A0A087X2B4_HUMAN Loading...

Intraflagellar transport 20

AlphaFold DB , UniProt , Accession A0A087X2B4, Species HUMAN (Homo sapiens, Human), Gene IFT20, Length 74 aa.

						>A0A087X2B4_HUMAN|A0A087X2B4|IFT20
MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKVSG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.6	Low	75	Confident	187 Å²	187	95.3 Å²	95.3	92%	0.921	55%	0.546	S	S	*	.				0	-77	0	-67.9	-154.7	-84.1	0	0	111.8	K3 D4 I5	M1-K3 PolarHBondContact O-N 3.43Å; M1-D4 PolarHBondContact N-OD2 3.41Å; M1-D4 PolarHBondContact O-N 3.26Å; M1-I5 WeakPolarHBondContact O-CG1 3.46Å; M1-I5 PolarHBondContact O-N 3.36Å
2	A	63.1	Low	75.9	Confident	71 Å²	71	91.8 Å²	91.8	59%	0.587	52%	0.521	S	S	*	.	H	α-helix	trans	-66.4	-38.6	-178.3	0	0	0	0	0	114	D4 L6	A2-D4 VanDerWaalsContact C-N 3.32Å; A2-D4 PolarHBondContact O-N 3.32Å; A2-L6 VanDerWaalsContact O-CG 3.28Å; A2-L6 WeakPolarHBondContact O-CG 3.45Å; A2-L6 PolarHBondContact O-N 3.33Å
3	K	62.2	Low	76.7	Confident	165 Å²	165	91.2 Å²	91.2	72%	0.717	51%	0.509	S	S	*	.	H	α-helix	trans	-66.4	-32.7	178.2	-160.9	175.6	179.9	179.4	0	112.7	M1 G7	M1-K3 PolarHBondContact O-N 3.43Å; K3-G7 PolarHBondContact O-N 3.42Å; K3-G7 VanDerWaalsContact O-N 3.08Å
4	D	70.4	Confident	77.2	Confident	102 Å²	102	86.1 Å²	86.1	55%	0.545	48%	0.481	S	S	.	.	H	α-helix	trans	-73.8	-42.6	179	-51.9	-50.5	0	0	0	111.3	M1 A2 L6 G7 E8	M1-D4 PolarHBondContact N-OD2 3.41Å; M1-D4 PolarHBondContact O-N 3.26Å; A2-D4 VanDerWaalsContact C-N 3.32Å; A2-D4 PolarHBondContact O-N 3.32Å; D4-L6 VanDerWaalsContact C-N 3.32Å; D4-L6 PolarHBondContact O-N 3.21Å; D4-G7 PolarHBondContact O-N 3.02Å; D4-E8 WeakPolarHBondContact O-CG 3.5Å; D4-E8 PolarHBondContact O-N 3.37Å
5	I	79.9	Confident	77.7	Confident	111 Å²	111	93.5 Å²	93.5	57%	0.569	51%	0.51	S	S	*	.	H	α-helix	trans	-62.6	-39.6	176.8	-63.7	164.2	0	0	0	111.4	M1 A9	M1-I5 WeakPolarHBondContact O-CG1 3.46Å; M1-I5 PolarHBondContact O-N 3.36Å; I5-A9 PolarHBondContact O-N 3.33Å; I5-A9 VanDerWaalsContact O-N 3.16Å
6	L	79.1	Confident	78.3	Confident	53 Å²	53	95.4 Å²	95.4	28%	0.277	52%	0.518	S	S	.	.	H	α-helix	trans	-69.4	-40.2	177.5	-66.5	173.1	0	0	0	111.2	A2 D4 A9 G10 L11 F13	A2-L6 VanDerWaalsContact O-CG 3.28Å; A2-L6 WeakPolarHBondContact O-CG 3.45Å; A2-L6 PolarHBondContact O-N 3.33Å; D4-L6 VanDerWaalsContact C-N 3.32Å; D4-L6 PolarHBondContact O-N 3.21Å; L6-A9 PolarHBondContact O-N 3.05Å; L6-G10 PolarHBondContact O-N 2.96Å; L6-L11 CarbonylContact C-O 3.51Å; L6-L11 HydrophobicContact CB-CB 4.24Å; L6-L11 HydrophobicContact CD2-CD1 3.79Å; L6-L11 WeakPolarHBondContact O-CA 3.43Å; L6-L11 WeakPolarHBondContact O-CB 3.44Å; L6-L11 PolarHBondContact O-N 3.47Å; L6-F13 HydrophobicContact CB-CE2 4.5Å; L6-F13 HydrophobicContact CD1-CE2 3.56Å; L6-F13 HydrophobicContact CD1-CZ 3.67Å
7	G	77.2	Confident	78.6	Confident	42 Å²	42	97.6 Å²	97.6	43%	0.433	53%	0.53	S	S	.	.	H	α-helix	trans	-61.4	-42.6	173.1	0	0	0	0	0	113	K3 D4 A9 G10	K3-G7 PolarHBondContact O-N 3.42Å; K3-G7 VanDerWaalsContact O-N 3.08Å; D4-G7 PolarHBondContact O-N 3.02Å; G7-A9 PolarHBondContact O-N 3.5Å; G7-G10 PolarHBondContact O-N 3.26Å
8	E	79.6	Confident	79.1	Confident	167 Å²	167	98.8 Å²	98.8	78%	0.78	53%	0.529	S	S	*	.	H	α-helix	trans	-63.1	-28.4	175.1	-73.8	174.1	-172.8	0	0	113	D4 G10	D4-E8 WeakPolarHBondContact O-CG 3.5Å; D4-E8 PolarHBondContact O-N 3.37Å; E8-G10 VanDerWaalsContact C-N 3.28Å; E8-G10 PolarHBondContact O-N 3.47Å
9	A	83.4	Confident	79.6	Confident	73 Å²	73	98.7 Å²	98.7	60%	0.603	53%	0.528	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.6	3.4	174.5	0	0	0	0	0	113.9	I5 L6 G7 L11	I5-A9 PolarHBondContact O-N 3.33Å; I5-A9 VanDerWaalsContact O-N 3.16Å; L6-A9 PolarHBondContact O-N 3.05Å; G7-A9 PolarHBondContact O-N 3.5Å; A9-L11 VanDerWaalsContact C-N 3.3Å; A9-L11 HydrophobicContact CB-CD1 4.38Å; A9-L11 HydrophobicContact CB-CG 4.43Å
10	G	81.4	Confident	79.8	Confident	33 Å²	33	100 Å²	100	34%	0.34	53%	0.525	S	S	.	.	T	Hydrogen-bonded Turn	trans	71.9	22.7	-176.3	0	0	0	0	0	113.6	L6 G7 E8 H12	L6-G10 PolarHBondContact O-N 2.96Å; G7-G10 PolarHBondContact O-N 3.26Å; E8-G10 VanDerWaalsContact C-N 3.28Å; E8-G10 PolarHBondContact O-N 3.47Å; G10-H12 PolarHBondContact O-CD2 3.11Å; G10-H12 VanDerWaalsContact O-CD2 3.27Å
11	L	87.4	Confident	80.2	Confident	44 Å²	44	100.8 Å²	100.8	23%	0.23	53%	0.534	C	S	.	.			trans	-100	122.3	175.6	-62.3	170.9	0	0	0	109.7	L6 A9 L19 R20 V21	L6-L11 CarbonylContact C-O 3.51Å; L6-L11 HydrophobicContact CB-CB 4.24Å; L6-L11 HydrophobicContact CD2-CD1 3.79Å; L6-L11 WeakPolarHBondContact O-CA 3.43Å; L6-L11 WeakPolarHBondContact O-CB 3.44Å; L6-L11 PolarHBondContact O-N 3.47Å; A9-L11 VanDerWaalsContact C-N 3.3Å; A9-L11 HydrophobicContact CB-CD1 4.38Å; A9-L11 HydrophobicContact CB-CG 4.43Å; L11-L19 HydrophobicContact CB-CD1 4.08Å; L11-L19 HydrophobicContact CB-CG 4.38Å; L11-L19 HydrophobicContact CD1-CD2 4.19Å; L11-L19 HydrophobicContact CD2-CD2 4.05Å; L11-L19 HydrophobicContact CD2-CG 4.28Å; L11-R20 CarbonylContact C-O 3.58Å; L11-R20 WeakPolarHBondContact CA-O 3.48Å; L11-V21 HydrophobicContact CD2-CG1 3.95Å
12	H	85.6	Confident	81.3	Confident	54 Å²	54	97.5 Å²	97.5	25%	0.25	52%	0.519	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	155	-177.6	-55	-98.9	0	0	0	109.8	G10 L19 R20 D23 P24	G10-H12 PolarHBondContact O-CD2 3.11Å; G10-H12 VanDerWaalsContact O-CD2 3.27Å; H12-L19 CarbonylContact O-C 3.4Å; H12-L19 WeakPolarHBondContact O-CA 3.35Å; H12-R20 HydrophobicContact CB-CB 4.29Å; H12-R20 PolarHBondContact N-O 3.16Å; H12-R20 PolarHBondContact O-N 3.48Å; H12-D23 IonicContact CE1-OD2 3.98Å; H12-D23 IonicContact ND1-OD2 2.7Å; H12-P24 HydrophobicContact CB-CG 4.41Å
13	F	86.5	Confident	82.4	Confident	84 Å²	84	96.8 Å²	96.8	37%	0.368	51%	0.506	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.1	133.4	168.3	-72.1	-85.5	0	0	0	108.9	L6 K18 L19	L6-F13 HydrophobicContact CB-CE2 4.5Å; L6-F13 HydrophobicContact CD1-CE2 3.56Å; L6-F13 HydrophobicContact CD1-CZ 3.67Å; F13-K18 WeakPolarHBondContact CA-O 3.39Å; F13-L19 HydrophobicContact CD1-CD1 4.42Å; F13-L19 HydrophobicContact CE1-CD1 3.78Å; F13-L19 HydrophobicContact CE2-CD1 4.09Å; F13-L19 HydrophobicContact CZ-CD1 3.59Å
14	D	83.6	Confident	83.5	Confident	20 Å²	20	91.1 Å²	91.1	11%	0.107	49%	0.486	C	S	.	.			trans	-81.4	177.7	169.2	69.9	17.3	0	0	0	112.1	L16 N17 K18 R20 P24	D14-L16 PolarHBondContact O-N 3.23Å; D14-L16 WeakPolarHBondContact OD1-CA 3.33Å; D14-L16 WeakPolarHBondContact OD1-CB 3.47Å; D14-L16 PolarHBondContact OD1-N 3.18Å; D14-N17 PolarHBondContact O-N 3.42Å; D14-N17 PolarHBondContact OD1-N 3.16Å; D14-K18 PolarHBondContact N-O 3.01Å; D14-K18 WeakPolarHBondContact OD1-CB 3.47Å; D14-K18 PolarHBondContact OD1-N 2.95Å; D14-R20 HydrophobicContact CB-CG 4.08Å; D14-R20 IonicContact OD2-CZ 3.24Å; D14-R20 VanDerWaalsContact OD2-CZ 3.24Å; D14-R20 IonicContact OD2-NE 3.5Å; D14-R20 PolarHBondContact OD2-NE 3.36Å; D14-R20 IonicContact OD2-NH2 2.76Å; D14-R20 PolarHBondContact OD2-NH2 2.7Å; D14-P24 HydrophobicContact CB-CG 4.23Å
15	E	84.1	Confident	84.3	Confident	197 Å²	197	92.3 Å²	92.3	92%	0.921	49%	0.488	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.7	-17.2	-179.4	-59.5	-177.2	165.6	0	0	114
16	L	87.9	Confident	84.7	Confident	123 Å²	123	90.7 Å²	90.7	64%	0.644	48%	0.483	S	S	*	.	T	Hydrogen-bonded Turn	trans	-99.2	13.4	177	-58.7	178	0	0	0	112.3	D14 K18	D14-L16 PolarHBondContact O-N 3.23Å; D14-L16 WeakPolarHBondContact OD1-CA 3.33Å; D14-L16 WeakPolarHBondContact OD1-CB 3.47Å; D14-L16 PolarHBondContact OD1-N 3.18Å; L16-K18 HydrophobicContact CB-CD 4.35Å; L16-K18 HydrophobicContact CB-CG 4.17Å; L16-K18 PolarHBondContact O-N 3.39Å
17	N	83.9	Confident	85.2	Confident	133 Å²	133	90.6 Å²	90.6	71%	0.711	49%	0.485	S	S	*	.			trans	57.8	27.8	-174	-60.1	-69.8	0	0	0	113.7	D14	D14-N17 PolarHBondContact O-N 3.42Å; D14-N17 PolarHBondContact OD1-N 3.16Å
18	K	86	Confident	85.9	Confident	119 Å²	119	93.2 Å²	93.2	52%	0.517	49%	0.486	S	S	.	.			trans	-87	139.3	173.4	-56.4	176.2	-180	177.2	0	109.7	F13 D14 L16	F13-K18 WeakPolarHBondContact CA-O 3.39Å; D14-K18 PolarHBondContact N-O 3.01Å; D14-K18 WeakPolarHBondContact OD1-CB 3.47Å; D14-K18 PolarHBondContact OD1-N 2.95Å; L16-K18 HydrophobicContact CB-CD 4.35Å; L16-K18 HydrophobicContact CB-CG 4.17Å; L16-K18 PolarHBondContact O-N 3.39Å
19	L	89	Confident	86.7	Confident	97 Å²	97	90 Å²	90	51%	0.508	47%	0.471	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69	131.8	174.5	-157.5	81.6	0	0	0	110	L11 H12 F13	L11-L19 HydrophobicContact CB-CD1 4.08Å; L11-L19 HydrophobicContact CB-CG 4.38Å; L11-L19 HydrophobicContact CD1-CD2 4.19Å; L11-L19 HydrophobicContact CD2-CD2 4.05Å; L11-L19 HydrophobicContact CD2-CG 4.28Å; H12-L19 CarbonylContact O-C 3.4Å; H12-L19 WeakPolarHBondContact O-CA 3.35Å; F13-L19 HydrophobicContact CD1-CD1 4.42Å; F13-L19 HydrophobicContact CE1-CD1 3.78Å; F13-L19 HydrophobicContact CE2-CD1 4.09Å; F13-L19 HydrophobicContact CZ-CD1 3.59Å
20	R	84	Confident	87.3	Confident	124 Å²	124	90.7 Å²	90.7	47%	0.468	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.8	143.9	-179.2	-63.6	-78.2	-176.6	156.3	2.9	108.6	L11 H12 D14 L22 P24	L11-R20 CarbonylContact C-O 3.58Å; L11-R20 WeakPolarHBondContact CA-O 3.48Å; H12-R20 HydrophobicContact CB-CB 4.29Å; H12-R20 PolarHBondContact N-O 3.16Å; H12-R20 PolarHBondContact O-N 3.48Å; D14-R20 HydrophobicContact CB-CG 4.08Å; D14-R20 IonicContact OD2-CZ 3.24Å; D14-R20 VanDerWaalsContact OD2-CZ 3.24Å; D14-R20 IonicContact OD2-NE 3.5Å; D14-R20 PolarHBondContact OD2-NE 3.36Å; D14-R20 IonicContact OD2-NH2 2.76Å; D14-R20 PolarHBondContact OD2-NH2 2.7Å; R20-L22 WeakPolarHBondContact CB-O 3.32Å; R20-P24 HydrophobicContact CG-CG 4.44Å
21	V	88.6	Confident	87.9	Confident	117 Å²	117	93 Å²	93	71%	0.709	47%	0.472	S	S	*	.	S	Bend	trans	-94.9	-8.2	175.1	-64.9	0	0	0	0	112.8	L11	L11-V21 HydrophobicContact CD2-CG1 3.95Å
22	L	83.4	Confident	88.4	Confident	118 Å²	118	95.4 Å²	95.4	62%	0.618	48%	0.482	S	S	*	.	S	Bend	trans	-117.7	140.6	174.8	-74.9	164.8	0	0	0	107.3	R20 P24	R20-L22 WeakPolarHBondContact CB-O 3.32Å; L22-P24 WeakPolarHBondContact O-CD 3.35Å
23	D	86.1	Confident	89	Confident	56 Å²	56	97.8 Å²	97.8	30%	0.299	50%	0.496	S	S	.	.			trans	-58.5	120.8	172.6	-166.1	-43.6	0	0	0	109.2	H12 E25 V26 T27	H12-D23 IonicContact CE1-OD2 3.98Å; H12-D23 IonicContact ND1-OD2 2.7Å; D23-E25 PolarHBondContact O-N 2.7Å; D23-E25 WeakPolarHBondContact OD1-CB 3.34Å; D23-E25 PolarHBondContact OD1-N 2.94Å; D23-V26 HydrophobicContact CB-CB 4Å; D23-V26 HydrophobicContact CB-CG2 3.77Å; D23-V26 PolarHBondContact O-N 3.44Å; D23-T27 WeakPolarHBondContact O-CB 3.49Å; D23-T27 PolarHBondContact O-N 2.94Å; D23-T27 PolarHBondContact O-OG1 3.21Å
24	P	85.4	Confident	89.5	Confident	46 Å²	46	100.6 Å²	100.6	30%	0.299	51%	0.507	S	S	.	.	H	α-helix	trans	-57	-35.6	178.8	-24.9	34.3	0	0	0	113	H12 D14 R20 L22 T27 Q28	H12-P24 HydrophobicContact CB-CG 4.41Å; D14-P24 HydrophobicContact CB-CG 4.23Å; R20-P24 HydrophobicContact CG-CG 4.44Å; L22-P24 WeakPolarHBondContact O-CD 3.35Å; P24-T27 PolarHBondContact O-N 3.47Å; P24-Q28 WeakPolarHBondContact O-CB 3.4Å; P24-Q28 PolarHBondContact O-N 3.4Å
25	E	87.6	Confident	90.2	Very high	127 Å²	127	103.5 Å²	103.5	59%	0.593	52%	0.52	S	S	*	.	H	α-helix	trans	-68.7	-48.3	-179.8	-173	178.8	168.5	0	0	110.5	D23 T27 Q28 Q29	D23-E25 PolarHBondContact O-N 2.7Å; D23-E25 WeakPolarHBondContact OD1-CB 3.34Å; D23-E25 PolarHBondContact OD1-N 2.94Å; E25-T27 VanDerWaalsContact C-N 3.26Å; E25-T27 PolarHBondContact O-N 3.08Å; E25-Q28 PolarHBondContact O-N 3.36Å; E25-Q29 WeakPolarHBondContact O-CB 3.37Å; E25-Q29 WeakPolarHBondContact O-CG 3.36Å; E25-Q29 PolarHBondContact O-N 3Å; E25-Q29 PolarHBondContact OE1-NE2 3.48Å
26	V	89.3	Confident	90.9	Very high	77 Å²	77	100.4 Å²	100.4	47%	0.467	51%	0.506	S	S	.	.	H	α-helix	trans	-61.6	-38.6	176.7	179.1	0	0	0	0	110.9	D23 T30	D23-V26 HydrophobicContact CB-CB 4Å; D23-V26 HydrophobicContact CB-CG2 3.77Å; D23-V26 PolarHBondContact O-N 3.44Å; V26-T30 VanDerWaalsContact O-CB 3.3Å; V26-T30 WeakPolarHBondContact O-CB 3.34Å; V26-T30 PolarHBondContact O-N 2.98Å; V26-T30 PolarHBondContact O-OG1 3.07Å
27	T	90.1	Very high	91.4	Very high	52 Å²	52	97.7 Å²	97.7	32%	0.319	50%	0.497	S	S	.	.	H	α-helix	trans	-62.8	-47.5	176.6	-58.1	0	0	0	0	110.9	D23 P24 E25 T30 I31	D23-T27 WeakPolarHBondContact O-CB 3.49Å; D23-T27 PolarHBondContact O-N 2.94Å; D23-T27 PolarHBondContact O-OG1 3.21Å; P24-T27 PolarHBondContact O-N 3.47Å; E25-T27 VanDerWaalsContact C-N 3.26Å; E25-T27 PolarHBondContact O-N 3.08Å; T27-T30 PolarHBondContact O-N 3.5Å; T27-I31 HydrophobicContact CG2-CD1 4.05Å; T27-I31 WeakPolarHBondContact O-CG1 3.47Å; T27-I31 PolarHBondContact O-N 2.92Å
28	Q	91.8	Very high	92.1	Very high	96 Å²	96	97 Å²	97	45%	0.449	49%	0.488	S	S	.	.	H	α-helix	trans	-63.1	-49.3	179.3	-177.2	58.2	36.8	0	0	111.3	P24 E25 T30 I31 E32	P24-Q28 WeakPolarHBondContact O-CB 3.4Å; P24-Q28 PolarHBondContact O-N 3.4Å; E25-Q28 PolarHBondContact O-N 3.36Å; Q28-T30 VanDerWaalsContact C-N 3.27Å; Q28-T30 PolarHBondContact O-N 3.31Å; Q28-I31 PolarHBondContact O-N 3.39Å; Q28-I31 VanDerWaalsContact O-N 3.1Å; Q28-E32 WeakPolarHBondContact CG-OE1 3.35Å; Q28-E32 PolarHBondContact NE2-OE1 2.89Å; Q28-E32 WeakPolarHBondContact O-CG 3.39Å; Q28-E32 PolarHBondContact O-N 2.97Å
29	Q	95.6	Very high	92.7	Very high	100 Å²	100	95.2 Å²	95.2	47%	0.467	48%	0.484	S	S	.	.	H	α-helix	trans	-58	-39.3	176.5	-72.4	174.2	-9.2	0	0	112.1	E25 E32 L33	E25-Q29 WeakPolarHBondContact O-CB 3.37Å; E25-Q29 WeakPolarHBondContact O-CG 3.36Å; E25-Q29 PolarHBondContact O-N 3Å; E25-Q29 PolarHBondContact OE1-NE2 3.48Å; Q29-E32 PolarHBondContact O-N 3.44Å; Q29-L33 VanDerWaalsContact O-CB 3.26Å; Q29-L33 WeakPolarHBondContact O-CB 3.36Å; Q29-L33 PolarHBondContact O-N 3.47Å
30	T	94.9	Very high	93.1	Very high	87 Å²	87	96.9 Å²	96.9	53%	0.534	49%	0.487	S	S	.	.	H	α-helix	trans	-66.6	-38.8	177.7	-59.2	0	0	0	0	111.8	V26 T27 Q28 K34	V26-T30 VanDerWaalsContact O-CB 3.3Å; V26-T30 WeakPolarHBondContact O-CB 3.34Å; V26-T30 PolarHBondContact O-N 2.98Å; V26-T30 PolarHBondContact O-OG1 3.07Å; T27-T30 PolarHBondContact O-N 3.5Å; Q28-T30 VanDerWaalsContact C-N 3.27Å; Q28-T30 PolarHBondContact O-N 3.31Å; T30-K34 WeakPolarHBondContact O-CB 3.23Å; T30-K34 PolarHBondContact O-N 2.97Å
31	I	96	Very high	93.8	Very high	83 Å²	83	95.6 Å²	95.6	43%	0.426	49%	0.493	S	S	.	.	H	α-helix	trans	-66.8	-47.4	176.3	-69.6	166.1	0	0	0	110.1	T27 Q28 K34 E35	T27-I31 HydrophobicContact CG2-CD1 4.05Å; T27-I31 WeakPolarHBondContact O-CG1 3.47Å; T27-I31 PolarHBondContact O-N 2.92Å; Q28-I31 PolarHBondContact O-N 3.39Å; Q28-I31 VanDerWaalsContact O-N 3.1Å; I31-K34 WeakPolarHBondContact O-CB 3.37Å; I31-K34 PolarHBondContact O-N 3.33Å; I31-E35 PolarHBondContact O-N 3.39Å
32	E	97.6	Very high	94.3	Very high	94 Å²	94	94 Å²	94	44%	0.439	48%	0.48	S	S	.	.	H	α-helix	trans	-57.9	-50.6	177.2	-74.1	172	-172.4	0	0	111.2	Q28 Q29 K34 E35 E36	Q28-E32 WeakPolarHBondContact CG-OE1 3.35Å; Q28-E32 PolarHBondContact NE2-OE1 2.89Å; Q28-E32 WeakPolarHBondContact O-CG 3.39Å; Q28-E32 PolarHBondContact O-N 2.97Å; Q29-E32 PolarHBondContact O-N 3.44Å; E32-K34 VanDerWaalsContact C-N 3.26Å; E32-K34 PolarHBondContact O-N 3Å; E32-E35 PolarHBondContact O-N 3.24Å; E32-E35 VanDerWaalsContact O-N 3.14Å; E32-E36 WeakPolarHBondContact O-CG 3.45Å; E32-E36 PolarHBondContact O-N 3.3Å
33	L	97.6	Very high	95	Very high	104 Å²	104	94.9 Å²	94.9	55%	0.545	48%	0.479	S	S	.	.	H	α-helix	trans	-57	-41.2	177.5	179.4	63	0	0	0	111.9	Q29 C37	Q29-L33 VanDerWaalsContact O-CB 3.26Å; Q29-L33 WeakPolarHBondContact O-CB 3.36Å; Q29-L33 PolarHBondContact O-N 3.47Å; L33-C37 WeakPolarHBondContact O-CB 3.46Å; L33-C37 PolarHBondContact O-N 2.89Å; L33-C37 PolarHBondContact O-SG 3.18Å
34	K	97.8	Very high	95.6	Very high	142 Å²	142	95.5 Å²	95.5	62%	0.617	48%	0.481	S	S	*	.	H	α-helix	trans	-63.5	-45	178.3	178.9	-166.7	168.7	-156.3	0	111.5	T30 I31 E32 C37 K38	T30-K34 WeakPolarHBondContact O-CB 3.23Å; T30-K34 PolarHBondContact O-N 2.97Å; I31-K34 WeakPolarHBondContact O-CB 3.37Å; I31-K34 PolarHBondContact O-N 3.33Å; E32-K34 VanDerWaalsContact C-N 3.26Å; E32-K34 PolarHBondContact O-N 3Å; K34-C37 PolarHBondContact O-N 3.22Å; K34-K38 PolarHBondContact O-N 2.97Å
35	E	98.4	Very high	96.2	Very high	81 Å²	81	94.4 Å²	94.4	38%	0.379	48%	0.479	S	S	.	.	H	α-helix	trans	-67.7	-42.2	178.7	-64.7	-54.8	135	0	0	111.1	I31 E32 C37 K38 D39	I31-E35 PolarHBondContact O-N 3.39Å; E32-E35 PolarHBondContact O-N 3.24Å; E32-E35 VanDerWaalsContact O-N 3.14Å; E35-C37 VanDerWaalsContact C-N 3.33Å; E35-C37 PolarHBondContact O-N 3.43Å; E35-K38 WeakPolarHBondContact O-CB 3.36Å; E35-K38 PolarHBondContact O-N 3.27Å; E35-K38 VanDerWaalsContact O-N 3.17Å; E35-D39 PolarHBondContact O-N 2.97Å
36	E	98.1	Very high	96.7	Very high	132 Å²	132	94.1 Å²	94.1	62%	0.617	48%	0.478	S	S	*	.	H	α-helix	trans	-59.6	-42.5	174	-73	-173.6	168.8	0	0	112.3	E32 K38 D39 F40	E32-E36 WeakPolarHBondContact O-CG 3.45Å; E32-E36 PolarHBondContact O-N 3.3Å; E36-K38 VanDerWaalsContact C-N 3.32Å; E36-K38 PolarHBondContact O-N 2.9Å; E36-D39 PolarHBondContact O-N 3.35Å; E36-F40 WeakPolarHBondContact O-CB 3.33Å; E36-F40 PolarHBondContact O-N 3.21Å
37	C	98.3	Very high	97.1	Very high	67 Å²	67	96.7 Å²	96.7	45%	0.453	48%	0.483	S	S	.	.	H	α-helix	trans	-62.9	-40.4	176.6	-72.7	0	0	0	0	111.6	L33 K34 E35 F40 V41	L33-C37 WeakPolarHBondContact O-CB 3.46Å; L33-C37 PolarHBondContact O-N 2.89Å; L33-C37 PolarHBondContact O-SG 3.18Å; K34-C37 PolarHBondContact O-N 3.22Å; E35-C37 VanDerWaalsContact C-N 3.33Å; E35-C37 PolarHBondContact O-N 3.43Å; C37-F40 PolarHBondContact O-N 3.33Å; C37-V41 WeakPolarHBondContact O-CG2 3.47Å; C37-V41 PolarHBondContact O-N 2.95Å
38	K	98.2	Very high	97.5	Very high	119 Å²	119	100.2 Å²	100.2	52%	0.517	50%	0.496	S	S	.	.	H	α-helix	trans	-64.4	-49	176.6	-178	-178	174	-175.5	0	111.1	K34 E35 E36 F40 V41 D42	K34-K38 PolarHBondContact O-N 2.97Å; E35-K38 WeakPolarHBondContact O-CB 3.36Å; E35-K38 PolarHBondContact O-N 3.27Å; E35-K38 VanDerWaalsContact O-N 3.17Å; E36-K38 VanDerWaalsContact C-N 3.32Å; E36-K38 PolarHBondContact O-N 2.9Å; K38-F40 VanDerWaalsContact C-N 3.25Å; K38-F40 PolarHBondContact O-N 3.24Å; K38-V41 PolarHBondContact O-N 3.18Å; K38-V41 VanDerWaalsContact O-N 3.17Å; K38-D42 PolarHBondContact O-N 3.06Å
39	D	98.4	Very high	97.8	Very high	81 Å²	81	103.6 Å²	103.6	43%	0.433	51%	0.509	S	S	.	.	H	α-helix	trans	-58.2	-39.4	176.9	-85.3	5.6	0	0	0	111.9	E35 E36 K43	E35-D39 PolarHBondContact O-N 2.97Å; E36-D39 PolarHBondContact O-N 3.35Å; D39-K43 WeakPolarHBondContact O-CB 3.45Å; D39-K43 VanDerWaalsContact O-CG 3.23Å; D39-K43 WeakPolarHBondContact O-CG 3.26Å; D39-K43 PolarHBondContact O-N 3.38Å
40	F	98.5	Very high	98	Very high	132 Å²	132	104.6 Å²	104.6	58%	0.579	52%	0.516	S	S	*	.	H	α-helix	trans	-62	-49.9	175.5	178.1	-96.7	0	0	0	111.7	E36 C37 K38 D42 K43 I44	E36-F40 WeakPolarHBondContact O-CB 3.33Å; E36-F40 PolarHBondContact O-N 3.21Å; C37-F40 PolarHBondContact O-N 3.33Å; K38-F40 VanDerWaalsContact C-N 3.25Å; K38-F40 PolarHBondContact O-N 3.24Å; F40-D42 VanDerWaalsContact C-N 3.32Å; F40-D42 PolarHBondContact O-N 3.32Å; F40-K43 PolarHBondContact O-N 3.44Å; F40-I44 HydrophobicContact CD1-CG1 4.26Å; F40-I44 HydrophobicContact CE1-CG1 3.83Å; F40-I44 HydrophobicContact CE2-CD1 4.31Å; F40-I44 HydrophobicContact CE2-CG1 4.14Å; F40-I44 HydrophobicContact CZ-CD1 4.05Å; F40-I44 HydrophobicContact CZ-CG1 3.77Å; F40-I44 WeakPolarHBondContact O-CG1 3.3Å; F40-I44 PolarHBondContact O-N 2.91Å
41	V	98.3	Very high	98.1	Very high	97 Å²	97	103 Å²	103	59%	0.588	51%	0.506	S	S	*	.	H	α-helix	trans	-60.8	-42.8	178.5	171.3	0	0	0	0	111.1	C37 K38 I44 G45	C37-V41 WeakPolarHBondContact O-CG2 3.47Å; C37-V41 PolarHBondContact O-N 2.95Å; K38-V41 PolarHBondContact O-N 3.18Å; K38-V41 VanDerWaalsContact O-N 3.17Å; V41-I44 PolarHBondContact O-N 2.92Å; V41-G45 PolarHBondContact O-N 3.17Å
42	D	98.5	Very high	98.2	Very high	84 Å²	84	100.3 Å²	100.3	45%	0.449	50%	0.499	S	S	.	.	H	α-helix	trans	-63.4	-44.3	178.5	-76	-13	0	0	0	111.6	K38 F40 G45 Q46	K38-D42 PolarHBondContact O-N 3.06Å; F40-D42 VanDerWaalsContact C-N 3.32Å; F40-D42 PolarHBondContact O-N 3.32Å; D42-G45 PolarHBondContact O-N 3.44Å; D42-Q46 WeakPolarHBondContact O-CG 3.44Å; D42-Q46 PolarHBondContact O-N 2.94Å
43	K	98.5	Very high	98.2	Very high	136 Å²	136	97.5 Å²	97.5	59%	0.591	50%	0.495	S	S	*	.	H	α-helix	trans	-62.4	-42.4	175.7	-75.5	168.6	-175.6	164.7	0	112.1	D39 F40 G45 Q46 F47	D39-K43 WeakPolarHBondContact O-CB 3.45Å; D39-K43 VanDerWaalsContact O-CG 3.23Å; D39-K43 WeakPolarHBondContact O-CG 3.26Å; D39-K43 PolarHBondContact O-N 3.38Å; F40-K43 PolarHBondContact O-N 3.44Å; K43-G45 VanDerWaalsContact C-N 3.35Å; K43-Q46 PolarHBondContact O-N 3.31Å; K43-F47 WeakPolarHBondContact O-CB 3.48Å; K43-F47 PolarHBondContact O-N 2.96Å
44	I	98.4	Very high	98.2	Very high	68 Å²	68	97.4 Å²	97.4	35%	0.349	50%	0.495	S	S	.	.	H	α-helix	trans	-63.5	-42.4	175.4	-69.4	-64.6	0	0	0	110.8	F40 V41 Q46 F47 Q48	F40-I44 HydrophobicContact CD1-CG1 4.26Å; F40-I44 HydrophobicContact CE1-CG1 3.83Å; F40-I44 HydrophobicContact CE2-CD1 4.31Å; F40-I44 HydrophobicContact CE2-CG1 4.14Å; F40-I44 HydrophobicContact CZ-CD1 4.05Å; F40-I44 HydrophobicContact CZ-CG1 3.77Å; F40-I44 WeakPolarHBondContact O-CG1 3.3Å; F40-I44 PolarHBondContact O-N 2.91Å; V41-I44 PolarHBondContact O-N 2.92Å; I44-Q46 VanDerWaalsContact C-N 3.33Å; I44-Q46 PolarHBondContact O-N 2.89Å; I44-F47 PolarHBondContact O-N 3.08Å; I44-Q48 HydrophobicContact CG2-CG 4.41Å; I44-Q48 WeakPolarHBondContact O-CG 3.32Å; I44-Q48 PolarHBondContact O-N 3.07Å
45	G	98.3	Very high	98.2	Very high	24 Å²	24	95 Å²	95	25%	0.247	49%	0.488	C	S	.	.	H	α-helix	trans	-61.4	-40.1	176	0	0	0	0	0	112.7	V41 D42 K43 K49	V41-G45 PolarHBondContact O-N 3.17Å; D42-G45 PolarHBondContact O-N 3.44Å; K43-G45 VanDerWaalsContact C-N 3.35Å; G45-K49 WeakPolarHBondContact O-CG 3.41Å; G45-K49 PolarHBondContact O-N 3.43Å
46	Q	98.4	Very high	98.2	Very high	121 Å²	121	97.4 Å²	97.4	57%	0.565	50%	0.499	S	S	*	.	H	α-helix	trans	-65.1	-45.2	173.5	-70.5	175.5	6.5	0	0	111.9	D42 K43 I44 Q48 K49 I50	D42-Q46 WeakPolarHBondContact O-CG 3.44Å; D42-Q46 PolarHBondContact O-N 2.94Å; K43-Q46 PolarHBondContact O-N 3.31Å; I44-Q46 VanDerWaalsContact C-N 3.33Å; I44-Q46 PolarHBondContact O-N 2.89Å; Q46-Q48 VanDerWaalsContact C-N 3.35Å; Q46-Q48 PolarHBondContact O-N 3.14Å; Q46-K49 WeakPolarHBondContact O-CB 3.44Å; Q46-K49 PolarHBondContact O-N 3.03Å; Q46-I50 WeakPolarHBondContact O-CG1 3.44Å; Q46-I50 PolarHBondContact O-N 3.06Å
47	F	98.4	Very high	98.1	Very high	130 Å²	130	96.1 Å²	96.1	57%	0.57	50%	0.496	S	S	*	.	H	α-helix	trans	-58.1	-46.6	177	176.9	-99.5	0	0	0	111.8	K43 I44 K49 I50 V51	K43-F47 WeakPolarHBondContact O-CB 3.48Å; K43-F47 PolarHBondContact O-N 2.96Å; I44-F47 PolarHBondContact O-N 3.08Å; F47-K49 VanDerWaalsContact C-N 3.31Å; F47-K49 PolarHBondContact O-N 3.06Å; F47-I50 PolarHBondContact O-N 3.27Å; F47-V51 HydrophobicContact CD1-CG2 4.27Å; F47-V51 HydrophobicContact CD2-CG2 4.36Å; F47-V51 HydrophobicContact CE1-CG2 3.79Å; F47-V51 HydrophobicContact CE2-CG2 3.9Å; F47-V51 HydrophobicContact CZ-CG2 3.59Å; F47-V51 WeakPolarHBondContact O-CG2 3.45Å; F47-V51 PolarHBondContact O-N 3.46Å
48	Q	98.2	Very high	98.1	Very high	127 Å²	127	96.8 Å²	96.8	59%	0.593	50%	0.498	S	S	*	.	H	α-helix	trans	-59.3	-40.9	177.1	-74.5	176.5	-26.1	0	0	112.3	I44 Q46 G52	I44-Q48 HydrophobicContact CG2-CG 4.41Å; I44-Q48 WeakPolarHBondContact O-CG 3.32Å; I44-Q48 PolarHBondContact O-N 3.07Å; Q46-Q48 VanDerWaalsContact C-N 3.35Å; Q46-Q48 PolarHBondContact O-N 3.14Å; Q48-G52 PolarHBondContact O-N 3.17Å
49	K	98.3	Very high	98.1	Very high	166 Å²	166	95.3 Å²	95.3	72%	0.722	50%	0.495	S	S	*	.	H	α-helix	trans	-62.5	-43.2	175.5	-72.6	172.3	-177.9	177.9	0	112.2	G45 Q46 F47 G52 G53	G45-K49 WeakPolarHBondContact O-CG 3.41Å; G45-K49 PolarHBondContact O-N 3.43Å; Q46-K49 WeakPolarHBondContact O-CB 3.44Å; Q46-K49 PolarHBondContact O-N 3.03Å; F47-K49 VanDerWaalsContact C-N 3.31Å; F47-K49 PolarHBondContact O-N 3.06Å; K49-G52 PolarHBondContact O-N 3.4Å; K49-G53 PolarHBondContact O-N 3.46Å
50	I	98.1	Very high	98	Very high	121 Å²	121	96.9 Å²	96.9	62%	0.621	50%	0.5	S	S	*	.	H	α-helix	trans	-64	-48.6	179.3	-67	166	0	0	0	110.4	Q46 F47 G52 G53 L54	Q46-I50 WeakPolarHBondContact O-CG1 3.44Å; Q46-I50 PolarHBondContact O-N 3.06Å; F47-I50 PolarHBondContact O-N 3.27Å; I50-G52 VanDerWaalsContact C-N 3.33Å; I50-G52 PolarHBondContact O-N 2.91Å; I50-G53 PolarHBondContact O-N 3.4Å; I50-L54 PolarHBondContact O-N 2.88Å
51	V	98.1	Very high	97.9	Very high	53 Å²	53	95.9 Å²	95.9	32%	0.321	50%	0.5	S	S	.	.	H	α-helix	trans	-63.5	-40.8	178.9	173.9	0	0	0	0	111	F47 L54 I55	F47-V51 HydrophobicContact CD1-CG2 4.27Å; F47-V51 HydrophobicContact CD2-CG2 4.36Å; F47-V51 HydrophobicContact CE1-CG2 3.79Å; F47-V51 HydrophobicContact CE2-CG2 3.9Å; F47-V51 HydrophobicContact CZ-CG2 3.59Å; F47-V51 WeakPolarHBondContact O-CG2 3.45Å; F47-V51 PolarHBondContact O-N 3.46Å; V51-L54 PolarHBondContact O-N 2.9Å; V51-I55 HydrophobicContact CG1-CD1 3.98Å; V51-I55 HydrophobicContact CG1-CG1 4.49Å; V51-I55 WeakPolarHBondContact O-CG1 3.39Å; V51-I55 PolarHBondContact O-N 3.05Å
52	G	98.1	Very high	97.7	Very high	28 Å²	28	93.9 Å²	93.9	29%	0.289	49%	0.494	S	S	.	.	H	α-helix	trans	-57.2	-49	174	0	0	0	0	0	112.4	Q48 K49 I50 L54 I55 E56	Q48-G52 PolarHBondContact O-N 3.17Å; K49-G52 PolarHBondContact O-N 3.4Å; I50-G52 VanDerWaalsContact C-N 3.33Å; I50-G52 PolarHBondContact O-N 2.91Å; G52-L54 VanDerWaalsContact C-N 3.32Å; G52-L54 PolarHBondContact O-N 3.35Å; G52-I55 PolarHBondContact O-N 3.21Å; G52-E56 PolarHBondContact O-N 3.3Å; G52-E56 VanDerWaalsContact O-N 3.08Å
53	G	97.8	Very high	97.6	Very high	34 Å²	34	96.6 Å²	96.6	35%	0.351	50%	0.501	S	S	.	.	H	α-helix	trans	-63.2	-34.8	176.6	0	0	0	0	0	113.6	K49 I50 E56 L57	K49-G53 PolarHBondContact O-N 3.46Å; I50-G53 PolarHBondContact O-N 3.4Å; G53-E56 PolarHBondContact O-N 2.89Å; G53-L57 PolarHBondContact O-N 2.93Å
54	L	97.6	Very high	97.4	Very high	102 Å²	102	95.7 Å²	95.7	53%	0.534	50%	0.5	S	S	.	.	H	α-helix	trans	-66.1	-42.1	174.5	178.5	61.8	0	0	0	111.9	I50 V51 G52 E56 L57 V58	I50-L54 PolarHBondContact O-N 2.88Å; V51-L54 PolarHBondContact O-N 2.9Å; G52-L54 VanDerWaalsContact C-N 3.32Å; G52-L54 PolarHBondContact O-N 3.35Å; L54-E56 VanDerWaalsContact C-N 3.33Å; L54-E56 PolarHBondContact O-N 3.35Å; L54-L57 PolarHBondContact O-N 2.89Å; L54-V58 HydrophobicContact CD1-CG2 4.31Å; L54-V58 VanDerWaalsContact O-CG2 3.32Å; L54-V58 WeakPolarHBondContact O-CG2 3.46Å; L54-V58 PolarHBondContact O-N 2.91Å
55	I	97.5	Very high	97.1	Very high	93 Å²	93	95.2 Å²	95.2	48%	0.477	51%	0.506	S	S	.	.	H	α-helix	trans	-60.4	-46	176.6	-68.7	164.8	0	0	0	110	V51 G52 L57 V58 D59	V51-I55 HydrophobicContact CG1-CD1 3.98Å; V51-I55 HydrophobicContact CG1-CG1 4.49Å; V51-I55 WeakPolarHBondContact O-CG1 3.39Å; V51-I55 PolarHBondContact O-N 3.05Å; G52-I55 PolarHBondContact O-N 3.21Å; I55-L57 VanDerWaalsContact C-N 3.33Å; I55-L57 PolarHBondContact O-N 3.1Å; I55-V58 PolarHBondContact O-N 2.71Å; I55-D59 PolarHBondContact O-N 2.95Å
56	E	97.8	Very high	96.8	Very high	130 Å²	130	98.6 Å²	98.6	61%	0.607	52%	0.515	S	S	*	.	H	α-helix	trans	-59.2	-43.1	177.4	-71.1	176.9	-179.6	0	0	112.3	G52 G53 L54 D59 Q60	G52-E56 PolarHBondContact O-N 3.3Å; G52-E56 VanDerWaalsContact O-N 3.08Å; G53-E56 PolarHBondContact O-N 2.89Å; L54-E56 VanDerWaalsContact C-N 3.33Å; L54-E56 PolarHBondContact O-N 3.35Å; E56-D59 PolarHBondContact O-N 3.45Å; E56-Q60 WeakPolarHBondContact O-CG 3.44Å; E56-Q60 PolarHBondContact O-N 2.78Å
57	L	97.6	Very high	96.5	Very high	106 Å²	106	97.3 Å²	97.3	56%	0.555	51%	0.512	S	S	*	.	H	α-helix	trans	-62.9	-43.2	176.8	-172.3	107.6	0	0	0	111.6	G53 L54 I55 Q60 L61	G53-L57 PolarHBondContact O-N 2.93Å; L54-L57 PolarHBondContact O-N 2.89Å; I55-L57 VanDerWaalsContact C-N 3.33Å; I55-L57 PolarHBondContact O-N 3.1Å; L57-Q60 PolarHBondContact O-N 3.27Å; L57-L61 WeakPolarHBondContact O-CB 3.33Å; L57-L61 PolarHBondContact O-N 3.47Å
58	V	97.4	Very high	96.1	Very high	81 Å²	81	96 Å²	96	49%	0.491	51%	0.508	S	S	.	.	H	α-helix	trans	-64.2	-41.9	177.9	170.1	0	0	0	0	111.1	L54 I55 Q60 L61 A62	L54-V58 HydrophobicContact CD1-CG2 4.31Å; L54-V58 VanDerWaalsContact O-CG2 3.32Å; L54-V58 WeakPolarHBondContact O-CG2 3.46Å; L54-V58 PolarHBondContact O-N 2.91Å; I55-V58 PolarHBondContact O-N 2.71Å; V58-Q60 VanDerWaalsContact C-N 3.35Å; V58-Q60 PolarHBondContact O-N 2.83Å; V58-L61 PolarHBondContact O-N 3.38Å; V58-A62 WeakPolarHBondContact O-CB 3.37Å; V58-A62 PolarHBondContact O-N 3.19Å
59	D	97.3	Very high	95.5	Very high	87 Å²	87	95.7 Å²	95.7	47%	0.465	50%	0.504	S	S	.	.	H	α-helix	trans	-64.4	-38.6	177	-80.8	-10.5	0	0	0	112.3	I55 E56 K63	I55-D59 PolarHBondContact O-N 2.95Å; E56-D59 PolarHBondContact O-N 3.45Å; D59-K63 WeakPolarHBondContact O-CG 3.45Å; D59-K63 PolarHBondContact O-N 2.88Å; D59-K63 VanDerWaalsContact O-N 3.16Å
60	Q	97	Very high	94.8	Very high	114 Å²	114	94.2 Å²	94.2	53%	0.533	50%	0.502	S	S	.	.	H	α-helix	trans	-63.7	-48.2	174.2	-74.7	176.1	-4.2	0	0	111	E56 L57 V58 A62 K63 E64	E56-Q60 WeakPolarHBondContact O-CG 3.44Å; E56-Q60 PolarHBondContact O-N 2.78Å; L57-Q60 PolarHBondContact O-N 3.27Å; V58-Q60 VanDerWaalsContact C-N 3.35Å; V58-Q60 PolarHBondContact O-N 2.83Å; Q60-A62 VanDerWaalsContact C-N 3.31Å; Q60-A62 PolarHBondContact O-N 3.49Å; Q60-K63 PolarHBondContact O-N 3.03Å; Q60-K63 VanDerWaalsContact O-N 3.16Å; Q60-E64 WeakPolarHBondContact O-CG 3.36Å; Q60-E64 PolarHBondContact O-N 3.31Å
61	L	96	Very high	94.1	Very high	111 Å²	111	94.9 Å²	94.9	58%	0.581	50%	0.5	S	S	*	.	H	α-helix	trans	-60.2	-40.9	179	-175.6	61.9	0	0	0	112	L57 V58 E64 A65	L57-L61 WeakPolarHBondContact O-CB 3.33Å; L57-L61 PolarHBondContact O-N 3.47Å; V58-L61 PolarHBondContact O-N 3.38Å; L61-E64 PolarHBondContact O-N 3.2Å; L61-A65 WeakPolarHBondContact O-CB 3.34Å; L61-A65 PolarHBondContact O-N 3.32Å
62	A	95.6	Very high	92.9	Very high	55 Å²	55	98.3 Å²	98.3	46%	0.455	52%	0.521	S	S	.	.	H	α-helix	trans	-62.5	-42.1	176.7	0	0	0	0	0	112.2	V58 Q60 A65 E66	V58-A62 WeakPolarHBondContact O-CB 3.37Å; V58-A62 PolarHBondContact O-N 3.19Å; Q60-A62 VanDerWaalsContact C-N 3.31Å; Q60-A62 PolarHBondContact O-N 3.49Å; A62-A65 PolarHBondContact O-N 3.16Å; A62-E66 PolarHBondContact O-N 2.94Å; A62-E66 VanDerWaalsContact O-N 3.11Å
63	K	95.3	Very high	91.1	Very high	141 Å²	141	101.7 Å²	101.7	61%	0.613	54%	0.54	S	S	*	.	H	α-helix	trans	-65.3	-42.7	176.4	-71.8	171.8	-172.8	171.1	0	112	D59 Q60 E66 N67	D59-K63 WeakPolarHBondContact O-CG 3.45Å; D59-K63 PolarHBondContact O-N 2.88Å; D59-K63 VanDerWaalsContact O-N 3.16Å; Q60-K63 PolarHBondContact O-N 3.03Å; Q60-K63 VanDerWaalsContact O-N 3.16Å; K63-E66 PolarHBondContact O-N 2.91Å; K63-N67 WeakPolarHBondContact O-CB 3.36Å; K63-N67 VanDerWaalsContact O-CG 3.28Å; K63-N67 PolarHBondContact O-N 3.34Å; K63-N67 PolarHBondContact O-ND2 3.23Å
64	E	94.1	Very high	88.9	Confident	118 Å²	118	106 Å²	106	55%	0.551	58%	0.584	S	S	*	*	H	α-helix	trans	-62.2	-44	176.4	-72.6	178.8	-171.7	0	0	111.4	Q60 L61 E66 N67 E68	Q60-E64 WeakPolarHBondContact O-CG 3.36Å; Q60-E64 PolarHBondContact O-N 3.31Å; L61-E64 PolarHBondContact O-N 3.2Å; E64-E66 PolarHBondContact O-N 2.79Å; E64-N67 PolarHBondContact O-N 2.76Å; E64-E68 PolarHBondContact O-N 2.9Å
65	A	93.3	Very high	88.5	Confident	58 Å²	58	106.2 Å²	106.2	48%	0.479	59%	0.587	S	S	.	*	H	α-helix	trans	-61.2	-43.5	178	0	0	0	0	0	112.9	L61 A62 E68 K69	L61-A65 WeakPolarHBondContact O-CB 3.34Å; L61-A65 PolarHBondContact O-N 3.32Å; A62-A65 PolarHBondContact O-N 3.16Å; A65-E68 PolarHBondContact O-N 3.24Å; A65-K69 WeakPolarHBondContact O-CB 3.28Å; A65-K69 PolarHBondContact O-N 3.08Å
66	E	91.6	Very high	88	Confident	95 Å²	95	106.8 Å²	106.8	44%	0.444	59%	0.592	S	S	.	*	H	α-helix	trans	-67.4	-38.5	175.7	-76	-63	143.2	0	0	112.2	A62 K63 E64 K69 M70	A62-E66 PolarHBondContact O-N 2.94Å; A62-E66 VanDerWaalsContact O-N 3.11Å; K63-E66 PolarHBondContact O-N 2.91Å; E64-E66 PolarHBondContact O-N 2.79Å; E66-K69 PolarHBondContact O-N 3.4Å; E66-K69 IonicContact OE1-NZ 2.85Å; E66-K69 PolarHBondContact OE1-NZ 3.33Å; E66-K69 IonicContact OE2-NZ 3.6Å; E66-K69 PolarHBondContact OE2-NZ 2.85Å; E66-M70 WeakPolarHBondContact O-CG 3.43Å; E66-M70 PolarHBondContact O-N 3.3Å
67	N	91.8	Very high	87.5	Confident	93 Å²	93	105.6 Å²	105.6	50%	0.497	59%	0.591	S	S	.	*	H	α-helix	trans	-61	-45.3	175.1	-77.5	-22.6	0	0	0	112.1	K63 E64 M70 K71	K63-N67 WeakPolarHBondContact O-CB 3.36Å; K63-N67 VanDerWaalsContact O-CG 3.28Å; K63-N67 PolarHBondContact O-N 3.34Å; K63-N67 PolarHBondContact O-ND2 3.23Å; E64-N67 PolarHBondContact O-N 2.76Å; N67-M70 PolarHBondContact O-N 2.72Å; N67-K71 WeakPolarHBondContact O-CG 3.49Å; N67-K71 PolarHBondContact O-N 3.01Å
68	E	89.4	Confident	86.9	Confident	104 Å²	104	105.5 Å²	105.5	49%	0.486	59%	0.594	S	S	.	*	H	α-helix	trans	-65	-40.1	177.4	-71.1	-55.9	136.1	0	0	111.8	E64 A65 M70 K71 V72	E64-E68 PolarHBondContact O-N 2.9Å; A65-E68 PolarHBondContact O-N 3.24Å; E68-M70 VanDerWaalsContact C-N 3.31Å; E68-M70 PolarHBondContact O-N 2.9Å; E68-K71 PolarHBondContact O-N 2.91Å; E68-K71 IonicContact OE1-NZ 3.42Å; E68-K71 PolarHBondContact OE1-NZ 2.99Å; E68-K71 IonicContact OE2-NZ 3.42Å; E68-V72 WeakPolarHBondContact O-CG2 3.34Å; E68-V72 PolarHBondContact O-N 3.05Å
69	K	86.9	Confident	86.2	Confident	120 Å²	120	107.1 Å²	107.1	52%	0.522	60%	0.6	S	S	.	*	H	α-helix	trans	-59.7	-39.9	174.6	-177.3	-179.8	159.1	-155	0	112.4	A65 E66 V72 S73	A65-K69 WeakPolarHBondContact O-CB 3.28Å; A65-K69 PolarHBondContact O-N 3.08Å; E66-K69 PolarHBondContact O-N 3.4Å; E66-K69 IonicContact OE1-NZ 2.85Å; E66-K69 PolarHBondContact OE1-NZ 3.33Å; E66-K69 IonicContact OE2-NZ 3.6Å; E66-K69 PolarHBondContact OE2-NZ 2.85Å; K69-V72 PolarHBondContact O-N 3.38Å; K69-S73 PolarHBondContact O-N 3.48Å; K69-S73 PolarHBondContact O-OG 3.21Å
70	M	82.8	Confident	85.5	Confident	134 Å²	134	108.4 Å²	108.4	66%	0.66	61%	0.609	S	S	*	*	H	α-helix	trans	-64.5	-39.6	175.4	-73.1	-170.8	-177.3	0	0	112.6	E66 N67 E68 V72 S73 G74	E66-M70 WeakPolarHBondContact O-CG 3.43Å; E66-M70 PolarHBondContact O-N 3.3Å; N67-M70 PolarHBondContact O-N 2.72Å; E68-M70 VanDerWaalsContact C-N 3.31Å; E68-M70 PolarHBondContact O-N 2.9Å; M70-V72 VanDerWaalsContact C-N 3.31Å; M70-V72 PolarHBondContact O-N 3.37Å; M70-S73 PolarHBondContact O-N 3.46Å; M70-G74 PolarHBondContact O-N 2.75Å
71	K	82.8	Confident	84.6	Confident	136 Å²	136	108 Å²	108	59%	0.591	61%	0.614	S	S	*	*	H	α-helix	trans	-65.2	-31.4	179	-68.4	174	-171.2	170	0	113.7	N67 E68	N67-K71 WeakPolarHBondContact O-CG 3.49Å; N67-K71 PolarHBondContact O-N 3.01Å; E68-K71 PolarHBondContact O-N 2.91Å; E68-K71 IonicContact OE1-NZ 3.42Å; E68-K71 PolarHBondContact OE1-NZ 2.99Å; E68-K71 IonicContact OE2-NZ 3.42Å
72	V	74.4	Confident	83.8	Confident	124 Å²	124	107.8 Å²	107.8	75%	0.752	62%	0.617	S	S	*	*	H	α-helix	trans	-82.1	-19.1	179.5	179.8	0	0	0	0	111.9	E68 K69 M70	E68-V72 WeakPolarHBondContact O-CG2 3.34Å; E68-V72 PolarHBondContact O-N 3.05Å; K69-V72 PolarHBondContact O-N 3.38Å; M70-V72 VanDerWaalsContact C-N 3.31Å; M70-V72 PolarHBondContact O-N 3.37Å
73	S	60	Low	82.8	Confident	99 Å²	99	112.2 Å²	112.2	69%	0.692	63%	0.631	S	S	*	*	H	α-helix	trans	-95.7	-6.3	-176	-49.8	0	0	0	0	114.1	K69 M70	K69-S73 PolarHBondContact O-N 3.48Å; K69-S73 PolarHBondContact O-OG 3.21Å; M70-S73 PolarHBondContact O-N 3.46Å
74	G	51.2	Low	81.6	Confident	124 Å²	124	109.5 Å²	109.5	100%	1.278	63%	0.632	S	S	*	*			trans	-110.9	0	176.8	0	0	0	0	0	112	M70	M70-G74 PolarHBondContact O-N 2.75Å

Retrieved 74 of 74 residues in 41.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).