83 S87 L88 Q89	D49-R85 WeakPolarHBondContact OD1-CA 3.41Å; D49-R85 VanDerWaalsContact OD1-CB 3.3Å; D49-R85 WeakPolarHBondContact OD1-CB 3.3Å; D49-R85 WeakPolarHBondContact OD1-CG 3.48Å; D49-R85 IonicContact OD1-NE 3.82Å; D49-R85 IonicContact OD2-CZ 3.19Å; D49-R85 VanDerWaalsContact OD2-CZ 3.27Å; D49-R85 IonicContact OD2-NE 3.03Å; D49-R85 PolarHBondContact OD2-NE 3.35Å; D49-R85 IonicContact OD2-NH2 2.85Å; D49-R85 PolarHBondContact OD2-NH2 3.19Å; V83-R85 HydrophobicContact CG2-CG 4.09Å; R85-S87 PolarHBondContact O-N 3.21Å; R85-L88 HydrophobicContact CB-CB 4.32Å; R85-L88 HydrophobicContact CB-CD1 3.92Å; R85-L88 HydrophobicContact CB-CG 4.04Å; R85-L88 HydrophobicContact CG-CD1 3.97Å; R85-L88 PolarHBondContact O-N 3.17Å; R85-L88 VanDerWaalsContact O-N 3.11Å; R85-Q89 PolarHBondContact O-N 3.38Å
86	Q	83.6	Confident	89.5	Confident	87 Å²	87	69.8 Å²	69.8	41%	0.407	36%	0.355	S	S	.	.	H	α-helix	trans	-62.4	-33.6	-177.5	-161.3	-176.4	27.6	0	0	112.4	Q89 K90	Q86-Q89 PolarHBondContact O-N 3.14Å; Q86-K90 WeakPolarHBondContact O-CG 3.47Å; Q86-K90 PolarHBondContact O-N 3.1Å; Q86-K90 VanDerWaalsContact O-N 3.14Å
87	S	86.3	Confident	88.7	Confident	77 Å²	77	75.2 Å²	75.2	54%	0.538	38%	0.384	S	S	.	.	H	α-helix	trans	-61.9	-40.5	175.5	54.9	0	0	0	0	112.5	R85 K90 A91	R85-S87 PolarHBondContact O-N 3.21Å; S87-K90 PolarHBondContact O-N 3.46Å; S87-A91 PolarHBondContact O-N 3.45Å
88	L	86.4	Confident	87.1	Confident	50 Å²	50	76.9 Å²	76.9	26%	0.262	41%	0.408	S	S	.	.	H	α-helix	trans	-68.8	-37.1	177.9	-69.1	174.6	0	0	0	112.2	V12 Q14 R85 K90 A91 V92	V12-L88 HydrophobicContact CB-CB 4.4Å; V12-L88 HydrophobicContact CG1-CB 3.86Å; Q14-L88 HydrophobicContact CB-CD1 3.57Å; Q14-L88 HydrophobicContact CG-CD1 4.29Å; R85-L88 HydrophobicContact CB-CB 4.32Å; R85-L88 HydrophobicContact CB-CD1 3.92Å; R85-L88 HydrophobicContact CB-CG 4.04Å; R85-L88 HydrophobicContact CG-CD1 3.97Å; R85-L88 PolarHBondContact O-N 3.17Å; R85-L88 VanDerWaalsContact O-N 3.11Å; L88-K90 VanDerWaalsContact C-N 3.34Å; L88-A91 PolarHBondContact O-N 3.16Å; L88-V92 WeakPolarHBondContact O-CG2 3.36Å; L88-V92 PolarHBondContact O-N 2.97Å
89	Q	84	Confident	86.6	Confident	76 Å²	76	79.2 Å²	79.2	36%	0.355	42%	0.419	S	S	.	.	H	α-helix	trans	-62.1	-44.1	175.1	-167.6	172.7	15.5	0	0	111.4	R85 Q86 V92 Q93	R85-Q89 PolarHBondContact O-N 3.38Å; Q86-Q89 PolarHBondContact O-N 3.14Å; Q89-V92 PolarHBondContact O-N 3.31Å; Q89-Q93 WeakPolarHBondContact O-CB 3.37Å; Q89-Q93 PolarHBondContact O-N 3.3Å
90	K	85.7	Confident	86.1	Confident	117 Å²	117	83.3 Å²	83.3	51%	0.509	44%	0.441	S	S	.	.	H	α-helix	trans	-61.6	-43.7	174.7	-70.1	174.6	-178	172.5	0	111.7	Q86 S87 L88 Q93 Q94	Q86-K90 WeakPolarHBondContact O-CG 3.47Å; Q86-K90 PolarHBondContact O-N 3.1Å; Q86-K90 VanDerWaalsContact O-N 3.14Å; S87-K90 PolarHBondContact O-N 3.46Å; L88-K90 VanDerWaalsContact C-N 3.34Å; K90-Q93 PolarHBondContact O-N 2.9Å; K90-Q94 WeakPolarHBondContact O-CG 3.5Å; K90-Q94 PolarHBondContact O-N 3.25Å
91	A	86.6	Confident	85.4	Confident	49 Å²	49	82.8 Å²	82.8	41%	0.405	45%	0.446	S	S	.	.	H	α-helix	trans	-61.7	-44.1	179.8	0	0	0	0	0	112.5	S87 L88 Q94 S95	S87-A91 PolarHBondContact O-N 3.45Å; L88-A91 PolarHBondContact O-N 3.16Å; A91-Q94 PolarHBondContact O-N 3.28Å; A91-S95 PolarHBondContact O-N 3.16Å
92	V	85.3	Confident	84.8	Confident	61 Å²	61	87 Å²	87	37%	0.37	47%	0.469	S	S	.	.	H	α-helix	trans	-67.6	-38.8	176.9	173.3	0	0	0	0	111.6	V12 L88 Q89 Q94 S95 M96	V12-V92 HydrophobicContact CB-CG2 4.41Å; V12-V92 HydrophobicContact CG1-CG2 3.81Å; V12-V92 HydrophobicContact CG2-CB 3.85Å; V12-V92 HydrophobicContact CG2-CG1 4.14Å; V12-V92 HydrophobicContact CG2-CG2 3.74Å; L88-V92 WeakPolarHBondContact O-CG2 3.36Å; L88-V92 PolarHBondContact O-N 2.97Å; Q89-V92 PolarHBondContact O-N 3.31Å; V92-Q94 VanDerWaalsContact C-N 3.29Å; V92-Q94 PolarHBondContact O-N 3.14Å; V92-S95 WeakPolarHBondContact CA-OG 3.17Å; V92-S95 PolarHBondContact O-N 3.26Å; V92-S95 PolarHBondContact O-OG 2.95Å; V92-M96 HydrophobicContact CG1-CG 4.4Å; V92-M96 WeakPolarHBondContact O-CG 3.27Å; V92-M96 PolarHBondContact O-N 3.41Å; V92-M96 VanDerWaalsContact O-N 3.12Å
93	Q	83.4	Confident	84.2	Confident	120 Å²	120	88.8 Å²	88.8	56%	0.561	48%	0.479	S	S	*	.	H	α-helix	trans	-63.1	-39	176.6	-169.4	175	6.1	0	0	111.5	Q89 K90 M96 L97	Q89-Q93 WeakPolarHBondContact O-CB 3.37Å; Q89-Q93 PolarHBondContact O-N 3.3Å; K90-Q93 PolarHBondContact O-N 2.9Å; Q93-M96 PolarHBondContact O-N 3.07Å; Q93-L97 WeakPolarHBondContact O-CG 3.29Å
94	Q	86.4	Confident	83.7	Confident	139 Å²	139	93.8 Å²	93.8	65%	0.65	51%	0.506	S	S	*	.	H	α-helix	trans	-66	-42.2	174.7	-74	174.2	-14.4	0	0	112.1	K90 A91 V92 M96 L97 S98	K90-Q94 WeakPolarHBondContact O-CG 3.5Å; K90-Q94 PolarHBondContact O-N 3.25Å; A91-Q94 PolarHBondContact O-N 3.28Å; V92-Q94 VanDerWaalsContact C-N 3.29Å; V92-Q94 PolarHBondContact O-N 3.14Å; Q94-M96 PolarHBondContact O-N 3.26Å; Q94-L97 PolarHBondContact O-N 3.07Å; Q94-L97 VanDerWaalsContact O-N 3.16Å; Q94-S98 PolarHBondContact O-N 2.71Å
95	S	88	Confident	83.2	Confident	69 Å²	69	98.8 Å²	98.8	48%	0.483	53%	0.531	S	S	.	.	H	α-helix	trans	-67.9	-20.1	178.6	66.3	0	0	0	0	114	A91 V92 S98	A91-S95 PolarHBondContact O-N 3.16Å; V92-S95 WeakPolarHBondContact CA-OG 3.17Å; V92-S95 PolarHBondContact O-N 3.26Å; V92-S95 PolarHBondContact O-OG 2.95Å; S95-S98 PolarHBondContact O-OG 2.86Å; S95-S98 VanDerWaalsContact O-OG 3.05Å
96	M	81.8	Confident	83	Confident	155 Å²	155	99.7 Å²	99.7	76%	0.764	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.8	-14.9	176.3	-66.4	-90.8	-79.7	0	0	112.6	V92 Q93 Q94	V92-M96 HydrophobicContact CG1-CG 4.4Å; V92-M96 WeakPolarHBondContact O-CG 3.27Å; V92-M96 PolarHBondContact O-N 3.41Å; V92-M96 VanDerWaalsContact O-N 3.12Å; Q93-M96 PolarHBondContact O-N 3.07Å; Q94-M96 PolarHBondContact O-N 3.26Å
97	L	77.7	Confident	82.9	Confident	149 Å²	149	100.8 Å²	100.8	78%	0.78	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.3	-8.2	179.4	-69.3	167.1	0	0	0	112.9	Q93 Q94	Q93-L97 WeakPolarHBondContact O-CG 3.29Å; Q94-L97 PolarHBondContact O-N 3.07Å; Q94-L97 VanDerWaalsContact O-N 3.16Å
98	S	63.2	Low	82.6	Confident	147 Å²	147	102.9 Å²	102.9	100%	1.028	56%	0.56	S	S	*	*			trans	-94.4	0	174	62	0	0	0	0	111.5	Q94 S95	Q94-S98 PolarHBondContact O-N 2.71Å; S95-S98 PolarHBondContact O-OG 2.86Å; S95-S98 VanDerWaalsContact O-OG 3.05Å

Retrieved 98 of 98 residues in 184.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).