TX1B3_RAT Loading...

Tax1-binding protein 3

May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway (By similarity).

AlphaFold DB , UniProt , Accession Q4QQV1, Species RAT (Rattus norvegicus, Rat), Gene Tax1bp3, Length 98 aa.

						>TX1B3_RAT|Q4QQV1|Tax1bp3
MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.7	Very low	69.5	Low	228 Å²	228	118.5 Å²	118.5	100%	1.123	70%	0.697	S	S	*	*				0	120.7	0	-66.2	-176.5	-161.6	0	0	107.4
2	S	56.5	Low	70.8	Confident	111 Å²	111	111.9 Å²	111.9	78%	0.776	66%	0.659	S	S	*	*			trans	-79.6	120.9	173.4	43.4	0	0	0	0	109.1	I4	S2-I4 PolarHBondContact O-N 3.26Å
3	Y	64.6	Low	72.3	Confident	171 Å²	171	108.9 Å²	108.9	67%	0.671	64%	0.642	S	S	*	*			trans	-63.9	125.5	173.5	170.5	-101.1	0	0	0	109.6	P5 V9	Y3-P5 HydrophobicContact CD1-CG 4.27Å; Y3-P5 HydrophobicContact CE1-CB 4.23Å; Y3-P5 HydrophobicContact CE1-CG 3.94Å; Y3-V9 HydrophobicContact CE2-CG2 4.31Å
4	I	77	Confident	73.7	Confident	95 Å²	95	106.2 Å²	106.2	49%	0.487	62%	0.62	S	S	.	*			trans	-102.6	113.3	173.1	-57.3	-179.2	0	0	0	107.4	S2 G6 Q7	S2-I4 PolarHBondContact O-N 3.26Å; I4-G6 PolarHBondContact O-N 2.81Å; I4-Q7 HydrophobicContact CB-CB 4.28Å; I4-Q7 PolarHBondContact O-N 2.72Å; I4-Q7 VanDerWaalsContact O-N 3.17Å
5	P	76.7	Confident	75.1	Confident	102 Å²	102	110.9 Å²	110.9	66%	0.662	62%	0.623	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.7	134.2	176.8	-25.3	33.6	0	0	0	111.8	Y3 Q7	Y3-P5 HydrophobicContact CD1-CG 4.27Å; Y3-P5 HydrophobicContact CE1-CB 4.23Å; Y3-P5 HydrophobicContact CE1-CG 3.94Å; P5-Q7 VanDerWaalsContact C-N 3.31Å; P5-Q7 PolarHBondContact O-N 3.09Å
6	G	78.5	Confident	76.3	Confident	81 Å²	81	106.6 Å²	106.6	84%	0.835	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	86.6	-11.5	179.5	0	0	0	0	0	115.1	I4	I4-G6 PolarHBondContact O-N 2.81Å
7	Q	72.7	Confident	77.5	Confident	121 Å²	121	105.7 Å²	105.7	57%	0.565	59%	0.59	S	S	*	*	S	Bend	trans	-80.6	129.4	173.5	-158.7	171.2	0.3	0	0	110	I4 P5 V9	I4-Q7 HydrophobicContact CB-CB 4.28Å; I4-Q7 PolarHBondContact O-N 2.72Å; I4-Q7 VanDerWaalsContact O-N 3.17Å; P5-Q7 VanDerWaalsContact C-N 3.31Å; P5-Q7 PolarHBondContact O-N 3.09Å; Q7-V9 PolarHBondContact O-N 3.02Å
8	P	68.8	Low	78.6	Confident	109 Å²	109	101.7 Å²	101.7	71%	0.708	57%	0.567	S	S	*	*			trans	-62.1	123.1	-179.1	21.2	-30.4	0	0	0	110.8	T10	P8-T10 PolarHBondContact O-N 2.76Å
9	V	67.4	Low	79.6	Confident	121 Å²	121	103.6 Å²	103.6	73%	0.733	57%	0.571	S	S	*	*			trans	-77.8	114.1	172.7	-178	0	0	0	0	107.6	Y3 Q7	Y3-V9 HydrophobicContact CE2-CG2 4.31Å; Q7-V9 PolarHBondContact O-N 3.02Å
10	T	73.1	Confident	80.5	Confident	119 Å²	119	99.4 Å²	99.4	73%	0.73	55%	0.546	S	S	*	.			trans	-98.8	115.8	175.9	-41.9	0	0	0	0	108.2	P8	P8-T10 PolarHBondContact O-N 2.76Å
11	A	79.8	Confident	81.3	Confident	45 Å²	45	100.2 Å²	100.2	37%	0.372	55%	0.549	S	S	.	.			trans	-113.3	140.2	176.2	0	0	0	0	0	109.9	V13 T84	A11-V13 PolarHBondContact O-N 2.71Å; A11-T84 HydrophobicContact CB-CG2 4.02Å
12	V	85.4	Confident	83.5	Confident	40 Å²	40	96.4 Å²	96.4	24%	0.242	52%	0.522	C	S	.	.			trans	-82	117.3	171	-179.8	0	0	0	0	107.6	L88 V92	V12-L88 HydrophobicContact CB-CB 4.4Å; V12-L88 HydrophobicContact CG1-CB 3.86Å; V12-V92 HydrophobicContact CB-CG2 4.41Å; V12-V92 HydrophobicContact CG1-CG2 3.81Å; V12-V92 HydrophobicContact CG2-CB 3.85Å; V12-V92 HydrophobicContact CG2-CG1 4.14Å; V12-V92 HydrophobicContact CG2-CG2 3.74Å
13	V	89.3	Confident	85.3	Confident	73 Å²	73	97 Å²	97	44%	0.442	51%	0.513	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.4	139.6	179.9	-65.2	0	0	0	0	110.9	A11 L82 V83	A11-V13 PolarHBondContact O-N 2.71Å; V13-L82 HydrophobicContact CB-CD2 4.06Å; V13-L82 HydrophobicContact CG2-CD2 3.82Å; V13-V83 CarbonylContact C-O 3.47Å; V13-V83 WeakPolarHBondContact CA-O 3.45Å
14	Q	92.1	Very high	86.8	Confident	71 Å²	71	92.1 Å²	92.1	33%	0.332	51%	0.514	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.4	132.1	168.4	-170.9	173.9	14.3	0	0	109.3	V16 L82 V83 L88	Q14-V16 HydrophobicContact CG-CG2 3.93Å; Q14-L82 WeakPolarHBondContact O-CA 3.42Å; Q14-V83 HydrophobicContact CB-CG2 3.88Å; Q14-V83 PolarHBondContact N-O 3.11Å; Q14-V83 PolarHBondContact O-N 3.19Å; Q14-L88 HydrophobicContact CB-CD1 3.57Å; Q14-L88 HydrophobicContact CG-CD1 4.29Å
15	R	94.5	Very high	87.5	Confident	177 Å²	177	95.3 Å²	95.3	67%	0.668	53%	0.527	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.2	120.9	166.9	-170.6	174.9	176.7	171.5	-3.3	108.8	L81 L82	R15-L81 CarbonylContact C-O 3.55Å; R15-L81 WeakPolarHBondContact CA-O 3.42Å; R15-L82 HydrophobicContact CB-CD2 4.33Å
16	V	94.9	Very high	88.3	Confident	42 Å²	42	94.4 Å²	94.4	26%	0.255	52%	0.517	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	130.6	178.2	-174.8	0	0	0	0	108.6	Q14 I18 R80 L81 V83	Q14-V16 HydrophobicContact CG-CG2 3.93Å; V16-I18 HydrophobicContact CG1-CD1 4.31Å; V16-I18 HydrophobicContact CG1-CG1 3.95Å; V16-R80 CarbonylContact O-C 3.59Å; V16-R80 WeakPolarHBondContact O-CA 3.4Å; V16-L81 HydrophobicContact CB-CB 4.34Å; V16-L81 PolarHBondContact N-O 3.03Å; V16-L81 PolarHBondContact O-N 3.03Å; V16-V83 HydrophobicContact CG2-CG2 4.05Å
17	E	97.4	Very high	89.1	Confident	91 Å²	91	91.6 Å²	91.6	43%	0.425	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.1	124	175.7	-174.8	157.8	153.9	0	0	109.4	H19 V78 R80	E17-H19 IonicContact OE1-NE2 3.92Å; E17-V78 HydrophobicContact CG-CG1 3.57Å; E17-R80 HydrophobicContact CB-CG 4.45Å; E17-R80 VanDerWaalsContact CD-NH2 3.32Å; E17-R80 HydrophobicContact CG-CG 4.1Å; E17-R80 IonicContact OE1-CZ 3.59Å; E17-R80 IonicContact OE1-NE 3.71Å; E17-R80 IonicContact OE1-NH2 2.81Å; E17-R80 PolarHBondContact OE1-NH2 3.3Å; E17-R80 IonicContact OE2-CZ 3.39Å; E17-R80 IonicContact OE2-NE 2.72Å; E17-R80 PolarHBondContact OE2-NE 3.35Å; E17-R80 IonicContact OE2-NH2 3.26Å; E17-R80 PolarHBondContact OE2-NH2 3Å
18	I	96.6	Very high	90.3	Very high	34 Å²	34	88.6 Å²	88.6	17%	0.174	47%	0.469	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.9	118.9	-175.7	-54.9	175.4	0	0	0	108.3	V16 L29 F31 V78 V79 L81	V16-I18 HydrophobicContact CG1-CD1 4.31Å; V16-I18 HydrophobicContact CG1-CG1 3.95Å; I18-L29 HydrophobicContact CB-CD2 4.33Å; I18-L29 HydrophobicContact CG2-CD2 3.88Å; I18-F31 HydrophobicContact CD1-CD1 4.02Å; I18-F31 HydrophobicContact CD1-CE1 3.51Å; I18-F31 HydrophobicContact CD1-CZ 4.44Å; I18-V78 WeakPolarHBondContact O-CA 3.14Å; I18-V79 PolarHBondContact N-O 3.48Å; I18-V79 PolarHBondContact O-N 3.4Å; I18-L81 HydrophobicContact CD1-CD1 3.74Å; I18-L81 HydrophobicContact CD1-CG 4.44Å
19	H	97.6	Very high	91.6	Very high	138 Å²	138	84.9 Å²	84.9	64%	0.639	44%	0.444	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.5	119.1	166.2	-69.9	-107.6	0	0	0	108.3	E17	E17-H19 IonicContact OE1-NE2 3.92Å
20	K	97.4	Very high	92.9	Very high	19 Å²	19	82.9 Å²	82.9	8%	0.083	45%	0.447	C	S	.	.	P	Polyproline II helix	trans	-65.1	138.9	179.6	-68.1	-179.1	-173.7	169.3	0	110.3	L27 I28 L29 L71 K73 E76 E77 V79	K20-L27 HydrophobicContact CB-CB 3.88Å; K20-L27 HydrophobicContact CB-CD2 4.23Å; K20-L27 HydrophobicContact CD-CB 3.62Å; K20-L27 HydrophobicContact CD-CD1 4.38Å; K20-L27 HydrophobicContact CG-CB 4.37Å; K20-I28 CarbonylContact C-O 3.45Å; K20-I28 VanDerWaalsContact CA-O 3.29Å; K20-I28 WeakPolarHBondContact CA-O 3.33Å; K20-I28 WeakPolarHBondContact CB-O 3.42Å; K20-L29 HydrophobicContact CD-CD2 4.32Å; K20-L29 HydrophobicContact CG-CD2 3.66Å; K20-L29 HydrophobicContact CG-CG 4.17Å; K20-L71 WeakPolarHBondContact CE-O 3.36Å; K20-L71 PolarHBondContact NZ-O 2.68Å; K20-K73 PolarHBondContact NZ-O 2.91Å; K20-E76 WeakPolarHBondContact CD-O 3.34Å; K20-E76 WeakPolarHBondContact CE-O 3.47Å; K20-E76 PolarHBondContact NZ-O 3.12Å; K20-E77 WeakPolarHBondContact CB-O 3.48Å; K20-E77 WeakPolarHBondContact CG-O 3.35Å; K20-E77 PolarHBondContact N-O 3.18Å; K20-V79 VanDerWaalsContact CE-CG2 3.44Å
21	L	97.2	Very high	93.9	Very high	117 Å²	117	81 Å²	81	61%	0.613	43%	0.429	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.5	133.8	172.6	-178.8	64.4	0	0	0	109.5	L27 I28	L21-L27 WeakPolarHBondContact O-CA 3.29Å; L21-I28 HydrophobicContact CB-CG1 3.9Å; L21-I28 HydrophobicContact CD2-CD1 4.3Å; L21-I28 HydrophobicContact CG-CG1 4.49Å; L21-I28 PolarHBondContact N-O 3.34Å; L21-I28 WeakPolarHBondContact O-CG1 3.36Å; L21-I28 PolarHBondContact O-N 2.82Å
22	R	96.3	Very high	94.5	Very high	147 Å²	147	83.7 Å²	83.7	56%	0.555	45%	0.445	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.6	124	173.4	-173.9	166	-69.7	-85.2	1.3	110.1	L27 E77	R22-L27 HydrophobicContact CB-CD2 4.2Å; R22-E77 IonicContact NH2-OE1 3.64Å; R22-E77 PolarHBondContact NH2-OE1 3.29Å
23	Q	95	Very high	94.9	Very high	125 Å²	125	84.3 Å²	84.3	58%	0.584	45%	0.446	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-132.2	98.2	175.7	-168.8	-177.1	37.3	0	0	108.9	E25 N26 I28	Q23-E25 PolarHBondContact O-N 3.15Å; Q23-N26 PolarHBondContact N-O 2.85Å; Q23-N26 PolarHBondContact O-N 2.93Å; Q23-I28 HydrophobicContact CB-CD1 4.38Å
24	G	94.2	Very high	95.1	Very high	67 Å²	67	82.5 Å²	82.5	69%	0.691	44%	0.443	S	S	*	.	T	Hydrogen-bonded Turn	trans	59.5	-125.3	-169	0	0	0	0	0	111	N26	G24-N26 VanDerWaalsContact C-N 3.31Å
25	E	93.2	Very high	95.1	Very high	162 Å²	162	80.2 Å²	80.2	76%	0.757	44%	0.438	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.8	-6.5	176.6	-59.8	-170	167.9	0	0	113.9	Q23	Q23-E25 PolarHBondContact O-N 3.15Å
26	N	93.6	Very high	95.1	Very high	83 Å²	83	73.3 Å²	73.3	44%	0.444	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.2	150.9	-175.1	-67.1	-40.2	0	0	0	112.3	Q23 G24 I28	Q23-N26 PolarHBondContact N-O 2.85Å; Q23-N26 PolarHBondContact O-N 2.93Å; G24-N26 VanDerWaalsContact C-N 3.31Å; N26-I28 HydrophobicContact CB-CG2 4.43Å
27	L	95.6	Very high	95.1	Very high	23 Å²	23	76.1 Å²	76.1	12%	0.12	43%	0.434	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.1	116	167.5	-70.1	173.5	0	0	0	108.1	K20 L21 R22 R74 E77	K20-L27 HydrophobicContact CB-CB 3.88Å; K20-L27 HydrophobicContact CB-CD2 4.23Å; K20-L27 HydrophobicContact CD-CB 3.62Å; K20-L27 HydrophobicContact CD-CD1 4.38Å; K20-L27 HydrophobicContact CG-CB 4.37Å; L21-L27 WeakPolarHBondContact O-CA 3.29Å; R22-L27 HydrophobicContact CB-CD2 4.2Å; L27-R74 WeakPolarHBondContact CD1-O 3.38Å; L27-E77 HydrophobicContact CD1-CG 3.94Å
28	I	96	Very high	95.1	Very high	57 Å²	57	75.6 Å²	75.6	29%	0.292	44%	0.435	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	148.4	-175.4	66.9	170.4	0	0	0	111.2	K20 L21 Q23 N26	K20-I28 CarbonylContact C-O 3.45Å; K20-I28 VanDerWaalsContact CA-O 3.29Å; K20-I28 WeakPolarHBondContact CA-O 3.33Å; K20-I28 WeakPolarHBondContact CB-O 3.42Å; L21-I28 HydrophobicContact CB-CG1 3.9Å; L21-I28 HydrophobicContact CD2-CD1 4.3Å; L21-I28 HydrophobicContact CG-CG1 4.49Å; L21-I28 PolarHBondContact N-O 3.34Å; L21-I28 WeakPolarHBondContact O-CG1 3.36Å; L21-I28 PolarHBondContact O-N 2.82Å; Q23-I28 HydrophobicContact CB-CD1 4.38Å; N26-I28 HydrophobicContact CB-CG2 4.43Å
29	L	96.4	Very high	95	Very high	32 Å²	32	78.3 Å²	78.3	17%	0.168	45%	0.447	C	S	.	.			trans	-95	-22.4	-180	-72.8	164.1	0	0	0	113.6	I18 K20 F31 L71 V79	I18-L29 HydrophobicContact CB-CD2 4.33Å; I18-L29 HydrophobicContact CG2-CD2 3.88Å; K20-L29 HydrophobicContact CD-CD2 4.32Å; K20-L29 HydrophobicContact CG-CD2 3.66Å; K20-L29 HydrophobicContact CG-CG 4.17Å; L29-F31 HydrophobicContact CB-CD1 3.63Å; L29-F31 HydrophobicContact CB-CE1 3.47Å; L29-F31 VanDerWaalsContact CB-CE1 3.47Å; L29-F31 HydrophobicContact CB-CZ 4.27Å; L29-F31 HydrophobicContact CD1-CE1 3.79Å; L29-F31 HydrophobicContact CD1-CZ 3.81Å; L29-F31 HydrophobicContact CD2-CE1 4.02Å; L29-F31 HydrophobicContact CG-CE1 3.96Å; L29-F31 HydrophobicContact CG-CZ 4.49Å; L29-L71 HydrophobicContact CD1-CB 3.78Å; L29-L71 HydrophobicContact CD1-CD2 4.05Å; L29-L71 HydrophobicContact CD1-CG 4.44Å; L29-V79 HydrophobicContact CD2-CB 3.93Å; L29-V79 HydrophobicContact CD2-CG1 4.45Å; L29-V79 HydrophobicContact CD2-CG2 3.94Å
30	G	94.7	Very high	94.8	Very high	78 Å²	78	76 Å²	76	80%	0.804	44%	0.439	S	S	*	.	S	Bend	trans	77.4	15.3	-178.2	0	0	0	0	0	115.1
31	F	94.2	Very high	94.5	Very high	80 Å²	80	80.2 Å²	80.2	35%	0.351	47%	0.469	S	S	.	.			trans	-138.6	163.9	173.2	70.2	-94.2	0	0	0	111.8	I18 L29 I33 L71 L81	I18-F31 HydrophobicContact CD1-CD1 4.02Å; I18-F31 HydrophobicContact CD1-CE1 3.51Å; I18-F31 HydrophobicContact CD1-CZ 4.44Å; L29-F31 HydrophobicContact CB-CD1 3.63Å; L29-F31 HydrophobicContact CB-CE1 3.47Å; L29-F31 VanDerWaalsContact CB-CE1 3.47Å; L29-F31 HydrophobicContact CB-CZ 4.27Å; L29-F31 HydrophobicContact CD1-CE1 3.79Å; L29-F31 HydrophobicContact CD1-CZ 3.81Å; L29-F31 HydrophobicContact CD2-CE1 4.02Å; L29-F31 HydrophobicContact CG-CE1 3.96Å; L29-F31 HydrophobicContact CG-CZ 4.49Å; F31-I33 HydrophobicContact CD2-CG2 4.07Å; F31-I33 HydrophobicContact CE2-CG2 3.6Å; F31-L71 HydrophobicContact CE2-CD1 4.41Å; F31-L71 HydrophobicContact CZ-CD1 4.49Å; F31-L71 HydrophobicContact CZ-CD2 4.04Å; F31-L81 HydrophobicContact CE1-CD1 4.36Å; F31-L81 HydrophobicContact CZ-CD1 4.06Å
32	S	93.3	Very high	94.2	Very high	101 Å²	101	78.7 Å²	78.7	71%	0.706	47%	0.468	S	S	*	.			trans	-110.2	154.7	176.8	-61.9	0	0	0	0	111
33	I	93.2	Very high	93.9	Very high	53 Å²	53	78.8 Å²	78.8	27%	0.272	47%	0.474	S	S	.	.			trans	-118.2	149.8	176.3	61.1	173	0	0	0	110.7	F31 A67 R68 L71	F31-I33 HydrophobicContact CD2-CG2 4.07Å; F31-I33 HydrophobicContact CE2-CG2 3.6Å; I33-A67 HydrophobicContact CD1-CB 4.01Å; I33-R68 HydrophobicContact CD1-CB 4.33Å; I33-L71 HydrophobicContact CD1-CD1 3.95Å; I33-L71 HydrophobicContact CG2-CD1 3.7Å
34	G	93.3	Very high	93.6	Very high	36 Å²	36	74.8 Å²	74.8	37%	0.371	46%	0.457	S	S	.	.			trans	-127.4	162.8	169.5	0	0	0	0	0	110.8
35	G	93.3	Very high	93.1	Very high	23 Å²	23	76.5 Å²	76.5	24%	0.237	46%	0.456	C	S	.	.			trans	88.5	-165.6	179.4	0	0	0	0	0	114.5	Q39 H64	G35-Q39 WeakPolarHBondContact O-CG 3.39Å; G35-H64 WeakPolarHBondContact O-CB 3.47Å; G35-H64 PolarHBondContact O-ND1 2.89Å
36	G	94.3	Very high	92.6	Very high	31 Å²	31	74.7 Å²	74.7	32%	0.32	45%	0.446	S	S	.	.			trans	122.9	147	-166.4	0	0	0	0	0	110.1	D38 Q39 V62	G36-D38 PolarHBondContact O-N 2.89Å; G36-D38 VanDerWaalsContact O-N 3.14Å; G36-Q39 PolarHBondContact O-N 2.82Å; G36-Q39 VanDerWaalsContact O-N 3.1Å; G36-V62 CarbonylContact C-O 3.54Å; G36-V62 WeakPolarHBondContact CA-O 3.36Å
37	I	94.5	Very high	91.6	Very high	101 Å²	101	74.3 Å²	74.3	52%	0.518	45%	0.45	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.9	-16.3	-177.9	66.4	176.4	0	0	0	113.4	M61 V62 T63	I37-M61 HydrophobicContact CG2-CE 4.4Å; I37-M61 HydrophobicContact CG2-SD 4.22Å; I37-V62 PolarHBondContact N-O 3.03Å; I37-T63 HydrophobicContact CD1-CG2 4.46Å; I37-T63 HydrophobicContact CG1-CG2 4.14Å
38	D	96.6	Very high	90.6	Very high	81 Å²	81	79.8 Å²	79.8	43%	0.433	48%	0.475	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97.7	3.2	179.9	64.7	-43.6	0	0	0	113.1	G36 T63 H64	G36-D38 PolarHBondContact O-N 2.89Å; G36-D38 VanDerWaalsContact O-N 3.14Å; D38-T63 HydrophobicContact CB-CG2 4.13Å; D38-T63 WeakPolarHBondContact OD1-CA 3.39Å; D38-T63 WeakPolarHBondContact OD1-CB 3.38Å; D38-H64 PolarHBondContact OD1-N 2.83Å
39	Q	95.1	Very high	89.8	Confident	90 Å²	90	80.2 Å²	80.2	42%	0.421	48%	0.477	S	S	.	.	S	Bend	trans	-110	155.3	-178.8	-56.7	-60.7	-56.7	0	0	110.7	G35 G36 P41 H64	G35-Q39 WeakPolarHBondContact O-CG 3.39Å; G36-Q39 PolarHBondContact O-N 2.82Å; G36-Q39 VanDerWaalsContact O-N 3.1Å; Q39-P41 VanDerWaalsContact O-CD 3.27Å; Q39-P41 WeakPolarHBondContact O-CD 3.16Å; Q39-H64 HydrophobicContact CG-CB 3.81Å
40	D	93.3	Very high	89.2	Confident	89 Å²	89	85 Å²	85	48%	0.476	50%	0.497	S	S	.	.			trans	-71.8	117.8	169.6	179.7	-2	0	0	0	109.8	S42 Q43	D40-S42 PolarHBondContact O-N 2.8Å; D40-S42 VanDerWaalsContact O-N 3.16Å; D40-S42 VanDerWaalsContact OD1-CB 3.29Å; D40-S42 WeakPolarHBondContact OD1-CB 3.48Å; D40-S42 PolarHBondContact OD1-N 2.88Å; D40-S42 PolarHBondContact OD1-OG 3.04Å; D40-S42 VanDerWaalsContact OD1-OG 3.07Å; D40-S42 PolarHBondContact OD2-OG 3.33Å; D40-Q43 HydrophobicContact CB-CG 3.95Å; D40-Q43 PolarHBondContact O-N 2.74Å
41	P	91.2	Very high	88.7	Confident	109 Å²	109	83.7 Å²	83.7	71%	0.708	47%	0.474	S	S	*	.	G	3₁₀ helix	trans	-58.7	-26.6	178	-23.1	34.5	0	0	0	113.7	Q39 Q43 N44	Q39-P41 VanDerWaalsContact O-CD 3.27Å; Q39-P41 WeakPolarHBondContact O-CD 3.16Å; P41-Q43 PolarHBondContact O-N 2.87Å; P41-N44 PolarHBondContact O-N 3.26Å
42	S	90.9	Very high	88.3	Confident	85 Å²	85	81.9 Å²	81.9	59%	0.594	47%	0.467	S	S	*	.	G	3₁₀ helix	trans	-65.2	-21.5	178.4	85	0	0	0	0	112.9	D40	D40-S42 PolarHBondContact O-N 2.8Å; D40-S42 VanDerWaalsContact O-N 3.16Å; D40-S42 VanDerWaalsContact OD1-CB 3.29Å; D40-S42 WeakPolarHBondContact OD1-CB 3.48Å; D40-S42 PolarHBondContact OD1-N 2.88Å; D40-S42 PolarHBondContact OD1-OG 3.04Å; D40-S42 VanDerWaalsContact OD1-OG 3.07Å; D40-S42 PolarHBondContact OD2-OG 3.33Å
43	Q	90.1	Very high	88.1	Confident	148 Å²	148	81.2 Å²	81.2	69%	0.692	45%	0.452	S	S	*	.	G	3₁₀ helix	trans	-90.7	-1.4	-179.1	-58.7	-60.6	-63.7	0	0	113.1	D40 P41 P45	D40-Q43 HydrophobicContact CB-CG 3.95Å; D40-Q43 PolarHBondContact O-N 2.74Å; P41-Q43 PolarHBondContact O-N 2.87Å; Q43-P45 WeakPolarHBondContact O-CD 3.45Å
44	N	89.3	Confident	88.2	Confident	42 Å²	42	78.7 Å²	78.7	23%	0.225	44%	0.439	C	S	.	.			trans	-87.4	108.2	-179.6	-176.3	8.1	0	0	0	111.5	P41 F46	P41-N44 PolarHBondContact O-N 3.26Å; N44-F46 PolarHBondContact O-N 2.94Å; N44-F46 PolarHBondContact OD1-N 3.34Å
45	P	84.1	Confident	88.2	Confident	103 Å²	103	78.9 Å²	78.9	67%	0.669	43%	0.432	S	S	*	.	S	Bend	trans	-74.8	-9.9	178.3	32.6	-35.9	0	0	0	113.3	Q43	Q43-P45 WeakPolarHBondContact O-CD 3.45Å
46	F	81.1	Confident	88.2	Confident	123 Å²	123	80.8 Å²	80.8	54%	0.539	45%	0.451	S	S	.	.			trans	-114.3	53.8	-174.3	-53	-66.4	0	0	0	111.9	N44	N44-F46 PolarHBondContact O-N 2.94Å; N44-F46 PolarHBondContact OD1-N 3.34Å
47	S	73.1	Confident	88.1	Confident	76 Å²	76	87.4 Å²	87.4	53%	0.531	47%	0.467	S	S	.	.			trans	-82.3	-14.7	-173.9	60.8	0	0	0	0	114.9
48	E	74.8	Confident	88.1	Confident	137 Å²	137	86.3 Å²	86.3	64%	0.64	46%	0.462	S	S	*	.	S	Bend	trans	-82.3	-33.4	-175.5	-61.9	-170.3	172.2	0	0	113.9
49	D	78.6	Confident	87.9	Confident	66 Å²	66	83.7 Å²	83.7	35%	0.353	45%	0.447	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.7	120.8	176.4	-81.5	-3.2	0	0	0	108.8	T84 R85	D49-T84 WeakPolarHBondContact CA-O 3.45Å; D49-R85 WeakPolarHBondContact OD1-CA 3.41Å; D49-R85 VanDerWaalsContact OD1-CB 3.3Å; D49-R85 WeakPolarHBondContact OD1-CB 3.3Å; D49-R85 WeakPolarHBondContact OD1-CG 3.48Å; D49-R85 IonicContact OD1-NE 3.82Å; D49-R85 IonicContact OD2-CZ 3.19Å; D49-R85 VanDerWaalsContact OD2-CZ 3.27Å; D49-R85 IonicContact OD2-NE 3.03Å; D49-R85 PolarHBondContact OD2-NE 3.35Å; D49-R85 IonicContact OD2-NH2 2.85Å; D49-R85 PolarHBondContact OD2-NH2 3.19Å
50	K	84.2	Confident	87.7	Confident	133 Å²	133	83.3 Å²	83.3	58%	0.578	45%	0.451	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-116.5	133.4	-178.4	-67.8	-176.4	-179.3	178.1	0	110.6	V83 T84	K50-V83 CarbonylContact O-C 3.59Å; K50-V83 WeakPolarHBondContact O-CA 3.44Å; K50-T84 PolarHBondContact N-O 2.96Å; K50-T84 PolarHBondContact O-N 3.38Å
51	T	83.4	Confident	87.7	Confident	51 Å²	51	85.8 Å²	85.8	31%	0.313	46%	0.462	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.2	117.6	170.8	-59.2	0	0	0	0	109	V54 M59 L81 V83	T51-V54 HydrophobicContact CG2-CG2 3.86Å; T51-M59 HydrophobicContact CG2-CG 4.22Å; T51-M59 WeakPolarHBondContact O-CB 3.46Å; T51-L81 HydrophobicContact CG2-CD2 4.23Å; T51-V83 HydrophobicContact CG2-CG1 4.39Å
52	D	85.9	Confident	87.8	Confident	41 Å²	41	81.7 Å²	81.7	22%	0.219	44%	0.435	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.1	-39.1	-179	-56.6	-60.4	0	0	0	111.1	M59 L82 T84	D52-M59 PolarHBondContact O-N 2.88Å; D52-L82 PolarHBondContact N-O 3.27Å; D52-T84 PolarHBondContact OD2-N 2.82Å; D52-T84 PolarHBondContact OD2-OG1 2.85Å
53	K	90.9	Very high	88.1	Confident	88 Å²	88	79.4 Å²	79.4	38%	0.383	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142	147.8	178.6	-54.5	-172.9	179.1	-177.7	0	113.9	W57 L81 L82	K53-W57 CarbonylContact C-O 3.53Å; K53-W57 WeakPolarHBondContact CA-O 3.46Å; K53-W57 WeakPolarHBondContact CB-O 3.35Å; K53-L81 WeakPolarHBondContact O-CA 3.15Å; K53-L82 HydrophobicContact CB-CB 4.14Å; K53-L82 HydrophobicContact CB-CD1 4.18Å; K53-L82 HydrophobicContact CD-CD1 4Å; K53-L82 HydrophobicContact CG-CD1 4.31Å; K53-L82 PolarHBondContact N-O 3.22Å; K53-L82 PolarHBondContact O-N 3.37Å
54	V	93.8	Very high	88.4	Confident	0 Å²	0	75.1 Å²	75.1	0%	0	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.5	112.2	172.8	173.8	0	0	0	0	109.2	T51 G56 W57 M59 R70 L71 V79 L81	T51-V54 HydrophobicContact CG2-CG2 3.86Å; V54-G56 PolarHBondContact O-N 2.86Å; V54-W57 PolarHBondContact N-O 2.92Å; V54-W57 WeakPolarHBondContact O-CB 3.33Å; V54-W57 PolarHBondContact O-N 2.89Å; V54-M59 HydrophobicContact CB-CG 4.1Å; V54-M59 HydrophobicContact CB-SD 3.89Å; V54-M59 HydrophobicContact CG2-CE 3.86Å; V54-M59 HydrophobicContact CG2-CG 3.6Å; V54-M59 HydrophobicContact CG2-SD 3.58Å; V54-M59 VanDerWaalsContact CG2-SD 3.58Å; V54-R70 HydrophobicContact CB-CG 4.07Å; V54-R70 HydrophobicContact CG1-CG 3.76Å; V54-L71 HydrophobicContact CB-CD2 4.49Å; V54-L71 HydrophobicContact CG1-CD2 3.82Å; V54-L71 HydrophobicContact CG1-CG 4.36Å; V54-L71 HydrophobicContact CG2-CD2 3.73Å; V54-L71 HydrophobicContact CG2-CG 4.24Å; V54-V79 HydrophobicContact CG1-CG1 4.06Å; V54-L81 HydrophobicContact CB-CD2 4.39Å; V54-L81 HydrophobicContact CG1-CD2 4.41Å; V54-L81 HydrophobicContact CG2-CD2 3.62Å
55	N	93.4	Very high	88.8	Confident	40 Å²	40	75.8 Å²	75.8	21%	0.214	40%	0.401	C	S	.	.	T	Hydrogen-bonded Turn	trans	48.3	46.4	-178	-77.1	-17.3	0	0	0	111.7	W57 R70 E76 V78 R80	N55-W57 PolarHBondContact O-N 2.79Å; N55-R70 PolarHBondContact O-NH2 2.72Å; N55-E76 PolarHBondContact ND2-OE2 2.93Å; N55-V78 PolarHBondContact ND2-O 3Å; N55-V78 VanDerWaalsContact ND2-O 3.09Å; N55-R80 PolarHBondContact N-O 3.01Å; N55-R80 WeakPolarHBondContact OD1-CB 3.13Å; N55-R80 PolarHBondContact OD1-N 3.46Å
56	G	93.6	Very high	89.4	Confident	63 Å²	63	75.8 Å²	75.8	65%	0.649	39%	0.391	S	S	*	.	T	Hydrogen-bonded Turn	trans	79.6	-11.9	-179.4	0	0	0	0	0	115.8	V54	V54-G56 PolarHBondContact O-N 2.86Å
57	W	93	Very high	90.2	Very high	170 Å²	170	70.3 Å²	70.3	64%	0.644	37%	0.369	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77.9	134.3	175.6	-85.1	63.6	0	0	0	111.3	K53 V54 N55 R70	K53-W57 CarbonylContact C-O 3.53Å; K53-W57 WeakPolarHBondContact CA-O 3.46Å; K53-W57 WeakPolarHBondContact CB-O 3.35Å; V54-W57 PolarHBondContact N-O 2.92Å; V54-W57 WeakPolarHBondContact O-CB 3.33Å; V54-W57 PolarHBondContact O-N 2.89Å; N55-W57 PolarHBondContact O-N 2.79Å; W57-R70 HydrophobicContact CB-CG 4.36Å
58	D	93.8	Very high	91.3	Very high	77 Å²	77	71.9 Å²	71.9	41%	0.412	36%	0.363	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.3	132.8	175.1	-162.2	-62.2	0	0	0	110.9	T60 V62	D58-T60 VanDerWaalsContact OD1-CB 3.3Å; D58-T60 WeakPolarHBondContact OD1-CB 3.33Å; D58-T60 WeakPolarHBondContact OD1-CG2 3.37Å; D58-T60 PolarHBondContact OD1-N 2.93Å; D58-T60 PolarHBondContact OD1-OG1 2.92Å; D58-V62 WeakPolarHBondContact O-CG1 3.09Å
59	M	92.5	Very high	92.4	Very high	27 Å²	27	71.3 Å²	71.3	13%	0.133	36%	0.359	C	S	.	.			trans	-112.4	2.2	-177.6	-62.2	-68.8	-65	0	0	112.9	T51 D52 V54 V62 A67	T51-M59 HydrophobicContact CG2-CG 4.22Å; T51-M59 WeakPolarHBondContact O-CB 3.46Å; D52-M59 PolarHBondContact O-N 2.88Å; V54-M59 HydrophobicContact CB-CG 4.1Å; V54-M59 HydrophobicContact CB-SD 3.89Å; V54-M59 HydrophobicContact CG2-CE 3.86Å; V54-M59 HydrophobicContact CG2-CG 3.6Å; V54-M59 HydrophobicContact CG2-SD 3.58Å; V54-M59 VanDerWaalsContact CG2-SD 3.58Å; M59-V62 HydrophobicContact CE-CG2 4.22Å; M59-V62 WeakPolarHBondContact O-CG2 3.41Å; M59-V62 HydrophobicContact SD-CG2 4.44Å; M59-A67 HydrophobicContact CE-CB 3.29Å
60	T	90.4	Very high	93.2	Very high	82 Å²	82	70 Å²	70	50%	0.503	35%	0.349	S	S	.	.	T	Hydrogen-bonded Turn	trans	-73.6	-30.6	-173.6	63.5	0	0	0	0	112.8	D58	D58-T60 VanDerWaalsContact OD1-CB 3.3Å; D58-T60 WeakPolarHBondContact OD1-CB 3.33Å; D58-T60 WeakPolarHBondContact OD1-CG2 3.37Å; D58-T60 PolarHBondContact OD1-N 2.93Å; D58-T60 PolarHBondContact OD1-OG1 2.92Å
61	M	92.9	Very high	93.8	Very high	141 Å²	141	64 Å²	64	70%	0.695	32%	0.323	S	S	*	.	T	Hydrogen-bonded Turn	trans	-129	53	-174.7	-66.3	-64.4	-66.1	0	0	111.6	I37	I37-M61 HydrophobicContact CG2-CE 4.4Å; I37-M61 HydrophobicContact CG2-SD 4.22Å
62	V	94.9	Very high	94.4	Very high	23 Å²	23	64.7 Å²	64.7	14%	0.139	33%	0.328	C	S	.	.			trans	-122.5	154.7	179.3	-58.2	0	0	0	0	111.7	G36 I37 D58 M59 Q66 A67	G36-V62 CarbonylContact C-O 3.54Å; G36-V62 WeakPolarHBondContact CA-O 3.36Å; I37-V62 PolarHBondContact N-O 3.03Å; D58-V62 WeakPolarHBondContact O-CG1 3.09Å; M59-V62 HydrophobicContact CE-CG2 4.22Å; M59-V62 WeakPolarHBondContact O-CG2 3.41Å; M59-V62 HydrophobicContact SD-CG2 4.44Å; V62-Q66 HydrophobicContact CB-CB 4.03Å; V62-A67 HydrophobicContact CG2-CB 3.97Å
63	T	96.8	Very high	94.9	Very high	37 Å²	37	67.4 Å²	67.4	23%	0.227	34%	0.337	C	S	.	.			trans	-72.6	160.2	168.6	70.6	0	0	0	0	111.1	I37 D38 D65 Q66 A67	I37-T63 HydrophobicContact CD1-CG2 4.46Å; I37-T63 HydrophobicContact CG1-CG2 4.14Å; D38-T63 HydrophobicContact CB-CG2 4.13Å; D38-T63 WeakPolarHBondContact OD1-CA 3.39Å; D38-T63 WeakPolarHBondContact OD1-CB 3.38Å; T63-D65 VanDerWaalsContact C-N 3.27Å; T63-D65 PolarHBondContact O-N 3.31Å; T63-Q66 WeakPolarHBondContact O-CB 3.3Å; T63-Q66 PolarHBondContact O-N 2.6Å; T63-Q66 WeakPolarHBondContact OG1-CB 3.33Å; T63-Q66 VanDerWaalsContact OG1-CG 3.26Å; T63-Q66 WeakPolarHBondContact OG1-CG 3.42Å; T63-Q66 PolarHBondContact OG1-N 3.23Å; T63-A67 PolarHBondContact O-N 3.42Å
64	H	96.1	Very high	95	Very high	57 Å²	57	71.5 Å²	71.5	26%	0.264	35%	0.35	S	S	.	.	H	α-helix	trans	-55.3	-44.5	176	-172.3	86.2	0	0	0	111.8	G35 D38 Q39 A67 R68	G35-H64 WeakPolarHBondContact O-CB 3.47Å; G35-H64 PolarHBondContact O-ND1 2.89Å; D38-H64 PolarHBondContact OD1-N 2.83Å; Q39-H64 HydrophobicContact CG-CB 3.81Å; H64-A67 WeakPolarHBondContact O-CB 3.3Å; H64-A67 PolarHBondContact O-N 2.93Å; H64-R68 WeakPolarHBondContact O-CB 3.26Å; H64-R68 PolarHBondContact O-N 3.48Å
65	D	97.5	Very high	95.1	Very high	57 Å²	57	75.9 Å²	75.9	31%	0.305	38%	0.381	S	S	.	.	H	α-helix	trans	-69.6	-33.8	-179.9	-173.4	59	0	0	0	112.6	T63 R68 K69	T63-D65 VanDerWaalsContact C-N 3.27Å; T63-D65 PolarHBondContact O-N 3.31Å; D65-R68 PolarHBondContact O-N 3.33Å; D65-R68 IonicContact OD1-CZ 3.02Å; D65-R68 VanDerWaalsContact OD1-CZ 3.24Å; D65-R68 IonicContact OD1-NE 2.71Å; D65-R68 PolarHBondContact OD1-NE 3Å; D65-R68 IonicContact OD1-NH2 3.71Å; D65-R68 PolarHBondContact OD1-NH2 3.39Å; D65-K69 WeakPolarHBondContact O-CB 3.49Å; D65-K69 VanDerWaalsContact O-CG 3.3Å; D65-K69 WeakPolarHBondContact O-CG 3.42Å; D65-K69 PolarHBondContact O-N 2.66Å; D65-K69 WeakPolarHBondContact OD2-CD 3Å; D65-K69 WeakPolarHBondContact OD2-CE 3.41Å; D65-K69 IonicContact OD2-NZ 3.66Å; D65-K69 PolarHBondContact OD2-NZ 2.87Å
66	Q	97.6	Very high	95.2	Very high	102 Å²	102	75.7 Å²	75.7	48%	0.477	38%	0.379	S	S	.	.	H	α-helix	trans	-62.3	-46.4	172	-76.9	171.4	-17.9	0	0	111.1	V62 T63 K69 R70	V62-Q66 HydrophobicContact CB-CB 4.03Å; T63-Q66 WeakPolarHBondContact O-CB 3.3Å; T63-Q66 PolarHBondContact O-N 2.6Å; T63-Q66 WeakPolarHBondContact OG1-CB 3.33Å; T63-Q66 VanDerWaalsContact OG1-CG 3.26Å; T63-Q66 WeakPolarHBondContact OG1-CG 3.42Å; T63-Q66 PolarHBondContact OG1-N 3.23Å; Q66-K69 PolarHBondContact O-N 2.95Å; Q66-R70 WeakPolarHBondContact O-CB 3.35Å; Q66-R70 PolarHBondContact O-N 2.9Å
67	A	96.5	Very high	95.3	Very high	9 Å²	9	78 Å²	78	7%	0.074	37%	0.372	C	S	.	.	H	α-helix	trans	-58.4	-49.7	175.6	0	0	0	0	0	111.5	I33 M59 V62 T63 H64 K69 R70 L71	I33-A67 HydrophobicContact CD1-CB 4.01Å; M59-A67 HydrophobicContact CE-CB 3.29Å; V62-A67 HydrophobicContact CG2-CB 3.97Å; T63-A67 PolarHBondContact O-N 3.42Å; H64-A67 WeakPolarHBondContact O-CB 3.3Å; H64-A67 PolarHBondContact O-N 2.93Å; A67-K69 PolarHBondContact O-N 3.45Å; A67-R70 PolarHBondContact O-N 3.2Å; A67-L71 WeakPolarHBondContact O-CG 3.19Å; A67-L71 PolarHBondContact O-N 3.48Å
68	R	97.2	Very high	95.5	Very high	109 Å²	109	71.4 Å²	71.4	41%	0.411	35%	0.351	S	S	.	.	H	α-helix	trans	-56.9	-50.3	177.1	-174	-165.3	68.2	82.3	-2.7	111.7	I33 H64 D65 R70 L71 T72	I33-R68 HydrophobicContact CD1-CB 4.33Å; H64-R68 WeakPolarHBondContact O-CB 3.26Å; H64-R68 PolarHBondContact O-N 3.48Å; D65-R68 PolarHBondContact O-N 3.33Å; D65-R68 IonicContact OD1-CZ 3.02Å; D65-R68 VanDerWaalsContact OD1-CZ 3.24Å; D65-R68 IonicContact OD1-NE 2.71Å; D65-R68 PolarHBondContact OD1-NE 3Å; D65-R68 IonicContact OD1-NH2 3.71Å; D65-R68 PolarHBondContact OD1-NH2 3.39Å; R68-R70 VanDerWaalsContact C-N 3.32Å; R68-R70 PolarHBondContact O-N 2.66Å; R68-L71 PolarHBondContact O-N 2.78Å; R68-T72 HydrophobicContact CG-CG2 4.49Å; R68-T72 WeakPolarHBondContact O-CB 3.42Å; R68-T72 WeakPolarHBondContact O-CG2 3.41Å; R68-T72 PolarHBondContact O-N 3.19Å; R68-T72 PolarHBondContact O-OG1 2.81Å
69	K	97.2	Very high	95.7	Very high	125 Å²	125	67.7 Å²	67.7	54%	0.543	33%	0.331	S	S	.	.	H	α-helix	trans	-59.1	-41.9	177.9	-79.6	170.5	170.8	158.3	0	111.8	D65 Q66 A67 T72 K73	D65-K69 WeakPolarHBondContact O-CB 3.49Å; D65-K69 VanDerWaalsContact O-CG 3.3Å; D65-K69 WeakPolarHBondContact O-CG 3.42Å; D65-K69 PolarHBondContact O-N 2.66Å; D65-K69 WeakPolarHBondContact OD2-CD 3Å; D65-K69 WeakPolarHBondContact OD2-CE 3.41Å; D65-K69 IonicContact OD2-NZ 3.66Å; D65-K69 PolarHBondContact OD2-NZ 2.87Å; Q66-K69 PolarHBondContact O-N 2.95Å; A67-K69 PolarHBondContact O-N 3.45Å; K69-T72 PolarHBondContact O-N 2.82Å; K69-K73 PolarHBondContact O-N 3.31Å
70	R	96.8	Very high	95.9	Very high	37 Å²	37	70.8 Å²	70.8	14%	0.14	34%	0.342	C	S	.	.	H	α-helix	trans	-63.6	-42.5	179.1	-171.9	69.2	-169	90.6	-10.2	112.1	V54 N55 W57 Q66 A67 R68 E76	V54-R70 HydrophobicContact CB-CG 4.07Å; V54-R70 HydrophobicContact CG1-CG 3.76Å; N55-R70 PolarHBondContact O-NH2 2.72Å; W57-R70 HydrophobicContact CB-CG 4.36Å; Q66-R70 WeakPolarHBondContact O-CB 3.35Å; Q66-R70 PolarHBondContact O-N 2.9Å; A67-R70 PolarHBondContact O-N 3.2Å; R68-R70 VanDerWaalsContact C-N 3.32Å; R68-R70 PolarHBondContact O-N 2.66Å; R70-E76 IonicContact CZ-OE1 2.82Å; R70-E76 IonicContact CZ-OE2 2.9Å; R70-E76 VanDerWaalsContact NH1-CD 3.33Å; R70-E76 IonicContact NH1-OE1 2.72Å; R70-E76 PolarHBondContact NH1-OE1 3.44Å; R70-E76 IonicContact NH1-OE2 3.24Å; R70-E76 PolarHBondContact NH1-OE2 2.87Å; R70-E76 IonicContact NH2-OE1 3.55Å; R70-E76 IonicContact NH2-OE2 2.66Å
71	L	96.2	Very high	96.2	Very high	8 Å²	8	67.5 Å²	67.5	4%	0.042	32%	0.321	C	S	.	.	H	α-helix	trans	-72.4	-35	179.5	-74.7	166.4	0	0	0	112.9	K20 L29 F31 I33 V54 A67 R68 V79 L81	K20-L71 WeakPolarHBondContact CE-O 3.36Å; K20-L71 PolarHBondContact NZ-O 2.68Å; L29-L71 HydrophobicContact CD1-CB 3.78Å; L29-L71 HydrophobicContact CD1-CD2 4.05Å; L29-L71 HydrophobicContact CD1-CG 4.44Å; F31-L71 HydrophobicContact CE2-CD1 4.41Å; F31-L71 HydrophobicContact CZ-CD1 4.49Å; F31-L71 HydrophobicContact CZ-CD2 4.04Å; I33-L71 HydrophobicContact CD1-CD1 3.95Å; I33-L71 HydrophobicContact CG2-CD1 3.7Å; V54-L71 HydrophobicContact CB-CD2 4.49Å; V54-L71 HydrophobicContact CG1-CD2 3.82Å; V54-L71 HydrophobicContact CG1-CG 4.36Å; V54-L71 HydrophobicContact CG2-CD2 3.73Å; V54-L71 HydrophobicContact CG2-CG 4.24Å; A67-L71 WeakPolarHBondContact O-CG 3.19Å; A67-L71 PolarHBondContact O-N 3.48Å; R68-L71 PolarHBondContact O-N 2.78Å; L71-V79 HydrophobicContact CD2-CG1 3.88Å; L71-L81 HydrophobicContact CD2-CD2 3.87Å
72	T	96	Very high	96.3	Very high	66 Å²	66	63.5 Å²	63.5	41%	0.405	30%	0.302	S	S	.	.	T	Hydrogen-bonded Turn	trans	-96.4	10.3	-173.3	57.3	0	0	0	0	114.4	R68 K69 R74	R68-T72 HydrophobicContact CG-CG2 4.49Å; R68-T72 WeakPolarHBondContact O-CB 3.42Å; R68-T72 WeakPolarHBondContact O-CG2 3.41Å; R68-T72 PolarHBondContact O-N 3.19Å; R68-T72 PolarHBondContact O-OG1 2.81Å; K69-T72 PolarHBondContact O-N 2.82Å; T72-R74 PolarHBondContact O-N 3.33Å; T72-R74 VanDerWaalsContact O-N 3.15Å
73	K	95.9	Very high	96.2	Very high	98 Å²	98	63.1 Å²	63.1	43%	0.426	30%	0.299	S	S	.	.			trans	-57.3	120.4	179.2	-165.7	175.6	172.9	-163	0	111.4	K20 K69 S75 E76	K20-K73 PolarHBondContact NZ-O 2.91Å; K69-K73 PolarHBondContact O-N 3.31Å; K73-S75 VanDerWaalsContact C-N 3.29Å; K73-S75 WeakPolarHBondContact CE-OG 3.5Å; K73-S75 PolarHBondContact O-N 3.18Å; K73-E76 HydrophobicContact CD-CG 4.19Å; K73-E76 WeakPolarHBondContact CD-OE1 3.42Å; K73-E76 IonicContact NZ-OE1 3.27Å; K73-E76 PolarHBondContact NZ-OE1 3.43Å; K73-E76 PolarHBondContact O-N 2.79Å
74	R	93.9	Very high	95.8	Very high	174 Å²	174	62.5 Å²	62.5	66%	0.657	30%	0.296	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.1	-27.8	-172.9	-71.7	-176.1	173.6	-176.6	-6.2	113.9	L27 T72 E76	L27-R74 WeakPolarHBondContact CD1-O 3.38Å; T72-R74 PolarHBondContact O-N 3.33Å; T72-R74 VanDerWaalsContact O-N 3.15Å; R74-E76 PolarHBondContact O-N 3.05Å
75	S	95.2	Very high	95.4	Very high	92 Å²	92	63.9 Å²	63.9	64%	0.643	30%	0.299	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77.3	-6.8	178.1	68.1	0	0	0	0	113.7	K73	K73-S75 VanDerWaalsContact C-N 3.29Å; K73-S75 WeakPolarHBondContact CE-OG 3.5Å; K73-S75 PolarHBondContact O-N 3.18Å
76	E	95.5	Very high	94.7	Very high	35 Å²	35	65.3 Å²	65.3	16%	0.164	30%	0.304	C	S	.	.			trans	-115.1	97.6	-177.1	-67.4	179.7	-162.5	0	0	108.8	K20 N55 R70 K73 R74 V78	K20-E76 WeakPolarHBondContact CD-O 3.34Å; K20-E76 WeakPolarHBondContact CE-O 3.47Å; K20-E76 PolarHBondContact NZ-O 3.12Å; N55-E76 PolarHBondContact ND2-OE2 2.93Å; R70-E76 IonicContact CZ-OE1 2.82Å; R70-E76 IonicContact CZ-OE2 2.9Å; R70-E76 VanDerWaalsContact NH1-CD 3.33Å; R70-E76 IonicContact NH1-OE1 2.72Å; R70-E76 PolarHBondContact NH1-OE1 3.44Å; R70-E76 IonicContact NH1-OE2 3.24Å; R70-E76 PolarHBondContact NH1-OE2 2.87Å; R70-E76 IonicContact NH2-OE1 3.55Å; R70-E76 IonicContact NH2-OE2 2.66Å; K73-E76 HydrophobicContact CD-CG 4.19Å; K73-E76 WeakPolarHBondContact CD-OE1 3.42Å; K73-E76 IonicContact NZ-OE1 3.27Å; K73-E76 PolarHBondContact NZ-OE1 3.43Å; K73-E76 PolarHBondContact O-N 2.79Å; R74-E76 PolarHBondContact O-N 3.05Å; E76-V78 VanDerWaalsContact C-N 3.27Å
77	E	96.4	Very high	94.2	Very high	111 Å²	111	64.1 Å²	64.1	52%	0.519	31%	0.307	S	S	.	.	S	Bend	trans	-73.2	-22.2	175.3	-61	-161.9	150.8	0	0	112.3	K20 R22 L27	K20-E77 WeakPolarHBondContact CB-O 3.48Å; K20-E77 WeakPolarHBondContact CG-O 3.35Å; K20-E77 PolarHBondContact N-O 3.18Å; R22-E77 IonicContact NH2-OE1 3.64Å; R22-E77 PolarHBondContact NH2-OE1 3.29Å; L27-E77 HydrophobicContact CD1-CG 3.94Å
78	V	97.1	Very high	93.7	Very high	32 Å²	32	66.1 Å²	66.1	19%	0.194	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.4	132.4	178.3	-178	0	0	0	0	110.5	E17 I18 N55 E76 R80	E17-V78 HydrophobicContact CG-CG1 3.57Å; I18-V78 WeakPolarHBondContact O-CA 3.14Å; N55-V78 PolarHBondContact ND2-O 3Å; N55-V78 VanDerWaalsContact ND2-O 3.09Å; E76-V78 VanDerWaalsContact C-N 3.27Å; V78-R80 HydrophobicContact CG1-CG 4.37Å
79	V	97.2	Very high	93.1	Very high	0 Å²	0	64.5 Å²	64.5	0%	0	31%	0.313	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.3	123.3	174.7	169.1	0	0	0	0	109.4	I18 K20 L29 V54 L71 L81	I18-V79 PolarHBondContact N-O 3.48Å; I18-V79 PolarHBondContact O-N 3.4Å; K20-V79 VanDerWaalsContact CE-CG2 3.44Å; L29-V79 HydrophobicContact CD2-CB 3.93Å; L29-V79 HydrophobicContact CD2-CG1 4.45Å; L29-V79 HydrophobicContact CD2-CG2 3.94Å; V54-V79 HydrophobicContact CG1-CG1 4.06Å; L71-V79 HydrophobicContact CD2-CG1 3.88Å; V79-L81 HydrophobicContact CG1-CD2 3.47Å; V79-L81 VanDerWaalsContact CG1-CD2 3.47Å; V79-L81 HydrophobicContact CG1-CG 4.04Å
80	R	97.4	Very high	92.5	Very high	92 Å²	92	64.1 Å²	64.1	35%	0.347	31%	0.311	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	114.3	176.2	-62.4	-179.7	174.2	87.1	11	109.3	V16 E17 N55 V78	V16-R80 CarbonylContact O-C 3.59Å; V16-R80 WeakPolarHBondContact O-CA 3.4Å; E17-R80 HydrophobicContact CB-CG 4.45Å; E17-R80 VanDerWaalsContact CD-NH2 3.32Å; E17-R80 HydrophobicContact CG-CG 4.1Å; E17-R80 IonicContact OE1-CZ 3.59Å; E17-R80 IonicContact OE1-NE 3.71Å; E17-R80 IonicContact OE1-NH2 2.81Å; E17-R80 PolarHBondContact OE1-NH2 3.3Å; E17-R80 IonicContact OE2-CZ 3.39Å; E17-R80 IonicContact OE2-NE 2.72Å; E17-R80 PolarHBondContact OE2-NE 3.35Å; E17-R80 IonicContact OE2-NH2 3.26Å; E17-R80 PolarHBondContact OE2-NH2 3Å; N55-R80 PolarHBondContact N-O 3.01Å; N55-R80 WeakPolarHBondContact OD1-CB 3.13Å; N55-R80 PolarHBondContact OD1-N 3.46Å; V78-R80 HydrophobicContact CG1-CG 4.37Å
81	L	96.1	Very high	92	Very high	12 Å²	12	64.7 Å²	64.7	6%	0.063	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.5	140.8	178.4	-51.3	178.6	0	0	0	109.6	R15 V16 I18 F31 T51 K53 V54 L71 V79 V83	R15-L81 CarbonylContact C-O 3.55Å; R15-L81 WeakPolarHBondContact CA-O 3.42Å; V16-L81 HydrophobicContact CB-CB 4.34Å; V16-L81 PolarHBondContact N-O 3.03Å; V16-L81 PolarHBondContact O-N 3.03Å; I18-L81 HydrophobicContact CD1-CD1 3.74Å; I18-L81 HydrophobicContact CD1-CG 4.44Å; F31-L81 HydrophobicContact CE1-CD1 4.36Å; F31-L81 HydrophobicContact CZ-CD1 4.06Å; T51-L81 HydrophobicContact CG2-CD2 4.23Å; K53-L81 WeakPolarHBondContact O-CA 3.15Å; V54-L81 HydrophobicContact CB-CD2 4.39Å; V54-L81 HydrophobicContact CG1-CD2 4.41Å; V54-L81 HydrophobicContact CG2-CD2 3.62Å; L71-L81 HydrophobicContact CD2-CD2 3.87Å; V79-L81 HydrophobicContact CG1-CD2 3.47Å; V79-L81 VanDerWaalsContact CG1-CD2 3.47Å; V79-L81 HydrophobicContact CG1-CG 4.04Å; L81-V83 HydrophobicContact CB-CG1 3.87Å; L81-V83 HydrophobicContact CD1-CG1 4.47Å
82	L	94.3	Very high	91.5	Very high	58 Å²	58	67.2 Å²	67.2	30%	0.304	34%	0.339	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.4	119.6	155	-83.7	161.6	0	0	0	106.9	V13 Q14 R15 D52 K53	V13-L82 HydrophobicContact CB-CD2 4.06Å; V13-L82 HydrophobicContact CG2-CD2 3.82Å; Q14-L82 WeakPolarHBondContact O-CA 3.42Å; R15-L82 HydrophobicContact CB-CD2 4.33Å; D52-L82 PolarHBondContact N-O 3.27Å; K53-L82 HydrophobicContact CB-CB 4.14Å; K53-L82 HydrophobicContact CB-CD1 4.18Å; K53-L82 HydrophobicContact CD-CD1 4Å; K53-L82 HydrophobicContact CG-CD1 4.31Å; K53-L82 PolarHBondContact N-O 3.22Å; K53-L82 PolarHBondContact O-N 3.37Å
83	V	92.5	Very high	90.9	Very high	14 Å²	14	69.8 Å²	69.8	9%	0.085	35%	0.347	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125	131.6	-177.4	-58.5	0	0	0	0	111	V13 Q14 V16 K50 T51 L81 R85	V13-V83 CarbonylContact C-O 3.47Å; V13-V83 WeakPolarHBondContact CA-O 3.45Å; Q14-V83 HydrophobicContact CB-CG2 3.88Å; Q14-V83 PolarHBondContact N-O 3.11Å; Q14-V83 PolarHBondContact O-N 3.19Å; V16-V83 HydrophobicContact CG2-CG2 4.05Å; K50-V83 CarbonylContact O-C 3.59Å; K50-V83 WeakPolarHBondContact O-CA 3.44Å; T51-V83 HydrophobicContact CG2-CG1 4.39Å; L81-V83 HydrophobicContact CB-CG1 3.87Å; L81-V83 HydrophobicContact CD1-CG1 4.47Å; V83-R85 HydrophobicContact CG2-CG 4.09Å
84	T	89.8	Confident	90.5	Very high	24 Å²	24	71.8 Å²	71.8	15%	0.147	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.3	131.1	167.3	-64	0	0	0	0	108.8	A11 D49 K50 D52	A11-T84 HydrophobicContact CB-CG2 4.02Å; D49-T84 WeakPolarHBondContact CA-O 3.45Å; K50-T84 PolarHBondContact N-O 2.96Å; K50-T84 PolarHBondContact O-N 3.38Å; D52-T84 PolarHBondContact OD2-N 2.82Å; D52-T84 PolarHBondContact OD2-OG1 2.85Å
85	R	86.8	Confident	90.2	Very high	87 Å²	87	66.8 Å²	66.8	33%	0.328	35%	0.349	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.1	129.8	178.2	-48.4	-174.2	104	166.9	7.1	110	D49 V83 S87 L88 Q89	D49-R85 WeakPolarHBondContact OD1-CA 3.41Å; D49-R85 VanDerWaalsContact OD1-CB 3.3Å; D49-R85 WeakPolarHBondContact OD1-CB 3.3Å; D49-R85 WeakPolarHBondContact OD1-CG 3.48Å; D49-R85 IonicContact OD1-NE 3.82Å; D49-R85 IonicContact OD2-CZ 3.19Å; D49-R85 VanDerWaalsContact OD2-CZ 3.27Å; D49-R85 IonicContact OD2-NE 3.03Å; D49-R85 PolarHBondContact OD2-NE 3.35Å; D49-R85 IonicContact OD2-NH2 2.85Å; D49-R85 PolarHBondContact OD2-NH2 3.19Å; V83-R85 HydrophobicContact CG2-CG 4.09Å; R85-S87 PolarHBondContact O-N 3.21Å; R85-L88 HydrophobicContact CB-CB 4.32Å; R85-L88 HydrophobicContact CB-CD1 3.92Å; R85-L88 HydrophobicContact CB-CG 4.04Å; R85-L88 HydrophobicContact CG-CD1 3.97Å; R85-L88 PolarHBondContact O-N 3.17Å; R85-L88 VanDerWaalsContact O-N 3.11Å; R85-Q89 PolarHBondContact O-N 3.38Å
86	Q	83.6	Confident	89.5	Confident	87 Å²	87	69.8 Å²	69.8	41%	0.407	36%	0.355	S	S	.	.	H	α-helix	trans	-62.4	-33.6	-177.5	-161.3	-176.4	27.6	0	0	112.4	Q89 K90	Q86-Q89 PolarHBondContact O-N 3.14Å; Q86-K90 WeakPolarHBondContact O-CG 3.47Å; Q86-K90 PolarHBondContact O-N 3.1Å; Q86-K90 VanDerWaalsContact O-N 3.14Å
87	S	86.3	Confident	88.7	Confident	77 Å²	77	75.2 Å²	75.2	54%	0.538	38%	0.384	S	S	.	.	H	α-helix	trans	-61.9	-40.5	175.5	54.9	0	0	0	0	112.5	R85 K90 A91	R85-S87 PolarHBondContact O-N 3.21Å; S87-K90 PolarHBondContact O-N 3.46Å; S87-A91 PolarHBondContact O-N 3.45Å
88	L	86.4	Confident	87.1	Confident	50 Å²	50	76.9 Å²	76.9	26%	0.262	41%	0.408	S	S	.	.	H	α-helix	trans	-68.8	-37.1	177.9	-69.1	174.6	0	0	0	112.2	V12 Q14 R85 K90 A91 V92	V12-L88 HydrophobicContact CB-CB 4.4Å; V12-L88 HydrophobicContact CG1-CB 3.86Å; Q14-L88 HydrophobicContact CB-CD1 3.57Å; Q14-L88 HydrophobicContact CG-CD1 4.29Å; R85-L88 HydrophobicContact CB-CB 4.32Å; R85-L88 HydrophobicContact CB-CD1 3.92Å; R85-L88 HydrophobicContact CB-CG 4.04Å; R85-L88 HydrophobicContact CG-CD1 3.97Å; R85-L88 PolarHBondContact O-N 3.17Å; R85-L88 VanDerWaalsContact O-N 3.11Å; L88-K90 VanDerWaalsContact C-N 3.34Å; L88-A91 PolarHBondContact O-N 3.16Å; L88-V92 WeakPolarHBondContact O-CG2 3.36Å; L88-V92 PolarHBondContact O-N 2.97Å
89	Q	84	Confident	86.6	Confident	76 Å²	76	79.2 Å²	79.2	36%	0.355	42%	0.419	S	S	.	.	H	α-helix	trans	-62.1	-44.1	175.1	-167.6	172.7	15.5	0	0	111.4	R85 Q86 V92 Q93	R85-Q89 PolarHBondContact O-N 3.38Å; Q86-Q89 PolarHBondContact O-N 3.14Å; Q89-V92 PolarHBondContact O-N 3.31Å; Q89-Q93 WeakPolarHBondContact O-CB 3.37Å; Q89-Q93 PolarHBondContact O-N 3.3Å
90	K	85.7	Confident	86.1	Confident	117 Å²	117	83.3 Å²	83.3	51%	0.509	44%	0.441	S	S	.	.	H	α-helix	trans	-61.6	-43.7	174.7	-70.1	174.6	-178	172.5	0	111.7	Q86 S87 L88 Q93 Q94	Q86-K90 WeakPolarHBondContact O-CG 3.47Å; Q86-K90 PolarHBondContact O-N 3.1Å; Q86-K90 VanDerWaalsContact O-N 3.14Å; S87-K90 PolarHBondContact O-N 3.46Å; L88-K90 VanDerWaalsContact C-N 3.34Å; K90-Q93 PolarHBondContact O-N 2.9Å; K90-Q94 WeakPolarHBondContact O-CG 3.5Å; K90-Q94 PolarHBondContact O-N 3.25Å
91	A	86.6	Confident	85.4	Confident	49 Å²	49	82.8 Å²	82.8	41%	0.405	45%	0.446	S	S	.	.	H	α-helix	trans	-61.7	-44.1	179.8	0	0	0	0	0	112.5	S87 L88 Q94 S95	S87-A91 PolarHBondContact O-N 3.45Å; L88-A91 PolarHBondContact O-N 3.16Å; A91-Q94 PolarHBondContact O-N 3.28Å; A91-S95 PolarHBondContact O-N 3.16Å
92	V	85.3	Confident	84.8	Confident	61 Å²	61	87 Å²	87	37%	0.37	47%	0.469	S	S	.	.	H	α-helix	trans	-67.6	-38.8	176.9	173.3	0	0	0	0	111.6	V12 L88 Q89 Q94 S95 M96	V12-V92 HydrophobicContact CB-CG2 4.41Å; V12-V92 HydrophobicContact CG1-CG2 3.81Å; V12-V92 HydrophobicContact CG2-CB 3.85Å; V12-V92 HydrophobicContact CG2-CG1 4.14Å; V12-V92 HydrophobicContact CG2-CG2 3.74Å; L88-V92 WeakPolarHBondContact O-CG2 3.36Å; L88-V92 PolarHBondContact O-N 2.97Å; Q89-V92 PolarHBondContact O-N 3.31Å; V92-Q94 VanDerWaalsContact C-N 3.29Å; V92-Q94 PolarHBondContact O-N 3.14Å; V92-S95 WeakPolarHBondContact CA-OG 3.17Å; V92-S95 PolarHBondContact O-N 3.26Å; V92-S95 PolarHBondContact O-OG 2.95Å; V92-M96 HydrophobicContact CG1-CG 4.4Å; V92-M96 WeakPolarHBondContact O-CG 3.27Å; V92-M96 PolarHBondContact O-N 3.41Å; V92-M96 VanDerWaalsContact O-N 3.12Å
93	Q	83.4	Confident	84.2	Confident	120 Å²	120	88.8 Å²	88.8	56%	0.561	48%	0.479	S	S	*	.	H	α-helix	trans	-63.1	-39	176.6	-169.4	175	6.1	0	0	111.5	Q89 K90 M96 L97	Q89-Q93 WeakPolarHBondContact O-CB 3.37Å; Q89-Q93 PolarHBondContact O-N 3.3Å; K90-Q93 PolarHBondContact O-N 2.9Å; Q93-M96 PolarHBondContact O-N 3.07Å; Q93-L97 WeakPolarHBondContact O-CG 3.29Å
94	Q	86.4	Confident	83.7	Confident	139 Å²	139	93.8 Å²	93.8	65%	0.65	51%	0.506	S	S	*	.	H	α-helix	trans	-66	-42.2	174.7	-74	174.2	-14.4	0	0	112.1	K90 A91 V92 M96 L97 S98	K90-Q94 WeakPolarHBondContact O-CG 3.5Å; K90-Q94 PolarHBondContact O-N 3.25Å; A91-Q94 PolarHBondContact O-N 3.28Å; V92-Q94 VanDerWaalsContact C-N 3.29Å; V92-Q94 PolarHBondContact O-N 3.14Å; Q94-M96 PolarHBondContact O-N 3.26Å; Q94-L97 PolarHBondContact O-N 3.07Å; Q94-L97 VanDerWaalsContact O-N 3.16Å; Q94-S98 PolarHBondContact O-N 2.71Å
95	S	88	Confident	83.2	Confident	69 Å²	69	98.8 Å²	98.8	48%	0.483	53%	0.531	S	S	.	.	H	α-helix	trans	-67.9	-20.1	178.6	66.3	0	0	0	0	114	A91 V92 S98	A91-S95 PolarHBondContact O-N 3.16Å; V92-S95 WeakPolarHBondContact CA-OG 3.17Å; V92-S95 PolarHBondContact O-N 3.26Å; V92-S95 PolarHBondContact O-OG 2.95Å; S95-S98 PolarHBondContact O-OG 2.86Å; S95-S98 VanDerWaalsContact O-OG 3.05Å
96	M	81.8	Confident	83	Confident	155 Å²	155	99.7 Å²	99.7	76%	0.764	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.8	-14.9	176.3	-66.4	-90.8	-79.7	0	0	112.6	V92 Q93 Q94	V92-M96 HydrophobicContact CG1-CG 4.4Å; V92-M96 WeakPolarHBondContact O-CG 3.27Å; V92-M96 PolarHBondContact O-N 3.41Å; V92-M96 VanDerWaalsContact O-N 3.12Å; Q93-M96 PolarHBondContact O-N 3.07Å; Q94-M96 PolarHBondContact O-N 3.26Å
97	L	77.7	Confident	82.9	Confident	149 Å²	149	100.8 Å²	100.8	78%	0.78	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.3	-8.2	179.4	-69.3	167.1	0	0	0	112.9	Q93 Q94	Q93-L97 WeakPolarHBondContact O-CG 3.29Å; Q94-L97 PolarHBondContact O-N 3.07Å; Q94-L97 VanDerWaalsContact O-N 3.16Å
98	S	63.2	Low	82.6	Confident	147 Å²	147	102.9 Å²	102.9	100%	1.028	56%	0.56	S	S	*	*			trans	-94.4	0	174	62	0	0	0	0	111.5	Q94 S95	Q94-S98 PolarHBondContact O-N 2.71Å; S95-S98 PolarHBondContact O-OG 2.86Å; S95-S98 VanDerWaalsContact O-OG 3.05Å

Retrieved 98 of 98 residues in 26 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).