A0A087X2B5_HUMAN Loading...

Basigin (Ok blood group)

AlphaFold DB , UniProt , Accession A0A087X2B5, Species HUMAN (Homo sapiens, Human), Gene BSG, Length 54 aa.

						>A0A087X2B5_HUMAN|A0A087X2B5|BSG
MAAALFVLLGFALLGTHGASGAGWTPTTSGESTPASSSPSPWARPTSSSTGLPE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.3	Low	79.7	Confident	220 Å²	220	110.8 Å²	110.8	100%	1.084	63%	0.633	S	S	*	*				0	-42.6	0	-73.9	171.8	-177.8	0	0	112.8	A3 A4	M1-A3 PolarHBondContact O-N 3.48Å; M1-A4 PolarHBondContact O-N 3.09Å
2	A	71.9	Confident	79.8	Confident	78 Å²	78	106.3 Å²	106.3	65%	0.645	62%	0.619	S	S	*	*	H	α-helix	trans	-60.2	-37.4	-179.1	0	0	0	0	0	115.5	A4 L5 F6	A2-A4 VanDerWaalsContact C-N 3.31Å; A2-A4 PolarHBondContact O-N 3.16Å; A2-L5 PolarHBondContact O-N 2.75Å; A2-L5 VanDerWaalsContact O-N 3.14Å; A2-F6 PolarHBondContact O-N 2.83Å; A2-F6 VanDerWaalsContact O-N 3.11Å
3	A	72.9	Confident	79.7	Confident	76 Å²	76	104.4 Å²	104.4	63%	0.628	60%	0.604	S	S	*	*	H	α-helix	trans	-61.3	-38.1	-179.6	0	0	0	0	0	113	M1 L5 F6 V7	M1-A3 PolarHBondContact O-N 3.48Å; A3-L5 VanDerWaalsContact C-N 3.3Å; A3-L5 PolarHBondContact O-N 2.98Å; A3-F6 PolarHBondContact O-N 2.77Å; A3-V7 VanDerWaalsContact O-CG2 3.32Å; A3-V7 WeakPolarHBondContact O-CG2 3.46Å; A3-V7 PolarHBondContact O-N 2.87Å
4	A	80.9	Confident	79.4	Confident	57 Å²	57	104.5 Å²	104.5	47%	0.471	60%	0.601	S	S	.	*	H	α-helix	trans	-64.2	-38	177.2	0	0	0	0	0	111.5	M1 A2 V7 L8	M1-A4 PolarHBondContact O-N 3.09Å; A2-A4 VanDerWaalsContact C-N 3.31Å; A2-A4 PolarHBondContact O-N 3.16Å; A4-V7 PolarHBondContact O-N 2.96Å; A4-L8 WeakPolarHBondContact O-CB 3.14Å; A4-L8 VanDerWaalsContact O-CG 3.23Å; A4-L8 WeakPolarHBondContact O-CG 3.43Å; A4-L8 PolarHBondContact O-N 2.71Å
5	L	85.9	Confident	78.3	Confident	120 Å²	120	100.8 Å²	100.8	63%	0.628	59%	0.594	S	S	*	*	H	α-helix	trans	-68.5	-38.3	178	-54.7	-174.5	0	0	0	111.7	A2 A3 L8 L9	A2-L5 PolarHBondContact O-N 2.75Å; A2-L5 VanDerWaalsContact O-N 3.14Å; A3-L5 VanDerWaalsContact C-N 3.3Å; A3-L5 PolarHBondContact O-N 2.98Å; L5-L8 PolarHBondContact O-N 2.84Å; L5-L9 VanDerWaalsContact O-CB 3.24Å; L5-L9 WeakPolarHBondContact O-CB 3.28Å; L5-L9 PolarHBondContact O-N 2.85Å
6	F	85.6	Confident	77.3	Confident	159 Å²	159	101.1 Å²	101.1	70%	0.697	60%	0.597	S	S	*	*	H	α-helix	trans	-65.9	-40.6	176	-176.3	-100.3	0	0	0	112.3	A2 A3 L9 G10	A2-F6 PolarHBondContact O-N 2.83Å; A2-F6 VanDerWaalsContact O-N 3.11Å; A3-F6 PolarHBondContact O-N 2.77Å; F6-L9 PolarHBondContact O-N 3.15Å; F6-G10 PolarHBondContact O-N 3.06Å
7	V	85.3	Confident	76	Confident	100 Å²	100	101.5 Å²	101.5	61%	0.606	59%	0.592	S	S	*	*	H	α-helix	trans	-65.5	-44.6	175.9	172.7	0	0	0	0	111.2	A3 A4 G10 F11	A3-V7 VanDerWaalsContact O-CG2 3.32Å; A3-V7 WeakPolarHBondContact O-CG2 3.46Å; A3-V7 PolarHBondContact O-N 2.87Å; A4-V7 PolarHBondContact O-N 2.96Å; V7-G10 PolarHBondContact O-N 2.93Å; V7-F11 PolarHBondContact O-N 2.72Å
8	L	86.4	Confident	74.6	Confident	116 Å²	116	97.7 Å²	97.7	61%	0.607	58%	0.578	S	S	*	*	H	α-helix	trans	-64.2	-40.7	176.6	-70.4	171.6	0	0	0	111.9	A4 L5 F11 A12	A4-L8 WeakPolarHBondContact O-CB 3.14Å; A4-L8 VanDerWaalsContact O-CG 3.23Å; A4-L8 WeakPolarHBondContact O-CG 3.43Å; A4-L8 PolarHBondContact O-N 2.71Å; L5-L8 PolarHBondContact O-N 2.84Å; L8-F11 PolarHBondContact O-N 3.02Å; L8-A12 VanDerWaalsContact O-CB 3.29Å; L8-A12 WeakPolarHBondContact O-CB 3.46Å; L8-A12 PolarHBondContact O-N 2.82Å
9	L	85.6	Confident	73.5	Confident	99 Å²	99	96.8 Å²	96.8	52%	0.518	58%	0.583	S	S	.	*	H	α-helix	trans	-64.4	-44.2	175.1	179.9	61.1	0	0	0	111.4	L5 F6 F11 A12 L13	L5-L9 VanDerWaalsContact O-CB 3.24Å; L5-L9 WeakPolarHBondContact O-CB 3.28Å; L5-L9 PolarHBondContact O-N 2.85Å; F6-L9 PolarHBondContact O-N 3.15Å; L9-F11 PolarHBondContact O-N 2.96Å; L9-A12 PolarHBondContact O-N 2.9Å; L9-L13 HydrophobicContact CD1-CD1 4.02Å; L9-L13 HydrophobicContact CD1-CG 4.15Å; L9-L13 HydrophobicContact CG-CD1 3.96Å; L9-L13 HydrophobicContact CG-CG 4.49Å; L9-L13 WeakPolarHBondContact O-CB 3.23Å; L9-L13 VanDerWaalsContact O-CG 3.23Å; L9-L13 WeakPolarHBondContact O-CG 3.29Å; L9-L13 PolarHBondContact O-N 2.95Å
10	G	83.6	Confident	72.6	Confident	38 Å²	38	97.6 Å²	97.6	39%	0.392	59%	0.593	S	S	.	*	H	α-helix	trans	-61	-42.1	176.1	0	0	0	0	0	112.8	F6 V7 L14	F6-G10 PolarHBondContact O-N 3.06Å; V7-G10 PolarHBondContact O-N 2.93Å; G10-L14 VanDerWaalsContact O-CB 3.28Å; G10-L14 WeakPolarHBondContact O-CB 3.29Å; G10-L14 PolarHBondContact O-N 3.17Å
11	F	80.3	Confident	71.6	Confident	156 Å²	156	95.1 Å²	95.1	68%	0.684	59%	0.587	S	S	*	*	H	α-helix	trans	-68.4	-42.2	176.3	-175	-96.8	0	0	0	112.6	V7 L8 L9 L14 G15	V7-F11 PolarHBondContact O-N 2.72Å; L8-F11 PolarHBondContact O-N 3.02Å; L9-F11 PolarHBondContact O-N 2.96Å; F11-L14 WeakPolarHBondContact O-CB 3.23Å; F11-L14 PolarHBondContact O-N 2.95Å; F11-G15 PolarHBondContact O-N 3.37Å
12	A	80.5	Confident	71.3	Confident	56 Å²	56	88.7 Å²	88.7	46%	0.463	57%	0.569	S	S	.	*	H	α-helix	trans	-61.8	-45.7	176.6	0	0	0	0	0	111.1	L8 L9 G15 T16	L8-A12 VanDerWaalsContact O-CB 3.29Å; L8-A12 WeakPolarHBondContact O-CB 3.46Å; L8-A12 PolarHBondContact O-N 2.82Å; L9-A12 PolarHBondContact O-N 2.9Å; A12-G15 PolarHBondContact O-N 3.04Å; A12-T16 WeakPolarHBondContact O-CG2 3.43Å; A12-T16 PolarHBondContact O-N 3.21Å
13	L	78.3	Confident	70.3	Confident	82 Å²	82	88 Å²	88	43%	0.429	57%	0.57	S	S	.	*	H	α-helix	trans	-60.4	-48.1	173.2	-68.5	171.6	0	0	0	109.6	L9 G15 T16 H17	L9-L13 HydrophobicContact CD1-CD1 4.02Å; L9-L13 HydrophobicContact CD1-CG 4.15Å; L9-L13 HydrophobicContact CG-CD1 3.96Å; L9-L13 HydrophobicContact CG-CG 4.49Å; L9-L13 WeakPolarHBondContact O-CB 3.23Å; L9-L13 VanDerWaalsContact O-CG 3.23Å; L9-L13 WeakPolarHBondContact O-CG 3.29Å; L9-L13 PolarHBondContact O-N 2.95Å; L13-G15 VanDerWaalsContact C-N 3.28Å; L13-G15 PolarHBondContact O-N 3.45Å; L13-T16 PolarHBondContact O-N 3Å; L13-T16 PolarHBondContact O-OG1 2.89Å; L13-H17 VanDerWaalsContact C-NE2 3.25Å; L13-H17 WeakPolarHBondContact CB-NE2 3.28Å; L13-H17 PolarHBondContact O-CD2 3.24Å; L13-H17 PolarHBondContact O-CE1 2.74Å; L13-H17 PolarHBondContact O-N 3.48Å; L13-H17 VanDerWaalsContact O-N 3.09Å; L13-H17 PolarHBondContact O-ND1 2.91Å; L13-H17 PolarHBondContact O-NE2 3.23Å
14	L	76.4	Confident	69.5	Low	106 Å²	106	95.8 Å²	95.8	56%	0.555	58%	0.583	S	S	*	*	H	α-helix	trans	-51.2	-41.3	176.7	-167.6	58.6	0	0	0	113.8	G10 F11 H17 G18	G10-L14 VanDerWaalsContact O-CB 3.28Å; G10-L14 WeakPolarHBondContact O-CB 3.29Å; G10-L14 PolarHBondContact O-N 3.17Å; F11-L14 WeakPolarHBondContact O-CB 3.23Å; F11-L14 PolarHBondContact O-N 2.95Å; L14-H17 WeakPolarHBondContact CA-CE1 3.49Å; L14-H17 WeakPolarHBondContact CA-ND1 3.32Å; L14-H17 PolarHBondContact N-CE1 2.9Å; L14-H17 PolarHBondContact O-ND1 3.45Å; L14-G18 VanDerWaalsContact O-CA 3.29Å; L14-G18 WeakPolarHBondContact O-CA 3.37Å; L14-G18 PolarHBondContact O-N 3.04Å
15	G	63.1	Low	68.3	Low	49 Å²	49	98 Å²	98	51%	0.505	59%	0.591	S	S	.	*	H	α-helix	trans	-66.8	-39	174.4	0	0	0	0	0	113.8	F11 A12 L13 A19	F11-G15 PolarHBondContact O-N 3.37Å; A12-G15 PolarHBondContact O-N 3.04Å; L13-G15 VanDerWaalsContact C-N 3.28Å; L13-G15 PolarHBondContact O-N 3.45Å; G15-A19 PolarHBondContact O-N 3.37Å
16	T	61.1	Low	66.6	Low	105 Å²	105	97.9 Å²	97.9	64%	0.644	60%	0.597	S	S	*	*	H	α-helix	trans	-72.1	-31.8	-179.2	63.7	0	0	0	0	113.9	A12 L13	A12-T16 WeakPolarHBondContact O-CG2 3.43Å; A12-T16 PolarHBondContact O-N 3.21Å; L13-T16 PolarHBondContact O-N 3Å; L13-T16 PolarHBondContact O-OG1 2.89Å
17	H	56.7	Low	65.1	Low	108 Å²	108	95.8 Å²	95.8	50%	0.5	60%	0.598	S	S	.	*	H	α-helix	trans	-103.3	-5.7	176.6	40.3	50.3	0	0	0	114.4	L13 L14 S20	L13-H17 VanDerWaalsContact C-NE2 3.25Å; L13-H17 WeakPolarHBondContact CB-NE2 3.28Å; L13-H17 PolarHBondContact O-CD2 3.24Å; L13-H17 PolarHBondContact O-CE1 2.74Å; L13-H17 PolarHBondContact O-N 3.48Å; L13-H17 VanDerWaalsContact O-N 3.09Å; L13-H17 PolarHBondContact O-ND1 2.91Å; L13-H17 PolarHBondContact O-NE2 3.23Å; L14-H17 WeakPolarHBondContact CA-CE1 3.49Å; L14-H17 WeakPolarHBondContact CA-ND1 3.32Å; L14-H17 PolarHBondContact N-CE1 2.9Å; L14-H17 PolarHBondContact O-ND1 3.45Å; H17-S20 PolarHBondContact O-OG 3.45Å
18	G	49.9	Very low	63.5	Low	34 Å²	34	97.3 Å²	97.3	35%	0.351	61%	0.607	S	S	.	*	H	α-helix	trans	-84.5	-20.8	171.9	0	0	0	0	0	113.6	L14 S20 G21 A22	L14-G18 VanDerWaalsContact O-CA 3.29Å; L14-G18 WeakPolarHBondContact O-CA 3.37Å; L14-G18 PolarHBondContact O-N 3.04Å; G18-S20 VanDerWaalsContact C-N 3.26Å; G18-S20 PolarHBondContact O-N 3.36Å; G18-G21 PolarHBondContact O-N 3.35Å; G18-A22 PolarHBondContact O-N 2.96Å
19	A	54.7	Low	62.1	Low	80 Å²	80	96.9 Å²	96.9	66%	0.661	61%	0.614	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68	-23.5	176.3	0	0	0	0	0	113.2	G15 G21	G15-A19 PolarHBondContact O-N 3.37Å; A19-G21 VanDerWaalsContact C-N 3.3Å
20	S	54.3	Low	61	Low	112 Å²	112	95.7 Å²	95.7	78%	0.783	63%	0.625	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.8	-2	171.2	60.5	0	0	0	0	113.8	H17 G18	H17-S20 PolarHBondContact O-OG 3.45Å; G18-S20 VanDerWaalsContact C-N 3.26Å; G18-S20 PolarHBondContact O-N 3.36Å
21	G	53	Low	59.5	Low	46 Å²	46	101.4 Å²	101.4	47%	0.474	64%	0.642	S	S	.	*	T	Hydrogen-bonded Turn	trans	-113.2	-8.6	179.1	0	0	0	0	0	114.6	G18 A19 G23	G18-G21 PolarHBondContact O-N 3.35Å; A19-G21 VanDerWaalsContact C-N 3.3Å; G21-G23 PolarHBondContact O-N 3.21Å
22	A	50.3	Low	58.4	Low	86 Å²	86	98.8 Å²	98.8	71%	0.711	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.1	26.9	176.7	0	0	0	0	0	113.6	G18 W24	G18-A22 PolarHBondContact O-N 2.96Å; A22-W24 VanDerWaalsContact C-N 3.34Å
23	G	52.2	Low	57	Low	64 Å²	64	101.9 Å²	101.9	66%	0.66	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.4	10.1	171.5	0	0	0	0	0	113.8	G21 T25	G21-G23 PolarHBondContact O-N 3.21Å; G23-T25 VanDerWaalsContact C-N 3.27Å; G23-T25 PolarHBondContact O-N 3.47Å
24	W	55.7	Low	55.8	Low	239 Å²	239	103.4 Å²	103.4	91%	0.905	67%	0.671	S	S	*	*			trans	-87.2	75.4	169.3	-74.6	73.8	0	0	0	108.9	A22 P26	A22-W24 VanDerWaalsContact C-N 3.34Å; W24-P26 WeakPolarHBondContact O-CD 3.47Å
25	T	54.6	Low	55.1	Low	104 Å²	104	102.5 Å²	102.5	64%	0.638	68%	0.679	S	S	*	*			trans	-67.3	123.8	157.3	52.9	0	0	0	0	106.8	G23 T27	G23-T25 VanDerWaalsContact C-N 3.27Å; G23-T25 PolarHBondContact O-N 3.47Å; T25-T27 VanDerWaalsContact C-N 3.3Å; T25-T27 PolarHBondContact O-N 2.88Å
26	P	52.2	Low	54.4	Low	117 Å²	117	105.5 Å²	105.5	76%	0.76	69%	0.692	S	S	*	*			trans	-66.1	101.5	162.9	-8.2	24	0	0	0	105.2	W24 T28	W24-P26 WeakPolarHBondContact O-CD 3.47Å; P26-T28 PolarHBondContact O-N 3.21Å
27	T	53.9	Low	54.3	Low	115 Å²	115	105.7 Å²	105.7	71%	0.706	70%	0.698	S	S	*	*			trans	-63.5	95.8	166.9	47.6	0	0	0	0	106.5	T25 S29	T25-T27 VanDerWaalsContact C-N 3.3Å; T25-T27 PolarHBondContact O-N 2.88Å; T27-S29 PolarHBondContact O-N 2.92Å
28	T	51.8	Low	54.3	Low	132 Å²	132	105.3 Å²	105.3	81%	0.81	71%	0.707	S	S	*	*			trans	-62	89.7	154.6	52.5	0	0	0	0	105.2	P26 G30	P26-T28 PolarHBondContact O-N 3.21Å; T28-G30 PolarHBondContact O-N 3.04Å
29	S	57	Low	54.8	Low	107 Å²	107	109 Å²	109	75%	0.748	73%	0.725	S	S	*	*			trans	-72.3	67.8	175.4	56.2	0	0	0	0	109	T27	T27-S29 PolarHBondContact O-N 2.92Å
30	G	60.7	Low	55.3	Low	73 Å²	73	108.5 Å²	108.5	75%	0.753	72%	0.717	S	S	*	*			trans	-103.3	63.5	155.5	0	0	0	0	0	107.3	T28	T28-G30 PolarHBondContact O-N 3.04Å
31	E	52.7	Low	55.7	Low	159 Å²	159	109 Å²	109	74%	0.743	72%	0.717	S	S	*	*	S	Bend	trans	-159.1	135.2	157.8	-169.4	53.6	86.8	0	0	108.3	T33	E31-T33 PolarHBondContact O-N 3.42Å; E31-T33 VanDerWaalsContact O-N 3.16Å
32	S	56.8	Low	56	Low	100 Å²	100	117.9 Å²	117.9	70%	0.699	74%	0.737	S	S	*	*			trans	-64.5	109.7	-163.9	-47.1	0	0	0	0	110.7	P34	S32-P34 WeakPolarHBondContact O-CD 3.1Å; S32-P34 VanDerWaalsContact O-N 3.08Å
33	T	51.8	Low	56.6	Low	122 Å²	122	117 Å²	117	75%	0.748	73%	0.729	S	S	*	*			trans	-57.5	113.9	164.5	-53.5	0	0	0	0	107.2	E31 A35	E31-T33 PolarHBondContact O-N 3.42Å; E31-T33 VanDerWaalsContact O-N 3.16Å; T33-A35 PolarHBondContact O-N 2.91Å
34	P	53.9	Low	57.1	Low	114 Å²	114	124.5 Å²	124.5	74%	0.74	74%	0.738	S	S	*	*			trans	-62.4	115.1	162.9	25.8	-26.3	0	0	0	103.9	S32 S36	S32-P34 WeakPolarHBondContact O-CD 3.1Å; S32-P34 VanDerWaalsContact O-N 3.08Å; P34-S36 VanDerWaalsContact C-N 3.29Å; P34-S36 PolarHBondContact O-N 2.84Å
35	A	60	Low	57.3	Low	87 Å²	87	118.6 Å²	118.6	72%	0.719	73%	0.73	S	S	*	*			trans	-52.5	102.9	178.8	0	0	0	0	0	106.7	T33 S37	T33-A35 PolarHBondContact O-N 2.91Å; A35-S37 PolarHBondContact O-N 2.8Å
36	S	49	Very low	57.3	Low	112 Å²	112	119.6 Å²	119.6	78%	0.783	74%	0.736	S	S	*	*			trans	-64.7	91	170.8	175.4	0	0	0	0	104.1	P34 S38	P34-S36 VanDerWaalsContact C-N 3.29Å; P34-S36 PolarHBondContact O-N 2.84Å; S36-S38 PolarHBondContact O-N 3.32Å
37	S	58.9	Low	57.1	Low	109 Å²	109	119.6 Å²	119.6	76%	0.762	74%	0.739	S	S	*	*			trans	-66.6	79.5	174	48.8	0	0	0	0	106.6	A35 P39	A35-S37 PolarHBondContact O-N 2.8Å; S37-P39 VanDerWaalsContact O-CD 3.28Å; S37-P39 WeakPolarHBondContact O-CD 3.25Å; S37-P39 VanDerWaalsContact O-N 3.13Å
38	S	56.7	Low	57.2	Low	99 Å²	99	118.9 Å²	118.9	69%	0.692	74%	0.739	S	S	*	*			trans	-59	113.1	171.1	-163.7	0	0	0	0	105.9	S36 S40	S36-S38 PolarHBondContact O-N 3.32Å; S38-S40 PolarHBondContact O-N 3.09Å
39	P	61.2	Low	57.5	Low	113 Å²	113	118.2 Å²	118.2	73%	0.734	74%	0.739	S	S	*	*			trans	-63.9	116	-179	25.2	-29.9	0	0	0	106.7	S37	S37-P39 VanDerWaalsContact O-CD 3.28Å; S37-P39 WeakPolarHBondContact O-CD 3.25Å; S37-P39 VanDerWaalsContact O-N 3.13Å
40	S	65.5	Low	57.6	Low	69 Å²	69	119 Å²	119	48%	0.483	74%	0.74	S	S	.	*			trans	-58.7	125.5	178.5	-175	0	0	0	0	108.2	S38 W42 A43	S38-S40 PolarHBondContact O-N 3.09Å; S40-W42 PolarHBondContact O-N 3.21Å; S40-A43 VanDerWaalsContact O-CB 3.23Å; S40-A43 WeakPolarHBondContact O-CB 3.24Å; S40-A43 PolarHBondContact O-N 3.43Å
41	P	61.9	Low	57.2	Low	123 Å²	123	118.4 Å²	118.4	80%	0.799	73%	0.734	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65	-12.2	179.7	26.2	-33.9	0	0	0	112.4
42	W	60	Low	57	Low	232 Å²	232	118.8 Å²	118.8	88%	0.879	74%	0.74	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.2	3.8	174.7	-64.4	105.9	0	0	0	113.6	S40 R44	S40-W42 PolarHBondContact O-N 3.21Å; W42-R44 PolarHBondContact O-N 3.14Å
43	A	63.2	Low	56.9	Low	67 Å²	67	119.7 Å²	119.7	55%	0.554	74%	0.744	S	S	*	*			trans	-61.9	108.9	173.1	0	0	0	0	0	108.1	S40 P45	S40-A43 VanDerWaalsContact O-CB 3.23Å; S40-A43 WeakPolarHBondContact O-CB 3.24Å; S40-A43 PolarHBondContact O-N 3.43Å; A43-P45 WeakPolarHBondContact O-CD 3.23Å
44	R	61.1	Low	56.7	Low	222 Å²	222	126.9 Å²	126.9	84%	0.838	77%	0.769	S	S	*	*			trans	-55.7	122.7	179.5	-163.1	179.1	-168.9	-165	2.8	107.6	W42 T46	W42-R44 PolarHBondContact O-N 3.14Å; R44-T46 PolarHBondContact O-N 3.37Å
45	P	60.4	Low	56.9	Low	115 Å²	115	127.5 Å²	127.5	75%	0.747	77%	0.77	S	S	*	*			trans	-63.9	103.9	176.9	22.3	-28.7	0	0	0	107.7	A43 S47	A43-P45 WeakPolarHBondContact O-CD 3.23Å; P45-S47 PolarHBondContact O-N 3.48Å; P45-S47 VanDerWaalsContact O-N 3.15Å
46	T	54.1	Low	56.7	Low	125 Å²	125	129.6 Å²	129.6	77%	0.767	77%	0.773	S	S	*	*			trans	-74.5	100.6	165	51.5	0	0	0	0	105.4	R44 S48	R44-T46 PolarHBondContact O-N 3.37Å; T46-S48 VanDerWaalsContact C-N 3.33Å; T46-S48 PolarHBondContact O-N 3.36Å
47	S	49.4	Very low	57.2	Low	117 Å²	117	130.6 Å²	130.6	82%	0.818	77%	0.772	S	S	*	*			trans	-54.9	99.5	171.9	-51.8	0	0	0	0	108.3	P45 S49	P45-S47 PolarHBondContact O-N 3.48Å; P45-S47 VanDerWaalsContact O-N 3.15Å; S47-S49 VanDerWaalsContact C-N 3.29Å; S47-S49 PolarHBondContact O-N 3.03Å
48	S	54.8	Low	57.1	Low	100 Å²	100	131.9 Å²	131.9	70%	0.699	77%	0.773	S	S	*	*			trans	-73.3	94	167.9	57.7	0	0	0	0	106.4	T46 T50	T46-S48 VanDerWaalsContact C-N 3.33Å; T46-S48 PolarHBondContact O-N 3.36Å; S48-T50 PolarHBondContact O-N 3.35Å
49	S	59.4	Low	57.1	Low	117 Å²	117	133.9 Å²	133.9	82%	0.818	78%	0.778	S	S	*	*			trans	-57.4	94.3	161.2	-179.9	0	0	0	0	107.1	S47 G51	S47-S49 VanDerWaalsContact C-N 3.29Å; S47-S49 PolarHBondContact O-N 3.03Å; S49-G51 PolarHBondContact O-N 3.31Å
50	T	58.5	Low	56.8	Low	124 Å²	124	135.3 Å²	135.3	76%	0.761	78%	0.781	S	S	*	*			trans	-78.1	86.2	163.7	11.2	0	0	0	0	105.2	S48 L52	S48-T50 PolarHBondContact O-N 3.35Å; T50-L52 PolarHBondContact O-N 3.11Å; T50-L52 VanDerWaalsContact O-N 3.09Å
51	G	52.4	Low	56.2	Low	61 Å²	61	140.1 Å²	140.1	63%	0.629	80%	0.802	S	S	*	*			trans	-54	112.9	155.6	0	0	0	0	0	107	S49	S49-G51 PolarHBondContact O-N 3.31Å
52	L	47	Very low	55.7	Low	166 Å²	166	141.4 Å²	141.4	87%	0.869	80%	0.802	S	S	*	*			trans	-61.9	127.5	169	-74.8	159.1	0	0	0	107.7	T50 E54	T50-L52 PolarHBondContact O-N 3.11Å; T50-L52 VanDerWaalsContact O-N 3.09Å; L52-E54 PolarHBondContact O-N 2.87Å
53	P	55.3	Low	55.4	Low	120 Å²	120	133.8 Å²	133.8	78%	0.779	80%	0.796	S	S	*	*			trans	-77.1	121	163.9	29.8	-27.3	0	0	0	109.1
54	E	49	Very low	54.7	Low	272 Å²	272	139.9 Å²	139.9	100%	1.271	82%	0.818	S	S	*	*			trans	53.5	0	160.6	-50.7	-151.5	129.6	0	0	120.1	L52	L52-E54 PolarHBondContact O-N 2.87Å

Retrieved 54 of 54 residues in 33.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).