A0A087X2G5_HUMAN Loading...

Protein FAM156A/FAM156B

AlphaFold DB , UniProt , Accession A0A087X2G5, Species HUMAN (Homo sapiens, Human), Gene FAM156A, Length 35 aa.

						>A0A087X2G5_HUMAN|A0A087X2G5|FAM156A
MDPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	68.1	Low	64.7	Low	234 Å²	234	144.3 Å²	144.3	100%	1.153	77%	0.768	S	S	*	*				0	110.3	0	-80.3	-69.6	-156	0	0	107.4
2	D	70.1	Confident	64.4	Low	98 Å²	98	140.7 Å²	140.7	52%	0.524	76%	0.758	S	S	.	*			trans	-82.2	121.6	-172.6	-154.5	-44	0	0	0	110.9	L4 Q5	D2-L4 VanDerWaalsContact O-N 3.11Å; D2-L4 PolarHBondContact O-N 3.42Å; D2-L4 PolarHBondContact OD1-N 2.85Å; D2-Q5 PolarHBondContact O-N 3.18Å; D2-Q5 VanDerWaalsContact O-N 3.16Å
3	P	64.4	Low	64.2	Low	93 Å²	93	137.9 Å²	137.9	60%	0.604	76%	0.756	S	S	*	*	G	3₁₀ helix	trans	-62.6	-17.1	-178.4	-19.2	31	0	0	0	113.8	Q5 K6	P3-Q5 VanDerWaalsContact C-N 3.28Å; P3-Q5 PolarHBondContact O-N 3.36Å; P3-K6 WeakPolarHBondContact O-CB 3.03Å; P3-K6 PolarHBondContact O-N 3.08Å; P3-K6 VanDerWaalsContact O-N 3.17Å
4	L	62.2	Low	64	Low	142 Å²	142	142.1 Å²	142.1	74%	0.743	76%	0.764	S	S	*	*	G	3₁₀ helix	trans	-73.5	-17.6	178.1	-65.8	171.8	0	0	0	113.2	D2 K6	D2-L4 VanDerWaalsContact O-N 3.11Å; D2-L4 PolarHBondContact O-N 3.42Å; D2-L4 PolarHBondContact OD1-N 2.85Å; L4-K6 PolarHBondContact O-N 3.17Å
5	Q	61.2	Low	63.8	Low	176 Å²	176	139.4 Å²	139.4	82%	0.822	76%	0.76	S	S	*	*	G	3₁₀ helix	trans	-73.9	-12.2	168.9	-65.2	-156	-11	0	0	113.3	D2 P3 R7	D2-Q5 PolarHBondContact O-N 3.18Å; D2-Q5 VanDerWaalsContact O-N 3.16Å; P3-Q5 VanDerWaalsContact C-N 3.28Å; P3-Q5 PolarHBondContact O-N 3.36Å; Q5-R7 PolarHBondContact O-N 2.8Å
6	K	64.6	Low	63.6	Low	184 Å²	184	137.1 Å²	137.1	80%	0.8	76%	0.757	S	S	*	*	G	3₁₀ helix	trans	-80.9	-1.3	177.5	-68.5	-174	173.5	-176.8	0	113.5	P3 L4	P3-K6 WeakPolarHBondContact O-CB 3.03Å; P3-K6 PolarHBondContact O-N 3.08Å; P3-K6 VanDerWaalsContact O-N 3.17Å; L4-K6 PolarHBondContact O-N 3.17Å
7	R	68.4	Low	63.7	Low	199 Å²	199	135.1 Å²	135.1	75%	0.751	75%	0.752	S	S	*	*	S	Bend	trans	-130.4	95.5	179.7	-72	-163.3	-95.7	180	-4.8	111.6	Q5	Q5-R7 PolarHBondContact O-N 2.8Å
8	N	64	Low	63.8	Low	145 Å²	145	137.7 Å²	137.7	78%	0.775	76%	0.76	S	S	*	*			trans	110.8	156.9	141.8	-63.1	4.6	0	0	0	116.3
9	P	64.1	Low	63.8	Low	114 Å²	114	136.9 Å²	136.9	74%	0.74	76%	0.759	S	S	*	*			cis	-141.7	123.3	-49.2	36	-19.4	0	0	0	109.9
10	A	62.9	Low	63.7	Low	92 Å²	92	134.5 Å²	134.5	76%	0.76	76%	0.758	S	S	*	*			trans	-161.8	83.3	161.5	0	0	0	0	0	108.3	P12	A10-P12 VanDerWaalsContact C-CD 3.49Å; A10-P12 WeakPolarHBondContact O-CD 3.37Å
11	S	61.8	Low	63.7	Low	110 Å²	110	132 Å²	132	77%	0.769	76%	0.755	S	S	*	*			trans	-77.4	105.8	143.1	-169.9	0	0	0	0	104.6	S13	S11-S13 PolarHBondContact O-N 2.92Å
12	P	60.9	Low	63.3	Low	101 Å²	101	129.7 Å²	129.7	66%	0.656	74%	0.741	S	S	*	*			trans	-61.1	101.1	158.9	25.8	-29.2	0	0	0	105	A10 K14	A10-P12 VanDerWaalsContact C-CD 3.49Å; A10-P12 WeakPolarHBondContact O-CD 3.37Å; P12-K14 VanDerWaalsContact C-N 3.34Å; P12-K14 PolarHBondContact O-N 2.86Å
13	S	61.7	Low	62.9	Low	105 Å²	105	131 Å²	131	73%	0.734	75%	0.753	S	S	*	*			trans	-51.9	111.3	159.7	-74.6	0	0	0	0	104.5	S11 S15	S11-S13 PolarHBondContact O-N 2.92Å; S13-S15 PolarHBondContact O-N 3.04Å
14	K	61.6	Low	62.9	Low	197 Å²	197	131.3 Å²	131.3	86%	0.857	76%	0.757	S	S	*	*			trans	-67.9	73.5	172.4	-66	-167.1	-177.5	-176	0	107.2	P12 S16	P12-K14 VanDerWaalsContact C-N 3.34Å; P12-K14 PolarHBondContact O-N 2.86Å; K14-S16 PolarHBondContact O-N 2.83Å
15	S	61.3	Low	62.9	Low	101 Å²	101	133 Å²	133	71%	0.706	76%	0.761	S	S	*	*			trans	-66.4	91.9	154	167.7	0	0	0	0	105	S13	S13-S15 PolarHBondContact O-N 3.04Å
16	S	61	Low	63.1	Low	102 Å²	102	132.9 Å²	132.9	71%	0.713	76%	0.761	S	S	*	*			trans	-100.4	103.8	149.8	-61.6	0	0	0	0	104.6	K14 M18	K14-S16 PolarHBondContact O-N 2.83Å; S16-M18 VanDerWaalsContact C-N 3.34Å; S16-M18 PolarHBondContact O-N 2.8Å
17	P	64.2	Low	63.6	Low	104 Å²	104	126.2 Å²	126.2	68%	0.675	74%	0.744	S	S	*	*			trans	-61.2	110.1	159.1	26.7	-29.5	0	0	0	105.1	T19	P17-T19 PolarHBondContact O-N 3.03Å; P17-T19 VanDerWaalsContact C-N 3.34Å
18	M	65.9	Low	64	Low	182 Å²	182	123 Å²	123	90%	0.897	75%	0.749	S	S	*	*			trans	-62	106.4	162.3	-174.8	99.2	136	0	0	104.9	S16 A20	S16-M18 VanDerWaalsContact C-N 3.34Å; S16-M18 PolarHBondContact O-N 2.8Å; M18-A20 PolarHBondContact O-N 2.99Å
19	T	63.5	Low	64.7	Low	122 Å²	122	119.5 Å²	119.5	75%	0.748	74%	0.74	S	S	*	*			trans	-54.7	113.1	167.5	-59.4	0	0	0	0	106.3	P17 A21	P17-T19 PolarHBondContact O-N 3.03Å; P17-T19 VanDerWaalsContact C-N 3.34Å; T19-A21 VanDerWaalsContact C-N 3.26Å; T19-A21 PolarHBondContact O-N 2.98Å
20	A	61.4	Low	65.4	Low	89 Å²	89	119.9 Å²	119.9	74%	0.736	74%	0.743	S	S	*	*			trans	-61.6	98.4	169.2	0	0	0	0	0	105.7	M18 E22	M18-A20 PolarHBondContact O-N 2.99Å; A20-E22 PolarHBondContact O-N 3.05Å
21	A	64.2	Low	66.4	Low	83 Å²	83	121.3 Å²	121.3	69%	0.686	75%	0.747	S	S	*	*			trans	-53.4	119.2	170.8	0	0	0	0	0	105.9	T19 T23	T19-A21 VanDerWaalsContact C-N 3.26Å; T19-A21 PolarHBondContact O-N 2.98Å; A21-T23 VanDerWaalsContact C-N 3.3Å; A21-T23 PolarHBondContact O-N 2.68Å
22	E	60.8	Low	67.5	Low	184 Å²	184	124.4 Å²	124.4	86%	0.86	75%	0.749	S	S	*	*			trans	-53	99.3	170.7	-75.9	170.5	92.6	0	0	107.5	A20 S24	A20-E22 PolarHBondContact O-N 3.05Å; E22-S24 PolarHBondContact O-N 2.92Å
23	T	60.2	Low	68.5	Low	126 Å²	126	124.4 Å²	124.4	77%	0.773	75%	0.749	S	S	*	*			trans	-70.9	81	160.5	2.6	0	0	0	0	105.8	A21 Q25	A21-T23 VanDerWaalsContact C-N 3.3Å; A21-T23 PolarHBondContact O-N 2.68Å; T23-Q25 PolarHBondContact O-N 2.84Å
24	S	64.1	Low	69.4	Low	100 Å²	100	125.5 Å²	125.5	70%	0.699	76%	0.757	S	S	*	*			trans	-63	76.9	151.6	-63.9	0	0	0	0	106.3	E22 E26	E22-S24 PolarHBondContact O-N 2.92Å; S24-E26 PolarHBondContact O-N 3.17Å
25	Q	62.8	Low	70	Confident	176 Å²	176	129.7 Å²	129.7	82%	0.822	77%	0.769	S	S	*	*			trans	-69.3	80.9	151.1	-87	-168.3	11.1	0	0	105.1	T23 G27	T23-Q25 PolarHBondContact O-N 2.84Å; Q25-G27 PolarHBondContact O-N 3.41Å
26	E	65	Low	70.4	Confident	175 Å²	175	131.2 Å²	131.2	82%	0.818	77%	0.772	S	S	*	*			trans	-62.9	91.2	153.2	-164.3	171.4	127.7	0	0	104.8	S24	S24-E26 PolarHBondContact O-N 3.17Å
27	G	75.6	Confident	70.9	Confident	43 Å²	43	132.7 Å²	132.7	44%	0.443	78%	0.776	S	S	.	*	P	Polyproline II helix	trans	-55.2	162.4	163.9	0	0	0	0	0	109	Q25 A29	Q25-G27 PolarHBondContact O-N 3.41Å; G27-A29 PolarHBondContact O-N 3.47Å; G27-A29 VanDerWaalsContact O-N 3.17Å
28	P	76.4	Confident	71.3	Confident	132 Å²	132	134.3 Å²	134.3	86%	0.857	78%	0.781	S	S	*	*	S	Bend	trans	-48.8	130.2	179.5	21.7	-32.7	0	0	0	109.9
29	A	79.6	Confident	71.6	Confident	72 Å²	72	131.5 Å²	131.5	60%	0.595	77%	0.774	S	S	*	*	P	Polyproline II helix	trans	-47.8	138.4	-176	0	0	0	0	0	110.5	G27 S31	G27-A29 PolarHBondContact O-N 3.47Å; G27-A29 VanDerWaalsContact O-N 3.17Å; A29-S31 PolarHBondContact O-N 3.11Å; A29-S31 VanDerWaalsContact O-N 3.08Å
30	P	77.8	Confident	72.1	Confident	122 Å²	122	132.1 Å²	132.1	79%	0.792	78%	0.776	S	S	*	*	P	Polyproline II helix	trans	-55.8	121.9	179.8	21.1	-30.4	0	0	0	108.9	Q32	P30-Q32 PolarHBondContact O-N 3.16Å
31	S	84.5	Confident	72.8	Confident	121 Å²	121	134.9 Å²	134.9	85%	0.846	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-60.3	122.2	178.4	-55.7	0	0	0	0	108.6	A29	A29-S31 PolarHBondContact O-N 3.11Å; A29-S31 VanDerWaalsContact O-N 3.08Å
32	Q	84.3	Confident	73.4	Confident	176 Å²	176	138.6 Å²	138.6	82%	0.822	79%	0.785	S	S	*	*	P	Polyproline II helix	trans	-64.6	144.4	179.7	-65.4	-151.8	-59.1	0	0	110.5	P30 S34	P30-Q32 PolarHBondContact O-N 3.16Å; Q32-S34 PolarHBondContact O-N 3.41Å
33	P	82.8	Confident	74.4	Confident	100 Å²	100	135.2 Å²	135.2	65%	0.649	78%	0.78	S	S	*	*	P	Polyproline II helix	trans	-66	130.9	175	25.3	-31	0	0	0	110.4	Y35	P33-Y35 HydrophobicContact CB-CD2 4.12Å; P33-Y35 HydrophobicContact CB-CE2 3.86Å; P33-Y35 HydrophobicContact CG-CD2 4.33Å; P33-Y35 HydrophobicContact CG-CE2 4.06Å; P33-Y35 PolarHBondContact O-N 3.31Å
34	S	80.5	Confident	75.6	Confident	128 Å²	128	135.9 Å²	135.9	90%	0.895	78%	0.78	S	S	*	*			trans	-78	106.5	168.5	-58.2	0	0	0	0	109.1	Q32	Q32-S34 PolarHBondContact O-N 3.41Å
35	Y	73.9	Confident	76.6	Confident	286 Å²	286	139.2 Å²	139.2	100%	1.122	79%	0.787	S	S	*	*			trans	-105.5	0	161.7	-74.6	-83.5	0	0	0	109.3	P33	P33-Y35 HydrophobicContact CB-CD2 4.12Å; P33-Y35 HydrophobicContact CB-CE2 3.86Å; P33-Y35 HydrophobicContact CG-CD2 4.33Å; P33-Y35 HydrophobicContact CG-CE2 4.06Å; P33-Y35 PolarHBondContact O-N 3.31Å

Retrieved 35 of 35 residues in 12.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).