A0A087X2H9_HUMAN Loading...

WD repeat domain 13

AlphaFold DB , UniProt , Accession A0A087X2H9, Species HUMAN (Homo sapiens, Human), Gene WDR13, Length 43 aa.

						>A0A087X2H9_HUMAN|A0A087X2H9|WDR13
MAAVWQQVLAVDASFGRSISAGAASCCGRMPRLGTPQRCVGST
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.1	Low	54.5	Low	235 Å²	235	111.8 Å²	111.8	100%	1.158	61%	0.614	S	S	*	*				0	44.8	0	-154.2	169.1	-163.4	0	0	111.7
2	A	51	Low	54.8	Low	74 Å²	74	112 Å²	112	61%	0.612	61%	0.613	S	S	*	*			trans	-120.8	-15.9	-177.6	0	0	0	0	0	113.3
3	A	54.8	Low	55.1	Low	68 Å²	68	108.2 Å²	108.2	56%	0.562	61%	0.606	S	S	*	*	H	α-helix	trans	-75.3	-27.6	-174.7	0	0	0	0	0	114	W5 Q6 Q7	A3-W5 PolarHBondContact O-N 3.5Å; A3-Q6 PolarHBondContact O-N 3.5Å; A3-Q7 WeakPolarHBondContact O-CG 3.45Å; A3-Q7 PolarHBondContact O-N 2.97Å
4	V	55.5	Low	55.2	Low	90 Å²	90	106.1 Å²	106.1	55%	0.545	60%	0.602	S	S	.	*	H	α-helix	trans	-66.5	-39.8	-178	179	0	0	0	0	111.2	Q6 Q7 V8	V4-Q6 VanDerWaalsContact C-N 3.33Å; V4-Q6 PolarHBondContact O-N 3.02Å; V4-Q7 WeakPolarHBondContact O-CB 3.35Å; V4-Q7 PolarHBondContact O-N 3.02Å; V4-V8 WeakPolarHBondContact O-CG2 3.25Å; V4-V8 PolarHBondContact O-N 3.35Å
5	W	52.5	Low	55.3	Low	185 Å²	185	108 Å²	108	70%	0.701	60%	0.601	S	S	*	*	H	α-helix	trans	-64.6	-37.2	179.5	-67.7	105.3	0	0	0	112.7	A3 Q7 V8 L9	A3-W5 PolarHBondContact O-N 3.5Å; W5-Q7 VanDerWaalsContact C-N 3.32Å; W5-Q7 PolarHBondContact O-N 3.41Å; W5-V8 PolarHBondContact O-N 3.41Å; W5-L9 WeakPolarHBondContact O-CG 3.43Å; W5-L9 PolarHBondContact O-N 3.38Å
6	Q	55.3	Low	55.3	Low	133 Å²	133	103.6 Å²	103.6	62%	0.621	59%	0.588	S	S	*	*	H	α-helix	trans	-67.9	-33.7	175.9	-66.5	-67.2	-13.6	0	0	111.9	A3 V4 A10	A3-Q6 PolarHBondContact O-N 3.5Å; V4-Q6 VanDerWaalsContact C-N 3.33Å; V4-Q6 PolarHBondContact O-N 3.02Å; Q6-A10 VanDerWaalsContact O-CB 3.25Å; Q6-A10 WeakPolarHBondContact O-CB 3.4Å; Q6-A10 PolarHBondContact O-N 3.17Å
7	Q	50.8	Low	55.1	Low	124 Å²	124	109.5 Å²	109.5	58%	0.579	60%	0.599	S	S	*	*	H	α-helix	trans	-68.8	-41.4	174.3	-68.7	171.8	-15.1	0	0	111.5	A3 V4 W5 A10 V11	A3-Q7 WeakPolarHBondContact O-CG 3.45Å; A3-Q7 PolarHBondContact O-N 2.97Å; V4-Q7 WeakPolarHBondContact O-CB 3.35Å; V4-Q7 PolarHBondContact O-N 3.02Å; W5-Q7 VanDerWaalsContact C-N 3.32Å; W5-Q7 PolarHBondContact O-N 3.41Å; Q7-A10 PolarHBondContact O-N 3.25Å; Q7-V11 WeakPolarHBondContact O-CB 3.39Å; Q7-V11 WeakPolarHBondContact O-CG2 3.18Å; Q7-V11 PolarHBondContact O-N 2.89Å
8	V	58.5	Low	54.9	Low	83 Å²	83	107.7 Å²	107.7	50%	0.503	60%	0.595	S	S	.	*	H	α-helix	trans	-63.4	-44.7	177	175.4	0	0	0	0	110.9	V4 W5 V11 D12	V4-V8 WeakPolarHBondContact O-CG2 3.25Å; V4-V8 PolarHBondContact O-N 3.35Å; W5-V8 PolarHBondContact O-N 3.41Å; V8-V11 PolarHBondContact O-N 3.5Å; V8-D12 WeakPolarHBondContact O-CB 3.33Å; V8-D12 PolarHBondContact O-N 3.03Å
9	L	54.9	Low	54.8	Low	107 Å²	107	108 Å²	108	56%	0.56	60%	0.595	S	S	*	*	H	α-helix	trans	-66.6	-37.1	177.3	-68.8	170.2	0	0	0	112.7	W5 D12 A13	W5-L9 WeakPolarHBondContact O-CG 3.43Å; W5-L9 PolarHBondContact O-N 3.38Å; L9-D12 PolarHBondContact O-N 2.75Å; L9-A13 WeakPolarHBondContact O-CB 3.33Å; L9-A13 PolarHBondContact O-N 3.42Å
10	A	56.9	Low	54.6	Low	53 Å²	53	106.8 Å²	106.8	44%	0.438	59%	0.594	S	S	.	*	H	α-helix	trans	-69.1	-37.2	176.2	0	0	0	0	0	112.4	Q6 Q7 S14	Q6-A10 VanDerWaalsContact O-CB 3.25Å; Q6-A10 WeakPolarHBondContact O-CB 3.4Å; Q6-A10 PolarHBondContact O-N 3.17Å; Q7-A10 PolarHBondContact O-N 3.25Å; A10-S14 WeakPolarHBondContact O-CB 3.38Å; A10-S14 PolarHBondContact O-N 2.91Å; A10-S14 PolarHBondContact O-OG 3.37Å
11	V	59.4	Low	54.4	Low	78 Å²	78	104.7 Å²	104.7	47%	0.473	59%	0.591	S	S	.	*	H	α-helix	trans	-67.4	-45	174.2	171.3	0	0	0	0	110	Q7 V8 S14 F15	Q7-V11 WeakPolarHBondContact O-CB 3.39Å; Q7-V11 WeakPolarHBondContact O-CG2 3.18Å; Q7-V11 PolarHBondContact O-N 2.89Å; V8-V11 PolarHBondContact O-N 3.5Å; V11-S14 PolarHBondContact O-N 2.93Å; V11-S14 VanDerWaalsContact O-N 3.15Å; V11-F15 HydrophobicContact CG1-CD2 3.64Å; V11-F15 HydrophobicContact CG1-CE2 3.83Å; V11-F15 WeakPolarHBondContact O-CB 3.43Å; V11-F15 WeakPolarHBondContact O-CD2 3.17Å; V11-F15 PolarHBondContact O-N 2.72Å
12	D	57.8	Low	54.4	Low	114 Å²	114	95.2 Å²	95.2	61%	0.61	55%	0.553	S	S	*	*	H	α-helix	trans	-61.8	-44.8	177.3	-168.8	-98.4	0	0	0	111.9	V8 L9 S14 F15 G16	V8-D12 WeakPolarHBondContact O-CB 3.33Å; V8-D12 PolarHBondContact O-N 3.03Å; L9-D12 PolarHBondContact O-N 2.75Å; D12-S14 VanDerWaalsContact C-N 3.29Å; D12-S14 PolarHBondContact O-N 2.78Å; D12-F15 PolarHBondContact O-N 3.28Å; D12-G16 PolarHBondContact O-N 2.96Å
13	A	58.7	Low	54.2	Low	62 Å²	62	93.5 Å²	93.5	51%	0.512	54%	0.539	S	S	.	.	H	α-helix	trans	-62.5	-35.8	174.3	0	0	0	0	0	112.6	L9 R17	L9-A13 WeakPolarHBondContact O-CB 3.33Å; L9-A13 PolarHBondContact O-N 3.42Å; A13-R17 WeakPolarHBondContact O-CB 3.17Å; A13-R17 PolarHBondContact O-N 2.85Å
14	S	57.3	Low	54	Low	79 Å²	79	93.9 Å²	93.9	55%	0.552	54%	0.542	S	S	*	.	H	α-helix	trans	-73.6	-39.2	177.4	-58.4	0	0	0	0	112.1	A10 V11 D12 S18	A10-S14 WeakPolarHBondContact O-CB 3.38Å; A10-S14 PolarHBondContact O-N 2.91Å; A10-S14 PolarHBondContact O-OG 3.37Å; V11-S14 PolarHBondContact O-N 2.93Å; V11-S14 VanDerWaalsContact O-N 3.15Å; D12-S14 VanDerWaalsContact C-N 3.29Å; D12-S14 PolarHBondContact O-N 2.78Å; S14-S18 WeakPolarHBondContact O-CB 3.23Å; S14-S18 PolarHBondContact O-N 3.3Å
15	F	56.2	Low	53.8	Low	135 Å²	135	94.4 Å²	94.4	59%	0.592	55%	0.55	S	S	*	.	H	α-helix	trans	-66.6	-45.2	172.5	-95.3	-90	0	0	0	111.3	V11 D12 R17 S18 I19	V11-F15 HydrophobicContact CG1-CD2 3.64Å; V11-F15 HydrophobicContact CG1-CE2 3.83Å; V11-F15 WeakPolarHBondContact O-CB 3.43Å; V11-F15 WeakPolarHBondContact O-CD2 3.17Å; V11-F15 PolarHBondContact O-N 2.72Å; D12-F15 PolarHBondContact O-N 3.28Å; F15-R17 VanDerWaalsContact C-N 3.33Å; F15-R17 PolarHBondContact O-N 3.35Å; F15-S18 WeakPolarHBondContact O-CB 3.46Å; F15-S18 PolarHBondContact O-N 2.8Å; F15-I19 WeakPolarHBondContact O-CB 3.4Å; F15-I19 VanDerWaalsContact O-CG1 3.23Å; F15-I19 WeakPolarHBondContact O-CG1 3.46Å; F15-I19 PolarHBondContact O-N 3.15Å
16	G	55.4	Low	53.6	Low	38 Å²	38	87.2 Å²	87.2	39%	0.392	53%	0.527	S	S	.	.	H	α-helix	trans	-60.7	-40	174.6	0	0	0	0	0	112.5	D12 I19 S20	D12-G16 PolarHBondContact O-N 2.96Å; G16-I19 PolarHBondContact O-N 3.47Å; G16-S20 WeakPolarHBondContact O-CB 3.34Å; G16-S20 PolarHBondContact O-N 2.85Å
17	R	51.2	Low	53.4	Low	203 Å²	203	85.6 Å²	85.6	77%	0.766	53%	0.529	S	S	*	.	H	α-helix	trans	-73.4	-33.9	176.5	-164.2	170.1	-179.2	159.8	-1	112.8	A13 F15 S20 A21	A13-R17 WeakPolarHBondContact O-CB 3.17Å; A13-R17 PolarHBondContact O-N 2.85Å; F15-R17 VanDerWaalsContact C-N 3.33Å; F15-R17 PolarHBondContact O-N 3.35Å; R17-S20 PolarHBondContact O-N 3.37Å; R17-A21 VanDerWaalsContact O-CB 3.3Å; R17-A21 WeakPolarHBondContact O-CB 2.86Å; R17-A21 PolarHBondContact O-N 2.77Å
18	S	52.3	Low	53.4	Low	77 Å²	77	83.2 Å²	83.2	54%	0.538	54%	0.538	S	S	.	.	H	α-helix	trans	-65.5	-42.9	170.3	169.9	0	0	0	0	111.7	S14 F15 S20 G22	S14-S18 WeakPolarHBondContact O-CB 3.23Å; S14-S18 PolarHBondContact O-N 3.3Å; F15-S18 WeakPolarHBondContact O-CB 3.46Å; F15-S18 PolarHBondContact O-N 2.8Å; S18-S20 VanDerWaalsContact C-N 3.33Å; S18-G22 WeakPolarHBondContact O-CA 3.29Å; S18-G22 PolarHBondContact O-N 2.87Å
19	I	53.1	Low	53.2	Low	114 Å²	114	88.7 Å²	88.7	59%	0.585	55%	0.55	S	S	*	.	H	α-helix	trans	-64.1	-41.6	172.6	-68.1	168.6	0	0	0	109.4	F15 G16 A23	F15-I19 WeakPolarHBondContact O-CB 3.4Å; F15-I19 VanDerWaalsContact O-CG1 3.23Å; F15-I19 WeakPolarHBondContact O-CG1 3.46Å; F15-I19 PolarHBondContact O-N 3.15Å; G16-I19 PolarHBondContact O-N 3.47Å; I19-A23 WeakPolarHBondContact O-CA 3.33Å; I19-A23 WeakPolarHBondContact O-CB 3.3Å; I19-A23 PolarHBondContact O-N 3.03Å
20	S	50.4	Low	52.9	Low	84 Å²	84	92.3 Å²	92.3	59%	0.587	57%	0.566	S	S	*	*	H	α-helix	trans	-72.7	-34.9	-178.3	-153.2	0	0	0	0	113.4	G16 R17 S18 A24	G16-S20 WeakPolarHBondContact O-CB 3.34Å; G16-S20 PolarHBondContact O-N 2.85Å; R17-S20 PolarHBondContact O-N 3.37Å; S18-S20 VanDerWaalsContact C-N 3.33Å; S20-A24 VanDerWaalsContact O-CB 3.29Å; S20-A24 WeakPolarHBondContact O-CB 3.37Å; S20-A24 PolarHBondContact O-N 2.73Å
21	A	49.7	Very low	52.6	Low	63 Å²	63	93.5 Å²	93.5	52%	0.521	57%	0.569	S	S	.	*	H	α-helix	trans	-80.8	-39.8	176.3	0	0	0	0	0	112.6	R17 A24 S25	R17-A21 VanDerWaalsContact O-CB 3.3Å; R17-A21 WeakPolarHBondContact O-CB 2.86Å; R17-A21 PolarHBondContact O-N 2.77Å; A21-A24 PolarHBondContact O-N 2.68Å; A21-S25 PolarHBondContact O-N 3.13Å
22	G	50	Low	52.5	Low	35 Å²	35	100.2 Å²	100.2	36%	0.361	59%	0.586	S	S	.	*	H	α-helix	trans	-68.4	-38.8	172.9	0	0	0	0	0	112.1	S18 S25 C26	S18-G22 WeakPolarHBondContact O-CA 3.29Å; S18-G22 PolarHBondContact O-N 2.87Å; G22-S25 PolarHBondContact O-N 3.03Å; G22-C26 WeakPolarHBondContact O-CB 2.97Å; G22-C26 PolarHBondContact O-N 3.44Å; G22-C26 PolarHBondContact O-SG 2.94Å
23	A	48.3	Very low	52.2	Low	38 Å²	38	103.8 Å²	103.8	31%	0.314	60%	0.604	S	S	.	*	H	α-helix	trans	-64.8	-46.1	170.1	0	0	0	0	0	110.2	I19 S25 C26 C27	I19-A23 WeakPolarHBondContact O-CA 3.33Å; I19-A23 WeakPolarHBondContact O-CB 3.3Å; I19-A23 PolarHBondContact O-N 3.03Å; A23-S25 VanDerWaalsContact C-N 3.26Å; A23-S25 PolarHBondContact O-N 3.24Å; A23-C26 CarbonylContact O-C 3.54Å; A23-C26 PolarHBondContact O-N 3.06Å; A23-C26 VanDerWaalsContact O-N 3.13Å; A23-C27 VanDerWaalsContact C-SG 3.57Å; A23-C27 WeakPolarHBondContact O-CA 3.5Å; A23-C27 WeakPolarHBondContact O-CB 3.29Å; A23-C27 PolarHBondContact O-N 3.15Å; A23-C27 PolarHBondContact O-SG 3.31Å
24	A	50.3	Low	52	Low	77 Å²	77	104.4 Å²	104.4	64%	0.636	62%	0.617	S	S	*	*	H	α-helix	trans	-58.8	-36.3	177.9	0	0	0	0	0	113.3	S20 A21	S20-A24 VanDerWaalsContact O-CB 3.29Å; S20-A24 WeakPolarHBondContact O-CB 3.37Å; S20-A24 PolarHBondContact O-N 2.73Å; A21-A24 PolarHBondContact O-N 2.68Å
25	S	51	Low	51.7	Low	100 Å²	100	105.1 Å²	105.1	70%	0.699	62%	0.618	S	S	*	*	H	α-helix	trans	-72.4	-34.1	176.7	-169.6	0	0	0	0	113.2	A21 G22 A23	A21-S25 PolarHBondContact O-N 3.13Å; G22-S25 PolarHBondContact O-N 3.03Å; A23-S25 VanDerWaalsContact C-N 3.26Å; A23-S25 PolarHBondContact O-N 3.24Å
26	C	48.7	Very low	51.5	Low	34 Å²	34	104.7 Å²	104.7	23%	0.23	63%	0.629	C	S	.	*	H	α-helix	trans	-99.9	-9.5	-177.2	-41.7	0	0	0	0	113	G22 A23 G28 R29 C39	G22-C26 WeakPolarHBondContact O-CB 2.97Å; G22-C26 PolarHBondContact O-N 3.44Å; G22-C26 PolarHBondContact O-SG 2.94Å; A23-C26 CarbonylContact O-C 3.54Å; A23-C26 PolarHBondContact O-N 3.06Å; A23-C26 VanDerWaalsContact O-N 3.13Å; C26-G28 PolarHBondContact O-N 3.4Å; C26-R29 PolarHBondContact O-N 3.19Å; C26-C39 WeakPolarHBondContact CB-SG 3.37Å; C26-C39 WeakPolarHBondContact SG-CB 3.43Å; C26-C39 CovalentContact SG-SG 2.07Å; C26-C39 PolarHBondContact SG-SG 2.85Å
27	C	50.1	Low	51.8	Low	99 Å²	99	107.3 Å²	107.3	67%	0.669	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.5	6.9	179.8	-77.9	0	0	0	0	114.6	A23 R29	A23-C27 VanDerWaalsContact C-SG 3.57Å; A23-C27 WeakPolarHBondContact O-CA 3.5Å; A23-C27 WeakPolarHBondContact O-CB 3.29Å; A23-C27 PolarHBondContact O-N 3.15Å; A23-C27 PolarHBondContact O-SG 3.31Å; C27-R29 VanDerWaalsContact C-N 3.31Å
28	G	51.2	Low	52	Low	74 Å²	74	108.3 Å²	108.3	76%	0.763	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.3	-19.1	162.1	0	0	0	0	0	112.9	C26	C26-G28 PolarHBondContact O-N 3.4Å
29	R	54.8	Low	52	Low	199 Å²	199	108.3 Å²	108.3	75%	0.751	63%	0.634	S	S	*	*	S	Bend	trans	-144.7	103.6	-177.7	-82.7	-179.1	167.4	174.5	-4.4	110.7	C26 C27 P31	C26-R29 PolarHBondContact O-N 3.19Å; C27-R29 VanDerWaalsContact C-N 3.31Å; R29-P31 WeakPolarHBondContact O-CD 3.21Å; R29-P31 VanDerWaalsContact O-N 3.13Å
30	M	47.7	Very low	52.1	Low	182 Å²	182	109 Å²	109	90%	0.897	64%	0.642	S	S	*	*			trans	-45.7	117.3	169.1	-145.7	147.6	-173.6	0	0	109.9	R32	M30-R32 PolarHBondContact O-N 2.94Å
31	P	52	Low	52.2	Low	78 Å²	78	108.1 Å²	108.1	51%	0.506	65%	0.647	S	S	.	*			trans	-66.9	120.1	179.8	5.8	-2.3	0	0	0	108.4	R29 L33 Q37	R29-P31 WeakPolarHBondContact O-CD 3.21Å; R29-P31 VanDerWaalsContact O-N 3.13Å; P31-L33 PolarHBondContact O-N 3.2Å; P31-Q37 HydrophobicContact CB-CG 4.49Å
32	R	56.2	Low	51.9	Low	219 Å²	219	110.7 Å²	110.7	83%	0.826	66%	0.661	S	S	*	*			trans	-62.4	128	172.5	-70.9	-173.7	171.3	-155	-2.2	108.2	M30 G34 T35	M30-R32 PolarHBondContact O-N 2.94Å; R32-G34 VanDerWaalsContact C-N 3.31Å; R32-G34 PolarHBondContact O-N 3.23Å; R32-T35 PolarHBondContact O-N 2.07Å
33	L	51	Low	51.6	Low	190 Å²	190	118.7 Å²	118.7	100%	0.995	70%	0.704	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.7	86.6	-178	-156.5	85.5	0	0	0	110	P31	P31-L33 PolarHBondContact O-N 3.2Å
34	G	54.1	Low	51.8	Low	75 Å²	75	122.8 Å²	122.8	77%	0.773	72%	0.723	S	S	*	*	T	Hydrogen-bonded Turn	trans	162.5	-15.2	-175.4	0	0	0	0	0	115.8	R32	R32-G34 VanDerWaalsContact C-N 3.31Å; R32-G34 PolarHBondContact O-N 3.23Å
35	T	52.8	Low	51.9	Low	94 Å²	94	125.2 Å²	125.2	58%	0.577	73%	0.728	S	S	*	*	S	Bend	trans	-128.3	129.5	173.9	46.1	0	0	0	0	111.5	R32 Q37	R32-T35 PolarHBondContact O-N 2.07Å; T35-Q37 PolarHBondContact O-N 3.13Å
36	P	52	Low	51.9	Low	126 Å²	126	126.6 Å²	126.6	82%	0.818	73%	0.729	S	S	*	*			trans	-67.3	101.4	167.3	27.3	-29.6	0	0	0	107.2	R38	P36-R38 VanDerWaalsContact C-N 3.28Å; P36-R38 PolarHBondContact O-N 3.04Å
37	Q	60.1	Low	52.1	Low	92 Å²	92	132 Å²	132	43%	0.43	76%	0.758	S	S	.	*			trans	-66.9	95	168.1	-88.7	-178.1	-19.1	0	0	107.6	P31 T35 C39	P31-Q37 HydrophobicContact CB-CG 4.49Å; T35-Q37 PolarHBondContact O-N 3.13Å; Q37-C39 VanDerWaalsContact C-N 3.34Å; Q37-C39 PolarHBondContact O-N 2.78Å
38	R	55.9	Low	52.3	Low	225 Å²	225	134.1 Å²	134.1	85%	0.849	76%	0.764	S	S	*	*			trans	-61.5	104.7	155.5	-88.4	179.4	158.1	168.6	-5.6	105.7	P36 V40	P36-R38 VanDerWaalsContact C-N 3.28Å; P36-R38 PolarHBondContact O-N 3.04Å; R38-V40 HydrophobicContact CB-CG2 4.42Å; R38-V40 PolarHBondContact O-N 3.4Å
39	C	52.9	Low	52.3	Low	77 Å²	77	138.1 Å²	138.1	52%	0.52	76%	0.764	S	S	.	*			trans	-65.1	94.3	162.9	-55.4	0	0	0	0	104.8	C26 Q37 G41	C26-C39 WeakPolarHBondContact CB-SG 3.37Å; C26-C39 WeakPolarHBondContact SG-CB 3.43Å; C26-C39 CovalentContact SG-SG 2.07Å; C26-C39 PolarHBondContact SG-SG 2.85Å; Q37-C39 VanDerWaalsContact C-N 3.34Å; Q37-C39 PolarHBondContact O-N 2.78Å; C39-G41 PolarHBondContact O-N 2.88Å; C39-G41 VanDerWaalsContact O-N 3.13Å
40	V	54.8	Low	52.2	Low	127 Å²	127	133.7 Å²	133.7	77%	0.77	77%	0.765	S	S	*	*			trans	-68.1	110.8	177.7	-178.1	0	0	0	0	104.9	R38 S42	R38-V40 HydrophobicContact CB-CG2 4.42Å; R38-V40 PolarHBondContact O-N 3.4Å; V40-S42 PolarHBondContact O-N 3Å
41	G	51.8	Low	52.5	Low	66 Å²	66	130 Å²	130	68%	0.68	76%	0.755	S	S	*	*			trans	-53.5	114.3	170.2	0	0	0	0	0	107.5	C39 T43	C39-G41 PolarHBondContact O-N 2.88Å; C39-G41 VanDerWaalsContact O-N 3.13Å; G41-T43 PolarHBondContact O-N 3.14Å; G41-T43 VanDerWaalsContact O-N 3.14Å
42	S	44.2	Very low	52.5	Low	117 Å²	117	134.3 Å²	134.3	82%	0.818	78%	0.776	S	S	*	*			trans	-64.2	114.7	162.9	-168.7	0	0	0	0	105	V40	V40-S42 PolarHBondContact O-N 3Å
43	T	44.7	Very low	52.2	Low	204 Å²	204	126.6 Å²	126.6	100%	1.252	77%	0.771	S	S	*	*			trans	-41	0	155.3	16.2	0	0	0	0	111	G41	G41-T43 PolarHBondContact O-N 3.14Å; G41-T43 VanDerWaalsContact O-N 3.14Å

Retrieved 43 of 43 residues in 21.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).