A0A087X2G4_HUMAN Loading...

Family with sequence similarity 13 member C

AlphaFold DB , UniProt , Accession A0A087X2G4, Species HUMAN (Homo sapiens, Human), Gene FAM13C, Length 50 aa.

						>A0A087X2G4_HUMAN|A0A087X2G4|FAM13C
MFSCFCFSLQDNSFSSTTVTEPERRGERCAKVCICRPKMRPGLPAPGAQV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.4	Low	62.3	Low	187 Å²	187	109.9 Å²	109.9	92%	0.921	58%	0.579	S	S	*	*				0	112.7	0	-139.3	170.3	177.1	0	0	106.6	K38	M1-K38 VanDerWaalsContact O-CB 3.24Å; M1-K38 HydrophobicContact CB-CD 4.44Å; M1-K38 PolarHBondContact O-N 2.84Å; M1-K38 WeakPolarHBondContact O-CB 3.08Å
2	F	60	Low	61	Low	147 Å²	147	114.1 Å²	114.1	65%	0.645	60%	0.602	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-100.4	145.6	-176.6	-66.2	-93.8	0	0	0	109.4	P37	F2-P37 HydrophobicContact CD1-CB 3.86Å; F2-P37 HydrophobicContact CE1-CB 3.65Å; F2-P37 HydrophobicContact CE1-CG 4.4Å
3	S	61.3	Low	60	Low	67 Å²	67	111.5 Å²	111.5	47%	0.469	60%	0.599	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-108.8	118.9	169.6	-162.5	0	0	0	0	107.4	R36	S3-R36 PolarHBondContact N-O 2.91Å; S3-R36 PolarHBondContact O-N 2.86Å
4	C	68.3	Low	59.3	Low	72 Å²	72	118 Å²	118	49%	0.486	62%	0.62	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-104.6	132.3	178.9	-59.2	0	0	0	0	109.8	I34 C35	C4-I34 WeakPolarHBondContact CA-O 3.09Å; C4-C35 WeakPolarHBondContact CB-SG 3.38Å; C4-C35 PolarHBondContact SG-SG 3.26Å; C4-C35 CovalentContact SG-SG 2.05Å; C4-C35 WeakPolarHBondContact SG-CB 3.42Å; C4-C35 HydrophobicContact CB-CB 4.14Å
5	F	67.4	Low	58.5	Low	148 Å²	148	115.4 Å²	115.4	65%	0.649	62%	0.615	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-117.5	120.3	172.9	-168.6	-98.4	0	0	0	108.3	F7 I34	F5-F7 HydrophobicContact CD1-CD1 4.35Å; F5-F7 HydrophobicContact CE1-CB 4.45Å; F5-I34 PolarHBondContact N-O 2.97Å; F5-I34 PolarHBondContact O-N 2.93Å
6	C	71.7	Confident	58	Low	74 Å²	74	115.1 Å²	115.1	50%	0.5	63%	0.625	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-107.7	130.1	179.6	-62.1	0	0	0	0	109.6	V32 C33	C6-V32 WeakPolarHBondContact CA-O 3.24Å; C6-C33 WeakPolarHBondContact CB-SG 3.11Å; C6-C33 WeakPolarHBondContact SG-CB 3.09Å; C6-C33 CovalentContact SG-SG 2.05Å; C6-C33 PolarHBondContact SG-SG 2.05Å; C6-C33 HydrophobicContact CB-CB 4.15Å
7	F	67.4	Low	57.6	Low	76 Å²	76	114.2 Å²	114.2	33%	0.333	62%	0.624	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-126.8	144.8	172	60	-85	0	0	0	110	F5 L9 V32 I34	F5-F7 HydrophobicContact CD1-CD1 4.35Å; F5-F7 HydrophobicContact CE1-CB 4.45Å; F7-L9 HydrophobicContact CE2-CG 3.71Å; F7-L9 HydrophobicContact CE2-CD2 3.68Å; F7-L9 HydrophobicContact CE2-CD1 4.36Å; F7-L9 HydrophobicContact CD2-CG 4.11Å; F7-L9 HydrophobicContact CD2-CD2 4.19Å; F7-V32 HydrophobicContact CE1-CB 4.24Å; F7-V32 HydrophobicContact CE1-CG1 4.23Å; F7-V32 HydrophobicContact CE2-CB 4.13Å; F7-V32 HydrophobicContact CZ-CB 3.89Å; F7-V32 HydrophobicContact CZ-CG1 3.98Å; F7-V32 PolarHBondContact N-O 2.05Å; F7-V32 PolarHBondContact O-N 2.75Å; F7-I34 HydrophobicContact CE1-CD1 3.74Å; F7-I34 HydrophobicContact CZ-CD1 4.29Å; F7-I34 HydrophobicContact CE1-CG1 4.05Å
8	S	65.6	Low	57.3	Low	64 Å²	64	115.4 Å²	115.4	45%	0.448	64%	0.636	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-84.7	119.7	169.8	-61.7	0	0	0	0	107.6	Q10	S8-Q10 PolarHBondContact O-N 3.02Å
9	L	57.9	Low	56.9	Low	105 Å²	105	116 Å²	116	55%	0.55	64%	0.643	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-73.3	78.4	164.1	-75.1	167.9	0	0	0	107.4	F7 A30 V32	F7-L9 HydrophobicContact CE2-CG 3.71Å; F7-L9 HydrophobicContact CE2-CD2 3.68Å; F7-L9 HydrophobicContact CE2-CD1 4.36Å; F7-L9 HydrophobicContact CD2-CG 4.11Å; F7-L9 HydrophobicContact CD2-CD2 4.19Å; L9-A30 VanDerWaalsContact N-O 3.12Å; L9-A30 PolarHBondContact N-O 3.12Å; L9-V32 HydrophobicContact CD1-CG2 3.62Å; L9-V32 HydrophobicContact CG-CG2 4.31Å
10	Q	53.4	Low	56.5	Low	106 Å²	106	116.6 Å²	116.6	50%	0.495	65%	0.65	S	S	.	*			trans	-84.7	132	161.8	-140.6	170.4	19.5	0	0	106	S8 N12	S8-Q10 PolarHBondContact O-N 3.02Å; Q10-N12 PolarHBondContact O-N 3.07Å
11	D	53.3	Low	56.1	Low	163 Å²	163	118.6 Å²	118.6	87%	0.872	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-44.9	107.2	-177.2	-147.7	-94.7	0	0	0	110.1	S13	D11-S13 PolarHBondContact O-N 2.88Å
12	N	47.3	Very low	56.1	Low	160 Å²	160	114.6 Å²	114.6	86%	0.856	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	39.3	45.2	170.7	-141	19.3	0	0	0	118.6	Q10	Q10-N12 PolarHBondContact O-N 3.07Å
13	S	47.6	Very low	55.2	Low	81 Å²	81	116.4 Å²	116.4	57%	0.566	65%	0.653	S	S	*	*			trans	-147.1	105	163.9	-107.6	0	0	0	0	112	D11 S15	D11-S13 PolarHBondContact O-N 2.88Å; S13-S15 VanDerWaalsContact C-N 3.31Å; S13-S15 PolarHBondContact O-N 2.92Å
14	F	50.8	Low	54.3	Low	202 Å²	202	123.8 Å²	123.8	89%	0.886	67%	0.67	S	S	*	*			trans	-67	92.6	165.7	-178.4	-95.6	0	0	0	108.3
15	S	47	Very low	53.3	Low	79 Å²	79	133 Å²	133	55%	0.552	70%	0.695	S	S	*	*			trans	-111.4	108.7	167.2	-85.3	0	0	0	0	108.9	S13 T17	S13-S15 VanDerWaalsContact C-N 3.31Å; S13-S15 PolarHBondContact O-N 2.92Å; S15-T17 PolarHBondContact O-N 2.91Å
16	S	50.8	Low	52.2	Low	111 Å²	111	129.4 Å²	129.4	78%	0.776	70%	0.7	S	S	*	*			trans	-73.6	80.6	166.2	-172.8	0	0	0	0	108
17	T	51.1	Low	51	Low	99 Å²	99	133.6 Å²	133.6	61%	0.607	71%	0.712	S	S	*	*			trans	-104.9	117.7	169.5	42.6	0	0	0	0	108.2	S15 V19	S15-T17 PolarHBondContact O-N 2.91Å; T17-V19 VanDerWaalsContact C-N 3.34Å; T17-V19 WeakPolarHBondContact O-CG2 3.43Å; T17-V19 PolarHBondContact O-N 2.85Å
18	T	52.2	Low	50.1	Low	136 Å²	136	142.1 Å²	142.1	83%	0.834	74%	0.742	S	S	*	*			trans	-58.5	95.9	166.5	33.8	0	0	0	0	108.6	T20	T18-T20 PolarHBondContact O-N 2.97Å
19	V	50.4	Low	49.5	Very low	127 Å²	127	141.5 Å²	141.5	77%	0.77	74%	0.737	S	S	*	*			trans	-74.8	111.8	-178.5	-171.6	0	0	0	0	109	T17	T17-V19 VanDerWaalsContact C-N 3.34Å; T17-V19 WeakPolarHBondContact O-CG2 3.43Å; T17-V19 PolarHBondContact O-N 2.85Å
20	T	47.9	Very low	49.5	Very low	128 Å²	128	139 Å²	139	79%	0.785	73%	0.732	S	S	*	*			trans	-97.8	97.5	173.2	-42.9	0	0	0	0	107.6	T18	T18-T20 PolarHBondContact O-N 2.97Å
21	E	48.8	Very low	50.1	Low	158 Å²	158	141.6 Å²	141.6	74%	0.738	74%	0.742	S	S	*	*	S	Bend	trans	63.1	166.3	159.9	-89	-82.3	87.7	0	0	118.1
22	P	57.6	Low	50.9	Low	103 Å²	103	136.4 Å²	136.4	67%	0.669	72%	0.716	S	S	*	*				-107.2	112.6	-115.4	37.7	-30	0	0	0	113.8
23	E	42.1	Very low	52	Low	185 Å²	185	132.1 Å²	132.1	86%	0.864	70%	0.697	S	S	*	*			trans	-99.2	111.6	170.7	-89	-165.6	83.1	0	0	113.1
24	R	42.2	Very low	53.2	Low	222 Å²	222	131.8 Å²	131.8	84%	0.838	69%	0.689	S	S	*	*			trans	37.3	106.7	139.6	-67.8	-167.6	178.2	-153.7	3.5	118.2	G26	R24-G26 PolarHBondContact O-N 3.28Å
25	R	47.4	Very low	54.3	Low	265 Å²	265	125.4 Å²	125.4	100%	1	67%	0.668	S	S	*	*	S	Bend		11.8	87.5	125	-157.1	179.4	-166.1	-159.9	3.3	114.4
26	G	44.3	Very low	55.3	Low	74 Å²	74	130 Å²	130	76%	0.763	67%	0.674	S	S	*	*			trans	-174	-41.7	175.1	0	0	0	0	0	116.1	R24	R24-G26 PolarHBondContact O-N 3.28Å
27	E	46.2	Very low	56	Low	161 Å²	161	128.4 Å²	128.4	75%	0.752	66%	0.661	S	S	*	*			trans	-117.8	115.5	-179.2	-77.1	172.1	84.3	0	0	109.8	C29	E27-C29 PolarHBondContact O-N 2.94Å
28	R	48.1	Very low	56.5	Low	255 Å²	255	129.5 Å²	129.5	96%	0.962	66%	0.657	S	S	*	*			trans	-66.6	76.8	164.6	-85.1	-176.3	172.6	176.7	-1.8	107.7	A30	R28-A30 PolarHBondContact O-N 2.89Å
29	C	53.4	Low	56.5	Low	51 Å²	51	130.2 Å²	130.2	35%	0.345	65%	0.652	S	S	.	*			trans	-57.9	106	162.5	-74	0	0	0	0	106.5	E27 K31	E27-C29 PolarHBondContact O-N 2.94Å; C29-K31 VanDerWaalsContact C-N 3.33Å; C29-K31 PolarHBondContact O-N 2.94Å
30	A	57.7	Low	56.8	Low	54 Å²	54	133.7 Å²	133.7	45%	0.446	65%	0.652	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-67.7	95.5	175.5	0	0	0	0	0	107.7	L9 R28 V32	L9-A30 VanDerWaalsContact N-O 3.12Å; L9-A30 PolarHBondContact N-O 3.12Å; R28-A30 PolarHBondContact O-N 2.89Å; A30-V32 PolarHBondContact O-N 2.87Å
31	K	66.5	Low	56.8	Low	160 Å²	160	134.4 Å²	134.4	70%	0.696	66%	0.658	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-74.1	110.5	171.4	-73.5	-177.4	-178.5	177	0	107.7	C29	C29-K31 VanDerWaalsContact C-N 3.33Å; C29-K31 PolarHBondContact O-N 2.94Å
32	V	69.2	Low	57.3	Low	53 Å²	53	130.3 Å²	130.3	32%	0.321	66%	0.659	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-100	119.8	173.9	-178.5	0	0	0	0	107.7	C6 F7 L9 A30 I34	C6-V32 WeakPolarHBondContact CA-O 3.24Å; F7-V32 HydrophobicContact CE1-CB 4.24Å; F7-V32 HydrophobicContact CE1-CG1 4.23Å; F7-V32 HydrophobicContact CE2-CB 4.13Å; F7-V32 HydrophobicContact CZ-CB 3.89Å; F7-V32 HydrophobicContact CZ-CG1 3.98Å; F7-V32 PolarHBondContact N-O 2.05Å; F7-V32 PolarHBondContact O-N 2.75Å; L9-V32 HydrophobicContact CD1-CG2 3.62Å; L9-V32 HydrophobicContact CG-CG2 4.31Å; A30-V32 PolarHBondContact O-N 2.87Å; V32-I34 HydrophobicContact CG1-CG1 4.29Å
33	C	70	Confident	57.2	Low	70 Å²	70	131.7 Å²	131.7	47%	0.473	66%	0.66	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-104.9	118.2	174.2	-66.8	0	0	0	0	109.2	C6	C6-C33 WeakPolarHBondContact CB-SG 3.11Å; C6-C33 WeakPolarHBondContact SG-CB 3.09Å; C6-C33 CovalentContact SG-SG 2.05Å; C6-C33 PolarHBondContact SG-SG 2.05Å; C6-C33 HydrophobicContact CB-CB 4.15Å
34	I	73	Confident	57.8	Low	75 Å²	75	128.2 Å²	128.2	39%	0.385	65%	0.654	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-100.3	110.9	173	-57.5	179.3	0	0	0	107.5	C4 F5 F7 V32 R36	C4-I34 WeakPolarHBondContact CA-O 3.09Å; F5-I34 PolarHBondContact N-O 2.97Å; F5-I34 PolarHBondContact O-N 2.93Å; F7-I34 HydrophobicContact CE1-CD1 3.74Å; F7-I34 HydrophobicContact CZ-CD1 4.29Å; F7-I34 HydrophobicContact CE1-CG1 4.05Å; V32-I34 HydrophobicContact CG1-CG1 4.29Å; I34-R36 HydrophobicContact CG2-CG 4.29Å
35	C	75.4	Confident	58.5	Low	68 Å²	68	120.1 Å²	120.1	46%	0.459	63%	0.634	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-92.2	114.5	171.3	-65.9	0	0	0	0	109.4	C4	C4-C35 WeakPolarHBondContact CB-SG 3.38Å; C4-C35 PolarHBondContact SG-SG 3.26Å; C4-C35 CovalentContact SG-SG 2.05Å; C4-C35 WeakPolarHBondContact SG-CB 3.42Å; C4-C35 HydrophobicContact CB-CB 4.14Å
36	R	66.8	Low	58.6	Low	176 Å²	176	114.2 Å²	114.2	66%	0.664	63%	0.63	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-96.1	132.5	169.7	-67.9	-66	-174.3	169.1	-0.8	109	S3 I34 K38	S3-R36 PolarHBondContact N-O 2.91Å; S3-R36 PolarHBondContact O-N 2.86Å; I34-R36 HydrophobicContact CG2-CG 4.29Å; R36-K38 PolarHBondContact O-N 2.86Å
37	P	65.3	Low	59.2	Low	77 Å²	77	114 Å²	114	50%	0.5	63%	0.628	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-56.2	129.6	164.1	21.8	-27.6	0	0	0	107.2	F2 M39	F2-P37 HydrophobicContact CD1-CB 3.86Å; F2-P37 HydrophobicContact CE1-CB 3.65Å; F2-P37 HydrophobicContact CE1-CG 4.4Å; P37-M39 VanDerWaalsContact C-N 3.31Å; P37-M39 PolarHBondContact O-N 2.96Å
38	K	62.2	Low	59.5	Low	121 Å²	121	110.1 Å²	110.1	53%	0.526	62%	0.623	S	S	.	*			trans	-59.6	106.8	165.7	-77.3	-174.3	168.2	177.2	0	105.1	M1 R36 R40	M1-K38 VanDerWaalsContact O-CB 3.24Å; M1-K38 HydrophobicContact CB-CD 4.44Å; M1-K38 PolarHBondContact O-N 2.84Å; M1-K38 WeakPolarHBondContact O-CB 3.08Å; R36-K38 PolarHBondContact O-N 2.86Å; K38-R40 PolarHBondContact O-N 3.06Å
39	M	51.7	Low	59.7	Low	151 Å²	151	106.9 Å²	106.9	74%	0.744	62%	0.619	S	S	*	*			trans	-58.5	111	163.2	-86.3	-163.5	177.8	0	0	104.9	P37 P41 A45	P37-M39 VanDerWaalsContact C-N 3.31Å; P37-M39 PolarHBondContact O-N 2.96Å; M39-P41 WeakPolarHBondContact O-CD 3.47Å; M39-A45 HydrophobicContact CE-CB 4.44Å
40	R	56	Low	59.5	Low	201 Å²	201	114.6 Å²	114.6	76%	0.758	66%	0.664	S	S	*	*			trans	-59.4	123.3	162.6	-75.5	-179.2	168.1	178.7	-3.7	105.1	K38 G42	K38-R40 PolarHBondContact O-N 3.06Å; R40-G42 VanDerWaalsContact C-N 3.33Å; R40-G42 PolarHBondContact O-N 3.25Å
41	P	49.6	Very low	59.6	Low	142 Å²	142	117.7 Å²	117.7	92%	0.922	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.6	101.9	171.5	26	-30.6	0	0	0	106.2	M39	M39-P41 WeakPolarHBondContact O-CD 3.47Å
42	G	59.2	Low	59.2	Low	73 Å²	73	115.4 Å²	115.4	75%	0.753	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	145.1	1.5	-176.4	0	0	0	0	0	117.4	R40	R40-G42 VanDerWaalsContact C-N 3.33Å; R40-G42 PolarHBondContact O-N 3.25Å
43	L	55.3	Low	58.6	Low	131 Å²	131	118.9 Å²	118.9	69%	0.686	69%	0.694	S	S	*	*	S	Bend	trans	-118.1	122.6	163.2	-81.1	100.9	0	0	0	110.3	A45	L43-A45 PolarHBondContact O-N 3.43Å
44	P	53.8	Low	58	Low	113 Å²	113	121.8 Å²	121.8	73%	0.734	71%	0.707	S	S	*	*			trans	-59.8	135.8	174	25.5	-31.8	0	0	0	108.9
45	A	57	Low	57	Low	52 Å²	52	124.7 Å²	124.7	43%	0.43	73%	0.727	S	S	.	*			trans	-56.9	128.7	172.9	0	0	0	0	0	108.5	M39 L43 G47 A48	M39-A45 HydrophobicContact CE-CB 4.44Å; L43-A45 PolarHBondContact O-N 3.43Å; A45-G47 PolarHBondContact O-N 3.12Å; A45-A48 PolarHBondContact O-N 2.97Å; A45-A48 VanDerWaalsContact O-N 3.12Å
46	P	49.8	Very low	55.8	Low	140 Å²	140	128.5 Å²	128.5	91%	0.909	75%	0.745	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.4	106.3	174.8	25.1	-30.5	0	0	0	107.6
47	G	56.3	Low	55	Low	70 Å²	70	125.1 Å²	125.1	72%	0.722	75%	0.75	S	S	*	*	T	Hydrogen-bonded Turn	trans	132.5	-8.8	-173.2	0	0	0	0	0	115.5	A45 Q49	A45-G47 PolarHBondContact O-N 3.12Å; G47-Q49 PolarHBondContact O-N 2.91Å
48	A	54.1	Low	54.2	Low	79 Å²	79	128.8 Å²	128.8	65%	0.653	77%	0.77	S	S	*	*			trans	-75.5	79.5	163.7	0	0	0	0	0	109.1	A45	A45-A48 PolarHBondContact O-N 2.97Å; A45-A48 VanDerWaalsContact O-N 3.12Å
49	Q	50.5	Low	53.6	Low	187 Å²	187	129.4 Å²	129.4	87%	0.874	79%	0.79	S	S	*	*			trans	-74.2	133	167	-67.7	-173.2	89.9	0	0	108.5	G47	G47-Q49 PolarHBondContact O-N 2.91Å
50	V	49.7	Very low	53.7	Low	214 Å²	214	127.5 Å²	127.5	100%	1.297	79%	0.794	S	S	*	*			trans	-72.2	0	166.4	178.4	0	0	0	0	109

Retrieved 50 of 50 residues in 18.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).