A0A087X2H4_HUMAN Loading...

6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2

AlphaFold DB , UniProt , Accession A0A087X2H4, Species HUMAN (Homo sapiens, Human), Gene PFKFB2, Length 49 aa.

						>A0A087X2H4_HUMAN|A0A087X2H4|PFKFB2
MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPAR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.6	Very low	44.8	Very low	233 Å²	233	134.3 Å²	134.3	100%	1.148	82%	0.816	S	S	*	*				0	125.1	0	-70.8	160.2	77.4	0	0	107.4
2	S	41.8	Very low	45.9	Very low	129 Å²	129	136.1 Å²	136.1	90%	0.902	82%	0.817	S	S	*	*			trans	63.8	131.2	158.8	-41.8	0	0	0	0	117.8
3	G	35.8	Very low	46	Very low	75 Å²	75	130.8 Å²	130.8	77%	0.773	79%	0.791	S	S	*	*			cis	-174	151.6	6.3	0	0	0	0	0	109.4
4	A	44.3	Very low	46.2	Very low	105 Å²	105	137.6 Å²	137.6	87%	0.868	80%	0.798	S	S	*	*			trans	-71.5	147	169.2	0	0	0	0	0	110.2
5	S	39.4	Very low	46.2	Very low	120 Å²	120	138 Å²	138	84%	0.839	79%	0.789	S	S	*	*			trans	-150.4	112	132.7	-160.7	0	0	0	0	109.4
6	S	41.3	Very low	46.4	Very low	104 Å²	104	137.8 Å²	137.8	73%	0.727	79%	0.792	S	S	*	*			trans	-65.2	137.3	177.8	-179.4	0	0	0	0	109.9	E8	S6-E8 PolarHBondContact O-N 3.02Å
7	S	47	Very low	46.8	Very low	94 Å²	94	140.9 Å²	140.9	66%	0.657	79%	0.794	S	S	*	*			trans	-51.7	119.1	172.6	47.3	0	0	0	0	112	Q9	S7-Q9 PolarHBondContact O-N 2.74Å
8	E	50.8	Low	47.3	Very low	195 Å²	195	138 Å²	138	91%	0.911	78%	0.78	S	S	*	*			trans	-66.1	109.2	163.3	-80.4	168	98.2	0	0	109.3	S6	S6-E8 PolarHBondContact O-N 3.02Å
9	Q	47.3	Very low	48	Very low	161 Å²	161	136.9 Å²	136.9	75%	0.752	78%	0.779	S	S	*	*			trans	-105.1	92	161.3	-90.9	165.4	-41.4	0	0	108.6	S7 N11	S7-Q9 PolarHBondContact O-N 2.74Å; Q9-N11 PolarHBondContact O-N 3.15Å
10	N	61.5	Low	48.5	Very low	132 Å²	132	136.4 Å²	136.4	71%	0.706	77%	0.774	S	S	*	*			trans	-54.1	113.3	156.1	-179.7	-69.2	0	0	0	108.4
11	N	44.4	Very low	48.9	Very low	129 Å²	129	136.1 Å²	136.1	69%	0.69	77%	0.77	S	S	*	*			trans	-141.4	88.2	163.9	-80.3	-48.6	0	0	0	107.8	Q9 S13	Q9-N11 PolarHBondContact O-N 3.15Å; N11-S13 VanDerWaalsContact C-N 3.27Å; N11-S13 PolarHBondContact O-N 3.24Å
12	N	57.4	Low	49.7	Very low	156 Å²	156	134.5 Å²	134.5	83%	0.834	75%	0.751	S	S	*	*			trans	-67.4	89.8	160.3	-89.9	-29.5	0	0	0	108.4
13	S	46.8	Very low	50.4	Low	68 Å²	68	134 Å²	134	48%	0.476	74%	0.736	S	S	.	*			trans	-120.2	116	161.5	56.3	0	0	0	0	106.6	N11 E15	N11-S13 VanDerWaalsContact C-N 3.27Å; N11-S13 PolarHBondContact O-N 3.24Å; S13-E15 PolarHBondContact O-N 3.26Å
14	Y	50	Low	51.6	Low	225 Å²	225	135.9 Å²	135.9	88%	0.882	74%	0.737	S	S	*	*			trans	-67.1	57.7	170	41.8	-92.6	0	0	0	109.7	T16	Y14-T16 PolarHBondContact O-N 3.27Å; Y14-T16 VanDerWaalsContact O-N 3.15Å
15	E	44.9	Very low	52.3	Low	144 Å²	144	140.1 Å²	140.1	67%	0.673	74%	0.739	S	S	*	*			trans	-67.8	112.7	168.2	-67.5	-68.6	126.5	0	0	105.6	S13 K17	S13-E15 PolarHBondContact O-N 3.26Å; E15-K17 PolarHBondContact O-N 2.74Å
16	T	50.7	Low	53.8	Low	135 Å²	135	141.1 Å²	141.1	83%	0.828	73%	0.728	S	S	*	*			trans	-58	86.7	163.9	-51.2	0	0	0	0	106.2	Y14 T18	Y14-T16 PolarHBondContact O-N 3.27Å; Y14-T16 VanDerWaalsContact O-N 3.15Å; T16-T18 VanDerWaalsContact C-N 3.25Å; T16-T18 PolarHBondContact O-N 2.66Å
17	K	52.9	Low	55.5	Low	191 Å²	191	146.4 Å²	146.4	83%	0.83	74%	0.738	S	S	*	*			trans	-67	90.3	-169.5	-157.9	175.3	-170.3	-175.7	0	106	E15 P19	E15-K17 PolarHBondContact O-N 2.74Å; K17-P19 WeakPolarHBondContact O-CD 3.34Å
18	T	55.9	Low	56.7	Low	88 Å²	88	145.5 Å²	145.5	54%	0.54	73%	0.731	S	S	.	*			trans	-48.2	116.8	169.7	47.9	0	0	0	0	105.8	T16 N20	T16-T18 VanDerWaalsContact C-N 3.25Å; T16-T18 PolarHBondContact O-N 2.66Å; T18-N20 PolarHBondContact O-N 2.75Å
19	P	59.4	Low	58.3	Low	118 Å²	118	140.4 Å²	140.4	77%	0.766	72%	0.716	S	S	*	*	S	Bend	trans	-70.3	14.7	-163.4	24.9	-34.2	0	0	0	114.1	K17	K17-P19 WeakPolarHBondContact O-CD 3.34Å
20	N	59.2	Low	60.2	Low	126 Å²	126	142.7 Å²	142.7	67%	0.674	72%	0.718	S	S	*	*			trans	-141.1	48.2	-162.5	-128	-47.3	0	0	0	114.3	T18	T18-N20 PolarHBondContact O-N 2.75Å
21	L	55.5	Low	61.1	Low	131 Å²	131	140 Å²	140	69%	0.686	71%	0.714	S	S	*	*	S	Bend	trans	-129.6	2.8	178.2	-86.3	178.1	0	0	0	116.7
22	R	56.9	Low	63	Low	199 Å²	199	136.5 Å²	136.5	75%	0.751	70%	0.7	S	S	*	*	S	Bend	trans	-142.2	46.2	-175.2	-65.6	-69.8	163.6	85.8	0.4	114.5	K26	R22-K26 WeakPolarHBondContact O-CE 3.4Å; R22-K26 PolarHBondContact O-NZ 3.45Å
23	M	56.7	Low	64.4	Low	118 Å²	118	137.2 Å²	137.2	58%	0.581	69%	0.692	S	S	*	*			trans	-101.5	-4.2	173.5	-104	73	146.8	0	0	115.1	E25	M23-E25 PolarHBondContact O-N 3.01Å
24	S	61	Low	66.5	Low	114 Å²	114	140 Å²	140	80%	0.797	70%	0.699	S	S	*	*	S	Bend	trans	-95.6	18.5	-163.4	60.9	0	0	0	0	117.7
25	E	60	Low	68.3	Low	195 Å²	195	133.1 Å²	133.1	91%	0.911	68%	0.681	S	S	*	*	S	Bend	trans	-147.9	-1.8	177.4	-133.9	169	101.4	0	0	117.5	M23	M23-E25 PolarHBondContact O-N 3.01Å
26	K	70.1	Confident	70.1	Confident	141 Å²	141	133.5 Å²	133.5	61%	0.613	69%	0.688	S	S	*	*	S	Bend	trans	-117.9	133.7	176.5	62.9	-146.4	173.6	-157.7	0	109.5	R22 C28	R22-K26 WeakPolarHBondContact O-CE 3.4Å; R22-K26 PolarHBondContact O-NZ 3.45Å; K26-C28 PolarHBondContact O-N 3.02Å
27	K	77.8	Confident	71.7	Confident	214 Å²	214	131.1 Å²	131.1	93%	0.93	68%	0.676	S	S	*	*			trans	-58.8	113.1	-179.7	-141.3	129.2	75.8	-166.2	0	108.4
28	C	71.6	Confident	73.3	Confident	76 Å²	76	128.1 Å²	128.1	51%	0.514	68%	0.676	S	S	.	*			trans	-56.9	145.9	-176.9	-60.1	0	0	0	0	111.1	K26	K26-C28 PolarHBondContact O-N 3.02Å
29	S	83.4	Confident	74.9	Confident	87 Å²	87	129 Å²	129	61%	0.608	68%	0.681	S	S	*	*			trans	-71.4	158.3	177	-52.5	0	0	0	0	111.9	A31 S32 Y33	S29-A31 PolarHBondContact O-N 3.41Å; S29-A31 VanDerWaalsContact O-N 3.12Å; S29-S32 WeakPolarHBondContact O-CA 3.42Å; S29-S32 WeakPolarHBondContact O-CB 3.44Å; S29-S32 PolarHBondContact O-N 3.12Å; S29-Y33 PolarHBondContact O-N 2.84Å
30	W	87.3	Confident	76.4	Confident	210 Å²	210	131 Å²	131	80%	0.795	69%	0.685	S	S	*	*	H	α-helix	trans	-50.7	-36.2	176	-84.3	96	0	0	0	113.9	S32 Y33 M34	W30-S32 VanDerWaalsContact C-N 3.32Å; W30-S32 PolarHBondContact O-N 3.25Å; W30-Y33 HydrophobicContact CE3-CD1 4.49Å; W30-Y33 HydrophobicContact CZ3-CD1 4.46Å; W30-Y33 WeakPolarHBondContact O-CB 3.36Å; W30-Y33 PolarHBondContact O-N 3.15Å; W30-M34 WeakPolarHBondContact O-CG 3.46Å; W30-M34 PolarHBondContact O-N 3.32Å
31	A	81.8	Confident	77.9	Confident	75 Å²	75	132.8 Å²	132.8	62%	0.62	69%	0.693	S	S	*	*	H	α-helix	trans	-62.4	-37.7	176.1	0	0	0	0	0	113.1	S29 Y33 M34 T35	S29-A31 PolarHBondContact O-N 3.41Å; S29-A31 VanDerWaalsContact O-N 3.12Å; A31-Y33 VanDerWaalsContact C-N 3.34Å; A31-M34 PolarHBondContact O-N 2.9Å; A31-T35 VanDerWaalsContact O-OG1 3.08Å; A31-T35 PolarHBondContact O-OG1 3.46Å; A31-T35 PolarHBondContact O-N 3.22Å
32	S	84	Confident	79.7	Confident	56 Å²	56	132 Å²	132	39%	0.392	69%	0.693	S	S	.	*	H	α-helix	trans	-71.1	-32.7	176.5	-162.7	0	0	0	0	111.4	S29 W30 M34 T35	S29-S32 WeakPolarHBondContact O-CA 3.42Å; S29-S32 WeakPolarHBondContact O-CB 3.44Å; S29-S32 PolarHBondContact O-N 3.12Å; W30-S32 VanDerWaalsContact C-N 3.32Å; W30-S32 PolarHBondContact O-N 3.25Å; S32-M34 PolarHBondContact O-N 3.19Å; S32-T35 PolarHBondContact O-N 3.08Å
33	Y	86.1	Confident	81.3	Confident	170 Å²	170	130.7 Å²	130.7	67%	0.667	70%	0.698	S	S	*	*	H	α-helix	trans	-65.8	-28.7	176	-174.6	-111.2	0	0	0	112.5	S29 W30 A31	S29-Y33 PolarHBondContact O-N 2.84Å; W30-Y33 HydrophobicContact CE3-CD1 4.49Å; W30-Y33 HydrophobicContact CZ3-CD1 4.46Å; W30-Y33 WeakPolarHBondContact O-CB 3.36Å; W30-Y33 PolarHBondContact O-N 3.15Å; A31-Y33 VanDerWaalsContact C-N 3.34Å
34	M	91.4	Very high	83	Confident	127 Å²	127	132.6 Å²	132.6	63%	0.626	71%	0.708	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.7	-9.7	178.7	-61	-76.6	72.4	0	0	113.9	W30 A31 S32	W30-M34 WeakPolarHBondContact O-CG 3.46Å; W30-M34 PolarHBondContact O-N 3.32Å; A31-M34 PolarHBondContact O-N 2.9Å; S32-M34 PolarHBondContact O-N 3.19Å
35	T	87.4	Confident	84.5	Confident	81 Å²	81	129.6 Å²	129.6	50%	0.497	70%	0.696	S	S	.	*			trans	-112.5	100.1	-176.2	-51.6	0	0	0	0	110	A31 S32	A31-T35 VanDerWaalsContact O-OG1 3.08Å; A31-T35 PolarHBondContact O-OG1 3.46Å; A31-T35 PolarHBondContact O-N 3.22Å; S32-T35 PolarHBondContact O-N 3.08Å
36	N	83.1	Confident	86	Confident	152 Å²	152	126.7 Å²	126.7	81%	0.813	69%	0.686	S	S	*	*			trans	-89.3	-9.7	-175.3	-70.3	-75.2	0	0	0	114.4
37	S	84.3	Confident	86.3	Confident	85 Å²	85	126.1 Å²	126.1	59%	0.594	70%	0.696	S	S	*	*	S	Bend	trans	-119.6	142.6	-177.1	-62.1	0	0	0	0	110.9	T39	S37-T39 PolarHBondContact O-N 3.29Å
38	P	87.1	Confident	86.4	Confident	127 Å²	127	121.5 Å²	121.5	83%	0.825	70%	0.698	S	S	*	*			trans	-63.3	126.4	172	26.6	-32.6	0	0	0	109.8
39	T	88.6	Confident	85.5	Confident	106 Å²	106	129.8 Å²	129.8	65%	0.65	72%	0.719	S	S	*	*			trans	-105.9	131.9	178.8	-57.8	0	0	0	0	110	S37	S37-T39 PolarHBondContact O-N 3.29Å
40	L	90.6	Very high	85.6	Confident	160 Å²	160	132 Å²	132	84%	0.838	72%	0.724	S	S	*	*			trans	-89.8	127.6	170.6	-63.1	175.9	0	0	0	109.4
41	I	91.7	Very high	85.5	Confident	165 Å²	165	127.8 Å²	127.8	85%	0.846	72%	0.72	S	S	*	*			trans	-100.4	115.4	175.9	-57.5	174.2	0	0	0	107.7
42	V	92.3	Very high	85.7	Confident	113 Å²	113	130.8 Å²	130.8	69%	0.685	73%	0.726	S	S	*	*			trans	-101.7	122.9	178.1	-177.3	0	0	0	0	108.8	I44	V42-I44 HydrophobicContact CG1-CD1 4.44Å; V42-I44 HydrophobicContact CG1-CG1 3.95Å
43	M	91.5	Very high	85.8	Confident	172 Å²	172	135.2 Å²	135.2	85%	0.847	75%	0.746	S	S	*	*			trans	-81.1	120.7	172.5	-166.7	167.1	74.8	0	0	108.8
44	I	92.3	Very high	85.7	Confident	158 Å²	158	133 Å²	133	81%	0.81	75%	0.751	S	S	*	*			trans	-123	119.7	174.3	-55.4	176.2	0	0	0	106.6	V42	V42-I44 HydrophobicContact CG1-CD1 4.44Å; V42-I44 HydrophobicContact CG1-CG1 3.95Å
45	G	92.1	Very high	85.4	Confident	51 Å²	51	133.4 Å²	133.4	53%	0.526	76%	0.759	S	S	.	*			trans	-155.8	164.5	-176.4	0	0	0	0	0	110.8	R49	G45-R49 WeakPolarHBondContact CA-O 3.49Å
46	L	91.8	Very high	85.2	Confident	134 Å²	134	137.1 Å²	137.1	70%	0.702	78%	0.778	S	S	*	*			trans	-67.1	154.2	170.6	-67.5	175.8	0	0	0	109	A48 R49	L46-A48 PolarHBondContact O-N 3.38Å; L46-A48 VanDerWaalsContact O-N 3.15Å; L46-R49 PolarHBondContact O-N 3.4Å; L46-R49 VanDerWaalsContact O-O 3.13Å
47	P	75.7	Confident	85.4	Confident	129 Å²	129	136 Å²	136	84%	0.838	78%	0.775	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51	127	166.9	-24	34	0	0	0	109.5
48	A	80.2	Confident	85.5	Confident	117 Å²	117	140.3 Å²	140.3	97%	0.967	79%	0.79	S	S	*	*	T	Hydrogen-bonded Turn	trans	74	21.6	-170.9	0	0	0	0	0	117.1	L46	L46-A48 PolarHBondContact O-N 3.38Å; L46-A48 VanDerWaalsContact O-N 3.15Å
49	R	52	Low	85.3	Confident	251 Å²	251	141.5 Å²	141.5	95%	0.947	79%	0.787	S	S	*	*			trans	-143.7	0	167	-164.8	165.4	-171.4	156.3	1.5	114.2	G45 L46	G45-R49 WeakPolarHBondContact CA-O 3.49Å; L46-R49 PolarHBondContact O-N 3.4Å; L46-R49 VanDerWaalsContact O-O 3.13Å

Retrieved 49 of 49 residues in 17.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).