A0A087X2G0_HUMAN Loading...

RAR related orphan receptor A

AlphaFold DB , UniProt , Accession A0A087X2G0, Species HUMAN (Homo sapiens, Human), Gene RORA, Length 38 aa.

						>A0A087X2G0_HUMAN|A0A087X2G0|RORA
AAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRDWHA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	A	46.5	Very low	62.7	Low	155 Å²	155	128.5 Å²	128.5	100%	1.281	80%	0.804	S	S	*	*				0	117.2	0	0	0	0	0	0	107.5
2	A	52.3	Low	63.3	Low	104 Å²	104	131.6 Å²	131.6	86%	0.86	80%	0.801	S	S	*	*	P	Polyproline II helix	trans	-76.1	126.9	179.1	0	0	0	0	0	108.8	G4	A2-G4 PolarHBondContact O-N 3.32Å
3	A	53.3	Low	63.6	Low	96 Å²	96	132.8 Å²	132.8	79%	0.793	79%	0.792	S	S	*	*	P	Polyproline II helix	trans	-53.8	127.3	179.3	0	0	0	0	0	109.9	S5	A3-S5 PolarHBondContact O-N 2.97Å; A3-S5 VanDerWaalsContact O-N 3.16Å
4	G	54.7	Low	63.6	Low	69 Å²	69	130.6 Å²	130.6	71%	0.711	79%	0.787	S	S	*	*	P	Polyproline II helix	trans	-57.8	117.7	-179.9	0	0	0	0	0	110.9	A2 R6	A2-G4 PolarHBondContact O-N 3.32Å; G4-R6 PolarHBondContact O-N 3.16Å
5	S	63.7	Low	63.9	Low	101 Å²	101	126.9 Å²	126.9	71%	0.706	78%	0.775	S	S	*	*			trans	-54.8	105.6	165.6	-55.2	0	0	0	0	108	A3 E7	A3-S5 PolarHBondContact O-N 2.97Å; A3-S5 VanDerWaalsContact O-N 3.16Å; S5-E7 PolarHBondContact O-N 2.96Å
6	R	62.7	Low	64.4	Low	236 Å²	236	131.6 Å²	131.6	89%	0.891	78%	0.775	S	S	*	*			trans	-74.3	87.7	170.2	-76.1	170.5	70.4	159.3	0.4	106.8	G4 T8	G4-R6 PolarHBondContact O-N 3.16Å; R6-T8 PolarHBondContact O-N 2.95Å
7	E	68.5	Low	64.9	Low	164 Å²	164	135.7 Å²	135.7	77%	0.766	78%	0.781	S	S	*	*			trans	-50.4	107.3	171.1	-55	-74.2	89.9	0	0	107.6	S5 P9	S5-E7 PolarHBondContact O-N 2.96Å; E7-P9 WeakPolarHBondContact O-CD 3.43Å
8	T	74.1	Confident	65.7	Low	127 Å²	127	134.2 Å²	134.2	78%	0.779	78%	0.779	S	S	*	*			trans	-70.5	121.3	169.8	-59.9	0	0	0	0	105.8	R6 L10	R6-T8 PolarHBondContact O-N 2.95Å; T8-L10 PolarHBondContact O-N 3.26Å
9	P	70.8	Confident	66.6	Low	119 Å²	119	136.4 Å²	136.4	77%	0.773	78%	0.782	S	S	*	*			trans	-60.2	113.8	179.5	22.5	-30.4	0	0	0	108.4	E7 N11	E7-P9 WeakPolarHBondContact O-CD 3.43Å; P9-N11 PolarHBondContact O-N 2.94Å
10	L	72.9	Confident	67.5	Low	154 Å²	154	134.7 Å²	134.7	81%	0.806	78%	0.776	S	S	*	*			trans	-62.5	123.4	176	-178.8	64.9	0	0	0	107.6	T8 Q12	T8-L10 PolarHBondContact O-N 3.26Å; L10-Q12 PolarHBondContact O-N 2.96Å
11	N	70.6	Confident	68.3	Low	89 Å²	89	134.3 Å²	134.3	48%	0.476	78%	0.778	S	S	.	*			trans	-59.2	109	178.5	-175.8	-22.4	0	0	0	109.6	P9 E13 S14	P9-N11 PolarHBondContact O-N 2.94Å; N11-E13 PolarHBondContact O-N 3.29Å; N11-E13 VanDerWaalsContact OD1-CB 3.25Å; N11-E13 WeakPolarHBondContact OD1-CB 3.42Å; N11-E13 PolarHBondContact OD1-N 3.49Å; N11-S14 PolarHBondContact O-N 3.24Å
12	Q	69	Low	70.2	Confident	165 Å²	165	130.9 Å²	130.9	77%	0.771	75%	0.75	S	S	*	*	G	3₁₀ helix	trans	-69.6	-16.1	-178.1	-63.5	-170.1	33.5	0	0	113.1	L10 S14 A15	L10-Q12 PolarHBondContact O-N 2.96Å; Q12-S14 VanDerWaalsContact C-N 3.3Å; Q12-S14 PolarHBondContact O-N 3.23Å; Q12-A15 PolarHBondContact O-N 3.3Å; Q12-A15 WeakPolarHBondContact O-CB 3.25Å
13	E	67.1	Low	71.9	Confident	147 Å²	147	132 Å²	132	69%	0.687	75%	0.748	S	S	*	*	G	3₁₀ helix	trans	-66.1	-34.9	174.1	-71.8	175.3	55.3	0	0	111.6	N11 A15 R16	N11-E13 PolarHBondContact O-N 3.29Å; N11-E13 VanDerWaalsContact OD1-CB 3.25Å; N11-E13 WeakPolarHBondContact OD1-CB 3.42Å; N11-E13 PolarHBondContact OD1-N 3.49Å; E13-A15 PolarHBondContact O-N 2.87Å; E13-R16 PolarHBondContact O-N 3.3Å
14	S	64.5	Low	73.7	Confident	103 Å²	103	134.2 Å²	134.2	72%	0.72	75%	0.752	S	S	*	*	G	3₁₀ helix	trans	-70.4	-16.1	175.8	-56	0	0	0	0	113.3	N11 Q12 R16	N11-S14 PolarHBondContact O-N 3.24Å; Q12-S14 VanDerWaalsContact C-N 3.3Å; Q12-S14 PolarHBondContact O-N 3.23Å; S14-R16 VanDerWaalsContact C-N 3.3Å
15	A	67.1	Low	75.2	Confident	74 Å²	74	141.2 Å²	141.2	61%	0.612	76%	0.757	S	S	*	*	G	3₁₀ helix	trans	-80.7	-11.3	176.5	0	0	0	0	0	112.7	Q12 E13 K17	Q12-A15 PolarHBondContact O-N 3.3Å; Q12-A15 WeakPolarHBondContact O-CB 3.25Å; E13-A15 PolarHBondContact O-N 2.87Å; A15-K17 PolarHBondContact O-N 3.33Å
16	R	72.3	Confident	76.4	Confident	203 Å²	203	146.3 Å²	146.3	77%	0.766	76%	0.76	S	S	*	*	S	Bend	trans	-77.4	114.3	175.9	-60	-172.7	-168.1	-122.4	3.6	109.2	E13 S14 S18	E13-R16 PolarHBondContact O-N 3.3Å; S14-R16 VanDerWaalsContact C-N 3.3Å; R16-S18 PolarHBondContact O-N 3.2Å
17	K	72.9	Confident	77.7	Confident	201 Å²	201	143.6 Å²	143.6	87%	0.874	76%	0.758	S	S	*	*	P	Polyproline II helix	trans	-64.4	118.3	167.6	-61.1	-62.9	-176.2	-176.1	0	107.4	A15	A15-K17 PolarHBondContact O-N 3.33Å
18	S	79.4	Confident	78.5	Confident	108 Å²	108	140.4 Å²	140.4	76%	0.755	75%	0.754	S	S	*	*	P	Polyproline II helix	trans	-60.9	145.6	172	59.3	0	0	0	0	109.7	R16	R16-S18 PolarHBondContact O-N 3.2Å
19	E	83.6	Confident	78.9	Confident	177 Å²	177	145 Å²	145	83%	0.827	76%	0.758	S	S	*	*	P	Polyproline II helix	trans	-58.4	134.5	172.8	-167.7	168.8	130.4	0	0	109.7
20	P	83.3	Confident	79.1	Confident	102 Å²	102	143.8 Å²	143.8	66%	0.662	75%	0.753	S	S	*	*	P	Polyproline II helix	trans	-61.2	143.6	173.3	23.9	-31.9	0	0	0	110
21	P	84.3	Confident	78.8	Confident	126 Å²	126	141.5 Å²	141.5	82%	0.818	75%	0.75	S	S	*	*	P	Polyproline II helix	trans	-58.3	147.7	179.8	24.2	-33.2	0	0	0	111.2
22	A	88	Confident	78.5	Confident	83 Å²	83	143 Å²	143	69%	0.686	76%	0.762	S	S	*	*	P	Polyproline II helix	trans	-55.9	142.7	-178.9	0	0	0	0	0	111.6	V24	A22-V24 PolarHBondContact O-N 3.27Å
23	P	87	Confident	78.3	Confident	129 Å²	129	139.6 Å²	139.6	84%	0.838	76%	0.756	S	S	*	*	P	Polyproline II helix	trans	-58.4	126.5	177.9	-22.6	32	0	0	0	111.7
24	V	90.3	Very high	78.3	Confident	142 Å²	142	142.2 Å²	142.2	86%	0.861	76%	0.76	S	S	*	*	P	Polyproline II helix	trans	-89	126.9	176.5	-176	0	0	0	0	109.6	A22	A22-V24 PolarHBondContact O-N 3.27Å
25	R	87.9	Confident	78.4	Confident	216 Å²	216	143.6 Å²	143.6	82%	0.815	76%	0.76	S	S	*	*	P	Polyproline II helix	trans	-86.5	126.7	175	-65.6	178.8	65.6	-110.6	0.7	110.1
26	R	89.2	Confident	78.3	Confident	207 Å²	207	150.4 Å²	150.4	78%	0.781	77%	0.77	S	S	*	*	P	Polyproline II helix	trans	-67	132.2	168.5	-93	179.5	62.9	-92.3	-2.1	110.1
27	Q	88.4	Confident	77.8	Confident	180 Å²	180	149.5 Å²	149.5	84%	0.841	77%	0.773	S	S	*	*	P	Polyproline II helix	trans	-89.5	125.8	166.7	-63.9	-173.2	-1.8	0	0	108.8
28	S	86.6	Confident	77	Confident	97 Å²	97	148.2 Å²	148.2	68%	0.678	80%	0.8	S	S	*	*	P	Polyproline II helix	trans	-92.1	120.5	167	-64.9	0	0	0	0	107.7	S30	S28-S30 PolarHBondContact O-N 2.76Å
29	Y	81.4	Confident	76.8	Confident	222 Å²	222	150.2 Å²	150.2	87%	0.871	80%	0.803	S	S	*	*	P	Polyproline II helix	trans	-71.6	123.3	166.2	-134.7	-99.6	0	0	0	107.5	S31	Y29-S31 VanDerWaalsContact O-N 3.13Å; Y29-S31 PolarHBondContact O-N 2.95Å
30	S	76.1	Confident	76.5	Confident	95 Å²	95	148.8 Å²	148.8	66%	0.664	80%	0.801	S	S	*	*			trans	-71.1	105.5	169.8	-176.7	0	0	0	0	106.8	S28 T32	S28-S30 PolarHBondContact O-N 2.76Å; S30-T32 PolarHBondContact O-N 3.13Å
31	S	65.1	Low	76.1	Confident	106 Å²	106	151.4 Å²	151.4	74%	0.741	81%	0.809	S	S	*	*			trans	-71.9	85.5	164.6	-63.1	0	0	0	0	107.2	Y29 S33	Y29-S31 VanDerWaalsContact O-N 3.13Å; Y29-S31 PolarHBondContact O-N 2.95Å; S31-S33 PolarHBondContact O-N 3.23Å
32	T	64.8	Low	75.6	Confident	119 Å²	119	152.9 Å²	152.9	73%	0.73	81%	0.808	S	S	*	*			trans	-68.3	90.7	151.6	42.7	0	0	0	0	105.6	S30 R34	S30-T32 PolarHBondContact O-N 3.13Å; T32-R34 PolarHBondContact O-N 3.41Å
33	S	66	Low	74.8	Confident	94 Å²	94	157.3 Å²	157.3	66%	0.657	82%	0.816	S	S	*	*			trans	-57.8	92.2	155.8	-71.6	0	0	0	0	105	S31 D35	S31-S33 PolarHBondContact O-N 3.23Å; S33-D35 PolarHBondContact O-N 2.93Å
34	R	66	Low	74	Confident	203 Å²	203	159.1 Å²	159.1	77%	0.766	82%	0.815	S	S	*	*			trans	-66.9	92	163.9	-162.7	179	-124.1	-117.7	2.1	102.5	T32 W36	T32-R34 PolarHBondContact O-N 3.41Å; R34-W36 PolarHBondContact O-N 3.45Å
35	D	66.3	Low	72.9	Confident	132 Å²	132	160.4 Å²	160.4	71%	0.706	81%	0.811	S	S	*	*			trans	-49.6	95.9	166.2	-73.5	-68	0	0	0	106	S33 H37	S33-D35 PolarHBondContact O-N 2.93Å; D35-H37 PolarHBondContact O-CD2 2.73Å; D35-H37 PolarHBondContact O-N 2.87Å
36	W	64.8	Low	71.7	Confident	217 Å²	217	156.1 Å²	156.1	82%	0.822	81%	0.811	S	S	*	*			trans	-69.3	93.7	171.1	-96.4	99.4	0	0	0	104.5	R34 A38	R34-W36 PolarHBondContact O-N 3.45Å; W36-A38 PolarHBondContact O-N 2.96Å
37	H	63.2	Low	70.3	Confident	183 Å²	183	151.8 Å²	151.8	85%	0.847	81%	0.814	S	S	*	*			trans	-51.5	121.9	166.6	-73.6	-87.4	0	0	0	108.9	D35	D35-H37 PolarHBondContact O-CD2 2.73Å; D35-H37 PolarHBondContact O-N 2.87Å
38	A	54.4	Low	68.6	Low	174 Å²	174	149.3 Å²	149.3	100%	1.438	81%	0.811	S	S	*	*			trans	-123.9	0	165	0	0	0	0	0	108.1	W36	W36-A38 PolarHBondContact O-N 2.96Å

Retrieved 38 of 38 residues in 22.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).