A0A087X2P5_POEFO Loading...

10 kDa heat shock protein, mitochondrial

Co-chaperonin implicated in mitochondrial protein import and macromolecular assembly. Together with Hsp60, facilitates the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix. The functional units of these chaperonins consist of heptameric rings of the large subunit Hsp60, which function as a back-to-back double ring. In a cyclic reaction, Hsp60 ring complexes bind one unfolded substrate protein per ring, followed by the binding of ATP and association with 2 heptameric rings of the co-chaperonin Hsp10. This leads to sequestration of the substrate protein in the inner cavity of Hsp60 where, for a certain period of time, it can fold undisturbed by other cell components. Synchronous hydrolysis of ATP in all Hsp60 subunits results in the dissociation of the chaperonin rings and the release of ADP and the folded substrate protein.

AlphaFold DB , UniProt , Accession A0A087X2P5, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 99 aa.

						>A0A087X2P5_POEFO|A0A087X2P5
MAFRKFLPLFDRVLVERLTAETVTKGGIMLPEKSQGKVLQATVVAVGPGSVNQKGHVQPVSVKVGEKVLLPEYGGTKVVLEEKDYFLFRDGDILGKYVD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	65.9	Low	87	Confident	161 Å²	161	88 Å²	88	79%	0.793	43%	0.431	S	S	*	.				0	138.1	0	-78.1	176	174.4	0	0	108.2	V46	M1-V46 PolarHBondContact N-O 2.91Å
2	A	77.5	Confident	87.7	Confident	70 Å²	70	88 Å²	88	58%	0.579	42%	0.423	S	S	*	.			trans	-83.1	144	179.4	0	0	0	0	0	110.8	F6 L7	A2-F6 CarbonylContact C-O 3.55Å; A2-F6 WeakPolarHBondContact CA-O 3.44Å; A2-L7 HydrophobicContact CB-CB 4.1Å; A2-L7 HydrophobicContact CB-CD1 4.06Å
3	F	82.9	Confident	88.3	Confident	53 Å²	53	81.2 Å²	81.2	23%	0.232	39%	0.391	C	S	.	.	B	Isolated β-bridge	trans	-126.6	125.6	176.8	178.7	-99.4	0	0	0	109.2	K5 F6 L14 V44 A45 L80 Y85	F3-K5 VanDerWaalsContact C-N 3.27Å; F3-K5 PolarHBondContact O-N 3.22Å; F3-F6 PolarHBondContact N-O 2.93Å; F3-F6 WeakPolarHBondContact O-CA 3.37Å; F3-F6 VanDerWaalsContact O-CB 3.32Å; F3-F6 WeakPolarHBondContact O-CB 3.12Å; F3-F6 PolarHBondContact O-N 2.86Å; F3-L14 HydrophobicContact CD1-CD2 4.13Å; F3-V44 HydrophobicContact CD1-CB 4.31Å; F3-V44 HydrophobicContact CD1-CG2 4.22Å; F3-V44 HydrophobicContact CD2-CB 4.21Å; F3-V44 HydrophobicContact CE1-CB 4.31Å; F3-V44 HydrophobicContact CE1-CG2 4.34Å; F3-V44 HydrophobicContact CE2-CB 4.23Å; F3-V44 HydrophobicContact CG-CB 4.25Å; F3-V44 HydrophobicContact CZ-CB 4.28Å; F3-V44 HydrophobicContact CZ-CG1 4.46Å; F3-A45 HydrophobicContact CB-CB 3.7Å; F3-L80 HydrophobicContact CD1-CD1 4.44Å; F3-Y85 HydrophobicContact CE1-CD1 4.44Å; F3-Y85 AromaticContact CE1-CE1 3.65Å; F3-Y85 HydrophobicContact CE1-CE1 3.65Å; F3-Y85 HydrophobicContact CE1-CE2 4.21Å; F3-Y85 AromaticContact CE1-CZ 3.52Å; F3-Y85 WeakPolarHBondContact CE1-OH 3.49Å; F3-Y85 HydrophobicContact CZ-CE1 4.11Å
4	R	84.9	Confident	88.8	Confident	78 Å²	78	75.4 Å²	75.4	29%	0.294	36%	0.363	S	S	.	.	T	Hydrogen-bonded Turn	trans	47.6	46.8	-179.7	-63.4	179	174.8	-144.9	-18.6	113.5	F6 E81 Y85	R4-F6 PolarHBondContact O-N 3.04Å; R4-F6 VanDerWaalsContact O-N 3.11Å; R4-E81 HydrophobicContact CB-CG 4.47Å; R4-E81 VanDerWaalsContact CD-CD 3.43Å; R4-E81 WeakPolarHBondContact CD-OE2 3.25Å; R4-E81 WeakPolarHBondContact CG-OE1 3.23Å; R4-E81 IonicContact CZ-OE2 3.06Å; R4-E81 IonicContact NE-OE2 3.78Å; R4-E81 PolarHBondContact NE-OE2 2.83Å; R4-E81 IonicContact NH1-OE2 2.73Å; R4-E81 PolarHBondContact NH1-OE2 3.08Å; R4-E81 IonicContact NH2-OE2 3.03Å; R4-E81 PolarHBondContact NH2-OE2 3.39Å; R4-Y85 PolarHBondContact NE-OH 2.97Å; R4-Y85 PolarHBondContact NH1-OH 2.82Å
5	K	88.8	Confident	89.3	Confident	214 Å²	214	70.4 Å²	70.4	93%	0.93	34%	0.338	S	S	*	.	T	Hydrogen-bonded Turn	trans	62.2	9.6	-175.5	-54	177.4	-179.4	176	0	115.4	F3	F3-K5 VanDerWaalsContact C-N 3.27Å; F3-K5 PolarHBondContact O-N 3.22Å
6	F	91.4	Very high	89.6	Confident	54 Å²	54	70.3 Å²	70.3	24%	0.237	34%	0.337	C	S	.	.	B	Isolated β-bridge	trans	-103.2	124.1	173.1	-173.6	-92.8	0	0	0	110.3	A2 F3 R4 P8 L14 V78 L80 L87	A2-F6 CarbonylContact C-O 3.55Å; A2-F6 WeakPolarHBondContact CA-O 3.44Å; F3-F6 PolarHBondContact N-O 2.93Å; F3-F6 WeakPolarHBondContact O-CA 3.37Å; F3-F6 VanDerWaalsContact O-CB 3.32Å; F3-F6 WeakPolarHBondContact O-CB 3.12Å; F3-F6 PolarHBondContact O-N 2.86Å; R4-F6 PolarHBondContact O-N 3.04Å; R4-F6 VanDerWaalsContact O-N 3.11Å; F6-P8 HydrophobicContact CD1-CG 4.26Å; F6-P8 HydrophobicContact CE1-CG 4.02Å; F6-L14 HydrophobicContact CD1-CD1 4.43Å; F6-L14 HydrophobicContact CD1-CD2 3.88Å; F6-L14 HydrophobicContact CE1-CD1 4.08Å; F6-L14 HydrophobicContact CE1-CD2 4.31Å; F6-V78 HydrophobicContact CE2-CG1 4.22Å; F6-V78 HydrophobicContact CZ-CG1 4.47Å; F6-L80 HydrophobicContact CB-CD1 3.63Å; F6-L80 HydrophobicContact CB-CD2 3.94Å; F6-L80 HydrophobicContact CB-CG 4.47Å; F6-L80 HydrophobicContact CD1-CD1 4.29Å; F6-L80 HydrophobicContact CD2-CD2 4.09Å; F6-L80 HydrophobicContact CG-CD1 3.93Å; F6-L80 HydrophobicContact CG-CD2 4.19Å; F6-L87 HydrophobicContact CE1-CD1 3.97Å; F6-L87 HydrophobicContact CZ-CD1 4.34Å; F6-L87 HydrophobicContact CZ-CD2 4.18Å
7	L	93.6	Very high	89.7	Confident	92 Å²	92	69.1 Å²	69.1	48%	0.482	33%	0.329	S	S	.	.			trans	-117.2	112.8	175.3	-178.2	66.4	0	0	0	109	A2	A2-L7 HydrophobicContact CB-CB 4.1Å; A2-L7 HydrophobicContact CB-CD1 4.06Å
8	P	93.9	Very high	89.5	Confident	1 Å²	1	68.4 Å²	68.4	1%	0.006	33%	0.327	C	S	.	.			trans	-59.9	140.4	173.1	-21.3	32.2	0	0	0	111.2	F6 R12 L14 A45 G47 L87	F6-P8 HydrophobicContact CD1-CG 4.26Å; F6-P8 HydrophobicContact CE1-CG 4.02Å; P8-R12 HydrophobicContact CB-CB 3.81Å; P8-R12 VanDerWaalsContact CB-O 3.23Å; P8-R12 WeakPolarHBondContact CB-O 3.42Å; P8-L14 HydrophobicContact CG-CB 4.03Å; P8-A45 HydrophobicContact CG-CB 3.74Å; P8-G47 WeakPolarHBondContact O-CA 3.48Å; P8-L87 HydrophobicContact CB-CD1 4.18Å; P8-L87 HydrophobicContact CG-CD1 4.31Å
9	L	93.4	Very high	89	Confident	106 Å²	106	71.9 Å²	71.9	56%	0.555	35%	0.353	S	S	*	.			trans	-98.3	145.3	179.2	-61.3	-179	0	0	0	111.7	D11 R12	L9-D11 PolarHBondContact O-N 2.88Å; L9-R12 VanDerWaalsContact O-CB 3.25Å; L9-R12 WeakPolarHBondContact O-CB 3.45Å; L9-R12 WeakPolarHBondContact O-CD 3.44Å; L9-R12 WeakPolarHBondContact O-CG 3.42Å; L9-R12 PolarHBondContact O-N 3.03Å; L9-R12 PolarHBondContact O-NH1 2.96Å
10	F	92.2	Very high	88.2	Confident	112 Å²	112	70 Å²	70	49%	0.491	35%	0.349	S	S	.	.	T	Hydrogen-bonded Turn	trans	56.9	-127.3	179.5	-54.8	-80.5	0	0	0	112.6	R12 G47 G49	F10-R12 PolarHBondContact O-N 3.03Å; F10-G47 CarbonylContact O-C 3.6Å; F10-G47 WeakPolarHBondContact O-CA 3.3Å; F10-G49 CarbonylContact C-O 3.56Å; F10-G49 VanDerWaalsContact C-O 3.26Å; F10-G49 VanDerWaalsContact CA-O 3.29Å; F10-G49 WeakPolarHBondContact CA-O 3.38Å; F10-G49 WeakPolarHBondContact O-CA 3.36Å; F10-G49 PolarHBondContact O-N 2.83Å
11	D	92.8	Very high	87.3	Confident	27 Å²	27	73.4 Å²	73.4	14%	0.144	36%	0.364	C	S	.	.	T	Hydrogen-bonded Turn	trans	-82.3	13.2	179.7	63.9	-27.8	0	0	0	113.6	L9 R89 D90	L9-D11 PolarHBondContact O-N 2.88Å; D11-R89 CarbonylContact O-C 3.58Å; D11-R89 WeakPolarHBondContact O-CA 3.48Å; D11-R89 IonicContact OD1-NH1 3.71Å; D11-R89 IonicContact OD2-NH1 3.09Å; D11-R89 PolarHBondContact OD2-NH1 3.06Å; D11-R89 VanDerWaalsContact OD2-NH1 3.09Å; D11-D90 PolarHBondContact O-N 3.45Å
12	R	95	Very high	87.5	Confident	88 Å²	88	68.9 Å²	68.9	33%	0.332	35%	0.345	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.4	141.4	-178	-67.4	172.2	176	77.1	-2.1	111.9	P8 L9 F10 G47 L87 F88	P8-R12 HydrophobicContact CB-CB 3.81Å; P8-R12 VanDerWaalsContact CB-O 3.23Å; P8-R12 WeakPolarHBondContact CB-O 3.42Å; L9-R12 VanDerWaalsContact O-CB 3.25Å; L9-R12 WeakPolarHBondContact O-CB 3.45Å; L9-R12 WeakPolarHBondContact O-CD 3.44Å; L9-R12 WeakPolarHBondContact O-CG 3.42Å; L9-R12 PolarHBondContact O-N 3.03Å; L9-R12 PolarHBondContact O-NH1 2.96Å; F10-R12 PolarHBondContact O-N 3.03Å; R12-G47 PolarHBondContact O-N 3.01Å; R12-L87 HydrophobicContact CB-CD1 4.06Å; R12-L87 HydrophobicContact CB-CG 4.28Å; R12-F88 CarbonylContact C-O 3.38Å; R12-F88 WeakPolarHBondContact CA-O 3.3Å
13	V	95.6	Very high	87.3	Confident	0 Å²	0	69.2 Å²	69.2	0%	0	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.9	124.5	179.9	-177.9	0	0	0	0	108.6	V15 V43 V46 V60 V62 L87 F88 D90 I93	V13-V15 HydrophobicContact CG1-CG1 3.98Å; V13-V43 HydrophobicContact CG1-CG1 3.69Å; V13-V43 HydrophobicContact CG1-CG2 4.15Å; V13-V46 HydrophobicContact CG1-CG1 4.3Å; V13-V60 HydrophobicContact CG2-CG1 4.36Å; V13-V62 HydrophobicContact CB-CG2 4.45Å; V13-V62 HydrophobicContact CG1-CG2 3.81Å; V13-V62 HydrophobicContact CG2-CG2 3.79Å; V13-L87 WeakPolarHBondContact O-CA 3.46Å; V13-F88 PolarHBondContact N-O 3.02Å; V13-F88 PolarHBondContact O-N 3.46Å; V13-D90 HydrophobicContact CG2-CB 4.15Å; V13-I93 HydrophobicContact CB-CD1 4.01Å; V13-I93 HydrophobicContact CG1-CD1 3.92Å; V13-I93 HydrophobicContact CG2-CD1 4.13Å
14	L	95.9	Very high	87	Confident	0 Å²	0	68.8 Å²	68.8	0%	0	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.3	130.6	174.9	-170.3	75.2	0	0	0	109.1	F3 F6 P8 V44 A45 V78 L80 Y85 F86 L87	F3-L14 HydrophobicContact CD1-CD2 4.13Å; F6-L14 HydrophobicContact CD1-CD1 4.43Å; F6-L14 HydrophobicContact CD1-CD2 3.88Å; F6-L14 HydrophobicContact CE1-CD1 4.08Å; F6-L14 HydrophobicContact CE1-CD2 4.31Å; P8-L14 HydrophobicContact CG-CB 4.03Å; L14-V44 HydrophobicContact CB-CG2 4Å; L14-V44 HydrophobicContact CD2-CG2 3.66Å; L14-V44 HydrophobicContact CG-CG2 3.66Å; L14-V44 VanDerWaalsContact O-CG2 3.3Å; L14-V44 WeakPolarHBondContact O-CG2 3.41Å; L14-V44 PolarHBondContact O-N 2.91Å; L14-A45 HydrophobicContact CB-CB 3.84Å; L14-A45 HydrophobicContact CD2-CB 4.25Å; L14-A45 PolarHBondContact N-O 2.8Å; L14-A45 PolarHBondContact O-N 3.44Å; L14-V78 HydrophobicContact CD1-CB 4.44Å; L14-L80 HydrophobicContact CD2-CD1 3.73Å; L14-Y85 HydrophobicContact CD2-CG 4.4Å; L14-F86 WeakPolarHBondContact CA-O 3.32Å; L14-L87 HydrophobicContact CB-CD1 4.04Å; L14-L87 HydrophobicContact CD1-CB 4.3Å; L14-L87 HydrophobicContact CD1-CD1 3.92Å
15	V	95.5	Very high	86.5	Confident	0 Å²	0	75.1 Å²	75.1	0%	0	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.7	149.1	-177.5	-56.9	0	0	0	0	111.3	V13 A41 T42 V43 V68 L70 F86 F88	V13-V15 HydrophobicContact CG1-CG1 3.98Å; V15-A41 HydrophobicContact CB-CB 3.9Å; V15-A41 HydrophobicContact CG2-CB 4.03Å; V15-T42 CarbonylContact C-O 3.6Å; V15-T42 VanDerWaalsContact CA-O 3.3Å; V15-T42 WeakPolarHBondContact CA-O 3.23Å; V15-V43 HydrophobicContact CG1-CG2 4.2Å; V15-V68 HydrophobicContact CG1-CG2 4.24Å; V15-L70 HydrophobicContact CG1-CD2 4.35Å; V15-L70 HydrophobicContact CG2-CD1 3.86Å; V15-L70 HydrophobicContact CG2-CD2 3.94Å; V15-F86 HydrophobicContact CG2-CB 4.01Å; V15-F86 WeakPolarHBondContact CG2-O 3.5Å; V15-F86 PolarHBondContact N-O 2.81Å; V15-F86 PolarHBondContact O-N 3.36Å; V15-F88 HydrophobicContact CG2-CD2 3.81Å; V15-F88 HydrophobicContact CG2-CE2 3.95Å
16	E	93.9	Very high	86	Confident	69 Å²	69	68.3 Å²	68.3	32%	0.322	36%	0.362	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.8	122	170	-174.2	172.8	-169.8	0	0	108.3	A41 T42 V44 Y85	E16-A41 CarbonylContact O-C 3.59Å; E16-A41 VanDerWaalsContact O-CA 3.23Å; E16-A41 WeakPolarHBondContact O-CA 3.42Å; E16-A41 VanDerWaalsContact O-CB 3.3Å; E16-A41 WeakPolarHBondContact O-CB 3.33Å; E16-T42 PolarHBondContact N-O 2.73Å; E16-T42 PolarHBondContact O-N 3.47Å; E16-V44 HydrophobicContact CB-CG1 3.87Å; E16-Y85 HydrophobicContact CB-CD1 3.87Å; E16-Y85 HydrophobicContact CB-CE1 3.91Å; E16-Y85 HydrophobicContact CG-CD1 4.28Å; E16-Y85 HydrophobicContact CG-CE1 4.05Å
17	R	91.8	Very high	85.4	Confident	50 Å²	50	68.6 Å²	68.6	19%	0.189	38%	0.38	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.2	142.5	178.1	-73.4	-177.8	178.6	173.1	-0.5	110	V38 A41 L70 F86	R17-V38 WeakPolarHBondContact CD-O 3.46Å; R17-A41 HydrophobicContact CG-CB 4.42Å; R17-L70 HydrophobicContact CG-CD1 4.14Å; R17-F86 HydrophobicContact CG-CD2 3.89Å; R17-F86 HydrophobicContact CG-CE2 4.07Å
18	L	86.3	Confident	84.7	Confident	57 Å²	57	69.8 Å²	69.8	30%	0.298	39%	0.386	S	S	.	.	P	Polyproline II helix	trans	-67.7	150.8	172.2	-62.7	179.6	0	0	0	110.1	V38 Q40	L18-V38 HydrophobicContact CB-CG1 4.13Å; L18-V38 WeakPolarHBondContact O-CB 3.36Å; L18-V38 WeakPolarHBondContact O-CG1 3.38Å; L18-V38 WeakPolarHBondContact O-CG2 3.37Å; L18-Q40 HydrophobicContact CD1-CB 3.7Å; L18-Q40 HydrophobicContact CG-CB 4.28Å; L18-Q40 PolarHBondContact N-O 3.31Å
19	T	79.3	Confident	83.9	Confident	135 Å²	135	76.9 Å²	76.9	83%	0.828	42%	0.421	S	S	*	.	P	Polyproline II helix	trans	-63.2	136.2	174.4	49.1	0	0	0	0	110.2
20	A	74.2	Confident	83.1	Confident	32 Å²	32	75.1 Å²	75.1	26%	0.264	41%	0.412	S	S	.	.	P	Polyproline II helix	trans	-64.1	138	176.3	0	0	0	0	0	110.6	T22 Q35 V38	A20-T22 PolarHBondContact O-N 2.79Å; A20-Q35 HydrophobicContact CB-CB 3.96Å; A20-Q35 HydrophobicContact CB-CG 4.19Å; A20-V38 HydrophobicContact CB-CG2 3.62Å
21	E	69.1	Low	82.3	Confident	142 Å²	142	73.6 Å²	73.6	66%	0.664	41%	0.413	S	S	*	.			trans	-63.7	107.7	173.1	-74.1	-173.7	166.6	0	0	109.3	Q35	E21-Q35 PolarHBondContact O-NE2 3.23Å
22	T	70.3	Confident	81.2	Confident	66 Å²	66	80 Å²	80	41%	0.405	44%	0.442	S	S	.	.	S	Bend	trans	-79.9	-21.6	177.6	50.1	0	0	0	0	112.4	A20 M29 L30 Q35	A20-T22 PolarHBondContact O-N 2.79Å; T22-M29 CarbonylContact O-C 3.4Å; T22-M29 WeakPolarHBondContact O-CA 3.44Å; T22-L30 PolarHBondContact O-N 3.4Å; T22-Q35 VanDerWaalsContact CA-NE2 3.26Å
23	V	73.2	Confident	79.9	Confident	77 Å²	77	85.8 Å²	85.8	47%	0.467	47%	0.469	S	S	.	.	B	Isolated β-bridge	trans	-123.6	121	179.5	-175	0	0	0	0	108.4
24	T	76.4	Confident	78.5	Confident	44 Å²	44	90 Å²	90	27%	0.27	50%	0.499	S	S	.	.			trans	-69.5	161.1	173.9	58.4	0	0	0	0	110.8	G26 G27 I28 L30	T24-G26 PolarHBondContact O-N 2.92Å; T24-G27 PolarHBondContact O-N 3.06Å; T24-I28 PolarHBondContact N-O 2.9Å; T24-I28 WeakPolarHBondContact OG1-CB 3.18Å; T24-I28 PolarHBondContact OG1-N 2.85Å; T24-I28 PolarHBondContact OG1-O 2.83Å; T24-L30 HydrophobicContact CG2-CD1 3.65Å; T24-L30 HydrophobicContact CG2-CD2 4.28Å; T24-L30 HydrophobicContact CG2-CG 3.85Å
25	K	73.8	Confident	77.1	Confident	212 Å²	212	92.1 Å²	92.1	92%	0.922	51%	0.509	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.3	-20.2	176.3	-64.8	-177.6	-179.7	179.5	0	114.4
26	G	78.1	Confident	75.9	Confident	71 Å²	71	95 Å²	95	73%	0.732	54%	0.539	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.3	6	175.8	0	0	0	0	0	115.3	T24 I28	T24-G26 PolarHBondContact O-N 2.92Å; G26-I28 VanDerWaalsContact C-N 3.34Å
27	G	79.4	Confident	75	Confident	59 Å²	59	98.1 Å²	98.1	61%	0.608	55%	0.551	S	S	*	*	S	Bend	trans	81.8	6.4	180	0	0	0	0	0	115.1	T24	T24-G27 PolarHBondContact O-N 3.06Å
28	I	78.6	Confident	74.7	Confident	118 Å²	118	97.4 Å²	97.4	61%	0.605	55%	0.552	S	S	*	*	P	Polyproline II helix	trans	-83.5	125.9	178.2	-54.5	172.6	0	0	0	109	T24 G26	T24-I28 PolarHBondContact N-O 2.9Å; T24-I28 WeakPolarHBondContact OG1-CB 3.18Å; T24-I28 PolarHBondContact OG1-N 2.85Å; T24-I28 PolarHBondContact OG1-O 2.83Å; G26-I28 VanDerWaalsContact C-N 3.34Å
29	M	77.3	Confident	74.9	Confident	150 Å²	150	97.6 Å²	97.6	74%	0.739	55%	0.553	S	S	*	*	B	Isolated β-bridge	trans	-80	123.8	176.4	-162.8	173	177	0	0	110.2	T22	T22-M29 CarbonylContact O-C 3.4Å; T22-M29 WeakPolarHBondContact O-CA 3.44Å
30	L	75.6	Confident	75.5	Confident	69 Å²	69	95.4 Å²	95.4	36%	0.361	53%	0.534	S	S	.	.	P	Polyproline II helix	trans	-87.5	135.1	178.3	-70.5	168	0	0	0	110	T22 T24 Q35	T22-L30 PolarHBondContact O-N 3.4Å; T24-L30 HydrophobicContact CG2-CD1 3.65Å; T24-L30 HydrophobicContact CG2-CD2 4.28Å; T24-L30 HydrophobicContact CG2-CG 3.85Å; L30-Q35 HydrophobicContact CB-CG 4.45Å
31	P	76.9	Confident	76.5	Confident	80 Å²	80	93.9 Å²	93.9	52%	0.519	52%	0.521	S	S	.	.	P	Polyproline II helix	trans	-64.9	137.9	172.5	24.7	-30.6	0	0	0	110.3	K33 S34	P31-K33 PolarHBondContact O-N 3.34Å; P31-S34 PolarHBondContact O-N 3.47Å
32	E	69.7	Low	77.8	Confident	161 Å²	161	88.9 Å²	88.9	75%	0.752	50%	0.5	S	S	*	.	G	3₁₀ helix	trans	-55.8	-30.9	-175.6	-63.4	-174.9	139.7	0	0	113.1	S34 Q35	E32-S34 VanDerWaalsContact C-N 3.27Å; E32-S34 PolarHBondContact O-N 3.11Å; E32-Q35 PolarHBondContact O-N 2.81Å
33	K	66.2	Low	79	Confident	210 Å²	210	85.8 Å²	85.8	91%	0.913	48%	0.481	S	S	*	.	G	3₁₀ helix	trans	-68.7	-21.3	178	-68.4	-172.6	179.3	-177.2	0	114.2	P31	P31-K33 PolarHBondContact O-N 3.34Å
34	S	66.4	Low	80	Confident	89 Å²	89	82.9 Å²	82.9	62%	0.622	46%	0.464	S	S	*	.	G	3₁₀ helix	trans	-93.1	-8	179	-63.1	0	0	0	0	112.6	P31 E32 G36	P31-S34 PolarHBondContact O-N 3.47Å; E32-S34 VanDerWaalsContact C-N 3.27Å; E32-S34 PolarHBondContact O-N 3.11Å; S34-G36 PolarHBondContact O-N 3.19Å
35	Q	66.4	Low	80.9	Confident	44 Å²	44	80.8 Å²	80.8	21%	0.206	45%	0.451	C	S	.	.			trans	-79.4	103.5	174.9	-64.5	179.2	-52.2	0	0	108.4	A20 E21 T22 L30 E32	A20-Q35 HydrophobicContact CB-CB 3.96Å; A20-Q35 HydrophobicContact CB-CG 4.19Å; E21-Q35 PolarHBondContact O-NE2 3.23Å; T22-Q35 VanDerWaalsContact CA-NE2 3.26Å; L30-Q35 HydrophobicContact CB-CG 4.45Å; E32-Q35 PolarHBondContact O-N 2.81Å
36	G	70.6	Confident	81.9	Confident	61 Å²	61	71.6 Å²	71.6	63%	0.629	41%	0.413	S	S	*	.	P	Polyproline II helix	trans	-59.7	173.3	172.8	0	0	0	0	0	112.2	S34 V38	S34-G36 PolarHBondContact O-N 3.19Å; G36-V38 PolarHBondContact O-N 2.96Å; G36-V38 VanDerWaalsContact O-N 3.13Å
37	K	74.6	Confident	82.6	Confident	133 Å²	133	68.5 Å²	68.5	58%	0.578	38%	0.381	S	S	*	.	P	Polyproline II helix	trans	-58.5	121.8	173.4	-68.5	175.3	-177.4	171.3	0	109	L39	K37-L39 PolarHBondContact O-N 3.09Å; K37-L39 VanDerWaalsContact O-N 3.15Å
38	V	85.6	Confident	83.2	Confident	36 Å²	36	69.8 Å²	69.8	22%	0.218	38%	0.378	C	S	.	.	P	Polyproline II helix	trans	-65.8	117	172.2	-175	0	0	0	0	108.2	R17 L18 A20 G36 Q40	R17-V38 WeakPolarHBondContact CD-O 3.46Å; L18-V38 HydrophobicContact CB-CG1 4.13Å; L18-V38 WeakPolarHBondContact O-CB 3.36Å; L18-V38 WeakPolarHBondContact O-CG1 3.38Å; L18-V38 WeakPolarHBondContact O-CG2 3.37Å; A20-V38 HydrophobicContact CB-CG2 3.62Å; G36-V38 PolarHBondContact O-N 2.96Å; G36-V38 VanDerWaalsContact O-N 3.13Å; V38-Q40 VanDerWaalsContact C-N 3.31Å; V38-Q40 HydrophobicContact CG1-CB 4.13Å
39	L	91.1	Very high	83.7	Confident	61 Å²	61	64.2 Å²	64.2	32%	0.319	35%	0.35	S	S	.	.			trans	-81.5	-14.9	179.6	-57.9	-177.2	0	0	0	112.1	K37 L69 L70 E72	K37-L39 PolarHBondContact O-N 3.09Å; K37-L39 VanDerWaalsContact O-N 3.15Å; L39-L69 HydrophobicContact CB-CD1 3.86Å; L39-L70 VanDerWaalsContact O-CB 3.3Å; L39-L70 WeakPolarHBondContact O-CB 3.43Å; L39-L70 WeakPolarHBondContact O-CG 3.33Å; L39-L70 PolarHBondContact O-N 2.89Å; L39-E72 HydrophobicContact CD2-CB 4.34Å
40	Q	92.8	Very high	84.3	Confident	88 Å²	88	59.9 Å²	59.9	41%	0.411	33%	0.334	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83	134.9	174.7	-59.8	-178.1	11.8	0	0	110.6	L18 V38 Y97	L18-Q40 HydrophobicContact CD1-CB 3.7Å; L18-Q40 HydrophobicContact CG-CB 4.28Å; L18-Q40 PolarHBondContact N-O 3.31Å; V38-Q40 VanDerWaalsContact C-N 3.31Å; V38-Q40 HydrophobicContact CG1-CB 4.13Å; Q40-Y97 HydrophobicContact CG-CE2 4.02Å; Q40-Y97 WeakPolarHBondContact CG-OH 3.42Å; Q40-Y97 PolarHBondContact NE2-OH 3.09Å
41	A	94.6	Very high	84.9	Confident	0 Å²	0	60.2 Å²	60.2	0%	0	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.2	159.9	179.6	0	0	0	0	0	112	V15 E16 R17 K67 V68 L70	V15-A41 HydrophobicContact CB-CB 3.9Å; V15-A41 HydrophobicContact CG2-CB 4.03Å; E16-A41 CarbonylContact O-C 3.59Å; E16-A41 VanDerWaalsContact O-CA 3.23Å; E16-A41 WeakPolarHBondContact O-CA 3.42Å; E16-A41 VanDerWaalsContact O-CB 3.3Å; E16-A41 WeakPolarHBondContact O-CB 3.33Å; R17-A41 HydrophobicContact CG-CB 4.42Å; A41-K67 CarbonylContact O-C 3.52Å; A41-K67 WeakPolarHBondContact O-CA 3.16Å; A41-V68 HydrophobicContact CB-CG2 4.45Å; A41-V68 PolarHBondContact N-O 3.31Å; A41-V68 PolarHBondContact O-N 3.01Å; A41-L70 HydrophobicContact CB-CD1 3.52Å; A41-L70 HydrophobicContact CB-CD2 4.28Å; A41-L70 HydrophobicContact CB-CG 3.85Å
42	T	95.1	Very high	85.3	Confident	37 Å²	37	59 Å²	59	23%	0.227	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.7	133.7	173.6	-50.1	0	0	0	0	109.1	V15 E16 V44	V15-T42 CarbonylContact C-O 3.6Å; V15-T42 VanDerWaalsContact CA-O 3.3Å; V15-T42 WeakPolarHBondContact CA-O 3.23Å; E16-T42 PolarHBondContact N-O 2.73Å; E16-T42 PolarHBondContact O-N 3.47Å; T42-V44 PolarHBondContact O-N 3.44Å
43	V	95.6	Very high	86	Confident	1 Å²	1	61.4 Å²	61.4	1%	0.006	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.7	121.6	176.4	-179.6	0	0	0	0	109.7	V13 V15 V46 V62 K63 G65 E66 V68	V13-V43 HydrophobicContact CG1-CG1 3.69Å; V13-V43 HydrophobicContact CG1-CG2 4.15Å; V15-V43 HydrophobicContact CG1-CG2 4.2Å; V43-V46 HydrophobicContact CG1-CG1 3.63Å; V43-V62 HydrophobicContact CG1-CG2 4.5Å; V43-V62 HydrophobicContact CG2-CB 4.3Å; V43-V62 HydrophobicContact CG2-CG2 4.2Å; V43-K63 WeakPolarHBondContact CB-O 3.49Å; V43-G65 PolarHBondContact O-N 2.69Å; V43-E66 PolarHBondContact N-O 3.13Å; V43-V68 HydrophobicContact CG2-CG1 3.81Å; V43-V68 HydrophobicContact CG2-CG2 3.98Å
44	V	95.1	Very high	86.9	Confident	17 Å²	17	59.9 Å²	59.9	10%	0.103	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.9	-27.2	180	-66.2	0	0	0	0	112.8	F3 L14 E16 T42 V64 Y85	F3-V44 HydrophobicContact CD1-CB 4.31Å; F3-V44 HydrophobicContact CD1-CG2 4.22Å; F3-V44 HydrophobicContact CD2-CB 4.21Å; F3-V44 HydrophobicContact CE1-CB 4.31Å; F3-V44 HydrophobicContact CE1-CG2 4.34Å; F3-V44 HydrophobicContact CE2-CB 4.23Å; F3-V44 HydrophobicContact CG-CB 4.25Å; F3-V44 HydrophobicContact CZ-CB 4.28Å; F3-V44 HydrophobicContact CZ-CG1 4.46Å; L14-V44 HydrophobicContact CB-CG2 4Å; L14-V44 HydrophobicContact CD2-CG2 3.66Å; L14-V44 HydrophobicContact CG-CG2 3.66Å; L14-V44 VanDerWaalsContact O-CG2 3.3Å; L14-V44 WeakPolarHBondContact O-CG2 3.41Å; L14-V44 PolarHBondContact O-N 2.91Å; E16-V44 HydrophobicContact CB-CG1 3.87Å; T42-V44 PolarHBondContact O-N 3.44Å; V44-V64 WeakPolarHBondContact O-CG1 3.42Å; V44-Y85 HydrophobicContact CG1-CE1 4.39Å; V44-Y85 HydrophobicContact CG2-CD1 3.89Å; V44-Y85 HydrophobicContact CG2-CE1 4.19Å
45	A	95.1	Very high	87.8	Confident	0 Å²	0	58.2 Å²	58.2	0%	0	33%	0.33	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.4	149.6	175.4	0	0	0	0	0	111.6	F3 P8 L14	F3-A45 HydrophobicContact CB-CB 3.7Å; P8-A45 HydrophobicContact CG-CB 3.74Å; L14-A45 HydrophobicContact CB-CB 3.84Å; L14-A45 HydrophobicContact CD2-CB 4.25Å; L14-A45 PolarHBondContact N-O 2.8Å; L14-A45 PolarHBondContact O-N 3.44Å
46	V	95.3	Very high	88.9	Confident	19 Å²	19	62.2 Å²	62.2	12%	0.115	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.1	139.9	176.9	-62.9	0	0	0	0	110.6	M1 V13 V43 V60 V62 V64	M1-V46 PolarHBondContact N-O 2.91Å; V13-V46 HydrophobicContact CG1-CG1 4.3Å; V43-V46 HydrophobicContact CG1-CG1 3.63Å; V46-V60 HydrophobicContact CB-CG2 3.74Å; V46-V60 HydrophobicContact CG1-CG2 4.02Å; V46-V60 HydrophobicContact CG2-CG2 4.21Å; V46-V62 HydrophobicContact CG1-CG2 4.27Å; V46-V64 HydrophobicContact CG1-CG2 4.29Å; V46-V64 HydrophobicContact CG2-CG2 4.08Å
47	G	93.3	Very high	89.7	Confident	6 Å²	6	63.3 Å²	63.3	6%	0.062	34%	0.343	C	S	.	.			trans	-72.1	171.1	169.5	0	0	0	0	0	112.5	P8 F10 R12 G49	P8-G47 WeakPolarHBondContact O-CA 3.48Å; F10-G47 CarbonylContact O-C 3.6Å; F10-G47 WeakPolarHBondContact O-CA 3.3Å; R12-G47 PolarHBondContact O-N 3.01Å; G47-G49 PolarHBondContact O-N 2.97Å
48	P	90.8	Very high	90.3	Very high	85 Å²	85	63 Å²	63	55%	0.552	34%	0.343	S	S	*	.	S	Bend	trans	-67.1	-20.6	-178.1	27.2	-34.8	0	0	0	113.6	V57	P48-V57 WeakPolarHBondContact O-CG1 3.3Å
49	G	90.2	Very high	90.6	Very high	1 Å²	1	65.7 Å²	65.7	1%	0.01	36%	0.362	C	S	.	.			trans	116.3	172.2	-175	0	0	0	0	0	113.8	F10 G47 Q58	F10-G49 CarbonylContact C-O 3.56Å; F10-G49 VanDerWaalsContact C-O 3.26Å; F10-G49 VanDerWaalsContact CA-O 3.29Å; F10-G49 WeakPolarHBondContact CA-O 3.38Å; F10-G49 WeakPolarHBondContact O-CA 3.36Å; F10-G49 PolarHBondContact O-N 2.83Å; G47-G49 PolarHBondContact O-N 2.97Å; G49-Q58 CarbonylContact C-O 3.51Å; G49-Q58 WeakPolarHBondContact CA-O 3.12Å
50	S	89.9	Confident	90.6	Very high	59 Å²	59	63.9 Å²	63.9	41%	0.413	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.8	148.7	178.9	-167.6	0	0	0	0	111.2	V57 Q58	S50-V57 CarbonylContact O-C 3.26Å; S50-Q58 PolarHBondContact N-O 2.85Å; S50-Q58 PolarHBondContact O-N 2.83Å
51	V	88.2	Confident	90.6	Very high	77 Å²	77	64.3 Å²	64.3	47%	0.467	37%	0.366	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.7	123.6	174.6	-175.8	0	0	0	0	108.7	V57	V51-V57 HydrophobicContact CG2-CG2 4.46Å
52	N	85.4	Confident	90.5	Very high	55 Å²	55	64.8 Å²	64.8	29%	0.294	37%	0.369	S	S	.	.	P	Polyproline II helix	trans	-77.6	171.7	176	72.7	15.8	0	0	0	111.6	K54 G55 H56	N52-K54 PolarHBondContact O-N 2.84Å; N52-K54 WeakPolarHBondContact OD1-CA 3.48Å; N52-K54 WeakPolarHBondContact OD1-CB 3.47Å; N52-K54 PolarHBondContact OD1-N 3.15Å; N52-G55 PolarHBondContact O-N 2.88Å; N52-G55 PolarHBondContact OD1-N 3.19Å; N52-G55 VanDerWaalsContact OD1-N 3.14Å; N52-H56 VanDerWaalsContact CG-O 3.27Å; N52-H56 PolarHBondContact N-O 3.3Å; N52-H56 PolarHBondContact OD1-N 3.13Å; N52-H56 PolarHBondContact OD1-O 3.34Å
53	Q	83	Confident	90.4	Very high	210 Å²	210	70 Å²	70	98%	0.981	39%	0.388	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.4	-16	179.8	-63.6	179.7	10.6	0	0	114.1
54	K	85.9	Confident	90.3	Very high	178 Å²	178	73.2 Å²	73.2	77%	0.774	41%	0.408	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.5	3.2	177.3	-59.9	-176.5	178	-177.3	0	112.5	N52 H56	N52-K54 PolarHBondContact O-N 2.84Å; N52-K54 WeakPolarHBondContact OD1-CA 3.48Å; N52-K54 WeakPolarHBondContact OD1-CB 3.47Å; N52-K54 PolarHBondContact OD1-N 3.15Å; K54-H56 VanDerWaalsContact C-N 3.3Å; K54-H56 PolarHBondContact O-CD2 2.96Å; K54-H56 PolarHBondContact O-N 3.21Å
55	G	85.5	Confident	90.2	Very high	55 Å²	55	75 Å²	75	57%	0.567	43%	0.43	S	S	*	.	S	Bend	trans	79.8	5.6	-178.6	0	0	0	0	0	114.6	N52	N52-G55 PolarHBondContact O-N 2.88Å; N52-G55 PolarHBondContact OD1-N 3.19Å; N52-G55 VanDerWaalsContact OD1-N 3.14Å
56	H	88.9	Confident	90.2	Very high	127 Å²	127	77 Å²	77	59%	0.588	44%	0.439	S	S	*	.			trans	-88.9	141.8	177.9	-63.1	-163.4	0	0	0	110.3	N52 K54 Q58	N52-H56 VanDerWaalsContact CG-O 3.27Å; N52-H56 PolarHBondContact N-O 3.3Å; N52-H56 PolarHBondContact OD1-N 3.13Å; N52-H56 PolarHBondContact OD1-O 3.34Å; K54-H56 VanDerWaalsContact C-N 3.3Å; K54-H56 PolarHBondContact O-CD2 2.96Å; K54-H56 PolarHBondContact O-N 3.21Å; H56-Q58 PolarHBondContact O-N 2.92Å
57	V	87	Confident	90.2	Very high	85 Å²	85	80.7 Å²	80.7	52%	0.515	45%	0.453	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.3	116	174.2	-176.3	0	0	0	0	109	P48 S50 V51	P48-V57 WeakPolarHBondContact O-CG1 3.3Å; S50-V57 CarbonylContact O-C 3.26Å; V51-V57 HydrophobicContact CG2-CG2 4.46Å
58	Q	88.8	Confident	90.3	Very high	125 Å²	125	80.4 Å²	80.4	58%	0.584	45%	0.45	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.2	113.5	169.7	-175.4	159.3	8.1	0	0	108.7	G49 S50 H56	G49-Q58 CarbonylContact C-O 3.51Å; G49-Q58 WeakPolarHBondContact CA-O 3.12Å; S50-Q58 PolarHBondContact N-O 2.85Å; S50-Q58 PolarHBondContact O-N 2.83Å; H56-Q58 PolarHBondContact O-N 2.92Å
59	P	90.7	Very high	90.5	Very high	93 Å²	93	79 Å²	79	60%	0.604	44%	0.438	S	S	*	.			trans	-64.4	154.9	-177.1	28.2	-34.8	0	0	0	111
60	V	92.3	Very high	90.7	Very high	24 Å²	24	79 Å²	79	15%	0.145	44%	0.438	C	S	.	.			trans	-62.4	153.1	173.2	-65.3	0	0	0	0	111.5	V13 V46 V62 D90	V13-V60 HydrophobicContact CG2-CG1 4.36Å; V46-V60 HydrophobicContact CB-CG2 3.74Å; V46-V60 HydrophobicContact CG1-CG2 4.02Å; V46-V60 HydrophobicContact CG2-CG2 4.21Å; V60-V62 WeakPolarHBondContact CG2-O 2.86Å; V60-D90 HydrophobicContact CB-CB 4.28Å; V60-D90 HydrophobicContact CG1-CB 4.02Å
61	S	92.2	Very high	90.9	Very high	96 Å²	96	77.3 Å²	77.3	67%	0.671	43%	0.426	S	S	*	.	S	Bend	trans	-80.4	-20.5	-176.2	-52.5	0	0	0	0	113	D90	S61-D90 PolarHBondContact N-OD1 3.24Å; S61-D90 VanDerWaalsContact N-OD1 3.13Å; S61-D90 PolarHBondContact N-OD2 2.82Å; S61-D90 PolarHBondContact OG-OD2 3.42Å; S61-D90 VanDerWaalsContact OG-OD2 3.08Å
62	V	93.1	Very high	91	Very high	11 Å²	11	78.9 Å²	78.9	7%	0.067	43%	0.428	C	S	.	.			trans	-104.2	152.2	-179.1	-59.4	0	0	0	0	112.4	V13 V43 V46 V60 E66 V68 I93	V13-V62 HydrophobicContact CB-CG2 4.45Å; V13-V62 HydrophobicContact CG1-CG2 3.81Å; V13-V62 HydrophobicContact CG2-CG2 3.79Å; V43-V62 HydrophobicContact CG1-CG2 4.5Å; V43-V62 HydrophobicContact CG2-CB 4.3Å; V43-V62 HydrophobicContact CG2-CG2 4.2Å; V46-V62 HydrophobicContact CG1-CG2 4.27Å; V60-V62 WeakPolarHBondContact CG2-O 2.86Å; V62-E66 WeakPolarHBondContact CA-OE2 3.21Å; V62-V68 HydrophobicContact CG1-CG1 4.04Å; V62-I93 HydrophobicContact CG1-CD1 4.28Å; V62-I93 HydrophobicContact CG2-CD1 4.1Å
63	K	92.3	Very high	91.1	Very high	147 Å²	147	84.1 Å²	84.1	64%	0.639	45%	0.445	S	S	*	.			trans	-114.8	156.5	177.6	-63	178.7	-177.6	176.2	0	111.3	V43 G65 E66	V43-K63 WeakPolarHBondContact CB-O 3.49Å; K63-G65 PolarHBondContact O-N 3.03Å; K63-E66 HydrophobicContact CB-CG 4.09Å; K63-E66 PolarHBondContact N-OE2 2.9Å; K63-E66 WeakPolarHBondContact O-CB 3.29Å; K63-E66 PolarHBondContact O-N 2.85Å
64	V	94.1	Very high	91.4	Very high	67 Å²	67	76.8 Å²	76.8	41%	0.406	43%	0.425	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.1	134.1	173.3	-179.3	0	0	0	0	109.7	V44 V46	V44-V64 WeakPolarHBondContact O-CG1 3.42Å; V46-V64 HydrophobicContact CG1-CG2 4.29Å; V46-V64 HydrophobicContact CG2-CG2 4.08Å
65	G	93.3	Very high	91.6	Very high	55 Å²	55	69.9 Å²	69.9	57%	0.567	41%	0.405	S	S	*	.	T	Hydrogen-bonded Turn	trans	91.9	-11.2	-177.4	0	0	0	0	0	114.7	V43 K63	V43-G65 PolarHBondContact O-N 2.69Å; K63-G65 PolarHBondContact O-N 3.03Å
66	E	94.6	Very high	92	Very high	42 Å²	42	71.7 Å²	71.7	20%	0.196	41%	0.405	C	S	.	.			trans	-75.7	144.7	177.9	-64.5	-174.7	141.4	0	0	111.6	V43 V62 K63 K96	V43-E66 PolarHBondContact N-O 3.13Å; V62-E66 WeakPolarHBondContact CA-OE2 3.21Å; K63-E66 HydrophobicContact CB-CG 4.09Å; K63-E66 PolarHBondContact N-OE2 2.9Å; K63-E66 WeakPolarHBondContact O-CB 3.29Å; K63-E66 PolarHBondContact O-N 2.85Å; E66-K96 HydrophobicContact CB-CD 4.07Å; E66-K96 HydrophobicContact CB-CG 4.5Å; E66-K96 HydrophobicContact CG-CD 4.09Å; E66-K96 WeakPolarHBondContact OE1-CD 3.3Å; E66-K96 IonicContact OE1-NZ 2.9Å; E66-K96 PolarHBondContact OE1-NZ 2.97Å; E66-K96 WeakPolarHBondContact OE2-CD 3.37Å; E66-K96 IonicContact OE2-NZ 3.45Å
67	K	95.1	Very high	92.2	Very high	96 Å²	96	71 Å²	71	42%	0.417	40%	0.4	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.2	132	172.3	-68.1	176.3	-170.1	161.5	0	109.6	A41 Y97 D99	A41-K67 CarbonylContact O-C 3.52Å; A41-K67 WeakPolarHBondContact O-CA 3.16Å; K67-Y97 HydrophobicContact CB-CD2 3.86Å; K67-Y97 HydrophobicContact CB-CG 4.35Å; K67-Y97 PolarHBondContact O-N 2.79Å; K67-D99 IonicContact NZ-OD2 3.5Å
68	V	95.4	Very high	92.6	Very high	0 Å²	0	68.2 Å²	68.2	0%	0	38%	0.383	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.9	155.8	-176.2	-64.1	0	0	0	0	111.8	V15 A41 V43 V62 L70 I93 G95	V15-V68 HydrophobicContact CG1-CG2 4.24Å; A41-V68 HydrophobicContact CB-CG2 4.45Å; A41-V68 PolarHBondContact N-O 3.31Å; A41-V68 PolarHBondContact O-N 3.01Å; V43-V68 HydrophobicContact CG2-CG1 3.81Å; V43-V68 HydrophobicContact CG2-CG2 3.98Å; V62-V68 HydrophobicContact CG1-CG1 4.04Å; V68-L70 HydrophobicContact CG2-CD2 4.11Å; V68-I93 HydrophobicContact CB-CG2 3.76Å; V68-I93 HydrophobicContact CG1-CG2 4.05Å; V68-I93 HydrophobicContact CG2-CG2 4.34Å; V68-G95 CarbonylContact C-O 3.6Å; V68-G95 VanDerWaalsContact CA-O 3.29Å; V68-G95 WeakPolarHBondContact CA-O 3.35Å; V68-G95 WeakPolarHBondContact CB-O 3.21Å
69	L	95.1	Very high	92.7	Very high	57 Å²	57	66.3 Å²	66.3	30%	0.298	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.4	121.1	170.9	-176.5	67.1	0	0	0	109.6	L39 L94 G95 Y97	L39-L69 HydrophobicContact CB-CD1 3.86Å; L69-L94 HydrophobicContact CD2-CB 4.28Å; L69-L94 HydrophobicContact CD2-CD1 4.44Å; L69-L94 HydrophobicContact CG-CB 4.37Å; L69-L94 PolarHBondContact O-N 2.92Å; L69-G95 PolarHBondContact N-O 2.87Å; L69-Y97 HydrophobicContact CB-CE2 4.33Å
70	L	94.7	Very high	92.8	Very high	0 Å²	0	63 Å²	63	0%	0	36%	0.357	C	S	.	.	P	Polyproline II helix	trans	-89.7	151.4	177.8	-55.9	178.6	0	0	0	111.3	V15 R17 L39 A41 V68 F88	V15-L70 HydrophobicContact CG1-CD2 4.35Å; V15-L70 HydrophobicContact CG2-CD1 3.86Å; V15-L70 HydrophobicContact CG2-CD2 3.94Å; R17-L70 HydrophobicContact CG-CD1 4.14Å; L39-L70 VanDerWaalsContact O-CB 3.3Å; L39-L70 WeakPolarHBondContact O-CB 3.43Å; L39-L70 WeakPolarHBondContact O-CG 3.33Å; L39-L70 PolarHBondContact O-N 2.89Å; A41-L70 HydrophobicContact CB-CD1 3.52Å; A41-L70 HydrophobicContact CB-CD2 4.28Å; A41-L70 HydrophobicContact CB-CG 3.85Å; V68-L70 HydrophobicContact CG2-CD2 4.11Å; L70-F88 HydrophobicContact CB-CZ 4.35Å; L70-F88 HydrophobicContact CD1-CE2 3.73Å; L70-F88 HydrophobicContact CD1-CZ 4.11Å; L70-F88 HydrophobicContact CD2-CD2 3.95Å; L70-F88 HydrophobicContact CD2-CE2 3.92Å; L70-F88 HydrophobicContact CD2-CG 4.44Å; L70-F88 HydrophobicContact CD2-CZ 4.4Å; L70-F88 HydrophobicContact CG-CE2 4.3Å
71	P	94.1	Very high	92.7	Very high	24 Å²	24	67.7 Å²	67.7	16%	0.156	38%	0.377	C	S	.	.	P	Polyproline II helix	trans	-67.5	155	167	30	-33.7	0	0	0	110.9	Y73 F88 D92 L94	P71-Y73 WeakPolarHBondContact CG-O 3.41Å; P71-Y73 PolarHBondContact O-N 2.8Å; P71-F88 HydrophobicContact CG-CD1 4.18Å; P71-F88 HydrophobicContact CG-CE1 3.85Å; P71-D92 VanDerWaalsContact CD-O 3.31Å; P71-D92 WeakPolarHBondContact CD-O 3.36Å; P71-D92 WeakPolarHBondContact CG-O 3.48Å; P71-L94 HydrophobicContact CB-CD1 4.25Å; P71-L94 HydrophobicContact CB-CD2 4.48Å; P71-L94 HydrophobicContact CB-CG 4.29Å
72	E	88.8	Confident	92.5	Very high	110 Å²	110	72.4 Å²	72.4	51%	0.514	39%	0.389	S	S	.	.	S	Bend	trans	-64.7	-30.4	178.3	-170.7	-174.6	157.6	0	0	112.5	L39	L39-E72 HydrophobicContact CD2-CB 4.34Å
73	Y	88.6	Confident	92.4	Very high	165 Å²	165	76.3 Å²	76.3	65%	0.647	41%	0.405	S	S	*	.	S	Bend	trans	-120.4	158.9	-177.3	-56.4	-81.9	0	0	0	110.9	P71	P71-Y73 WeakPolarHBondContact CG-O 3.41Å; P71-Y73 PolarHBondContact O-N 2.8Å
74	G	89.1	Confident	92.3	Very high	56 Å²	56	73.1 Å²	73.1	58%	0.577	40%	0.395	S	S	*	.			trans	88	-173.5	-175.6	0	0	0	0	0	112.8	F88	G74-F88 VanDerWaalsContact C-CE1 3.49Å
75	G	89.9	Confident	92.3	Very high	33 Å²	33	70 Å²	70	34%	0.34	38%	0.376	S	S	.	.			trans	75.7	144.3	-172	0	0	0	0	0	113.4	L87 F88	G75-L87 CarbonylContact C-O 3.6Å; G75-L87 WeakPolarHBondContact CA-O 3.48Å; G75-F88 VanDerWaalsContact N-CE1 3.35Å
76	T	94.8	Very high	92.4	Very high	93 Å²	93	69 Å²	69	57%	0.571	36%	0.356	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-103	129.5	176.2	-54	0	0	0	0	109.5	F86 L87	T76-F86 CarbonylContact O-C 3.57Å; T76-F86 WeakPolarHBondContact O-CA 3.06Å; T76-L87 PolarHBondContact N-O 3.23Å; T76-L87 PolarHBondContact O-N 3.36Å
77	K	93.2	Very high	92.4	Very high	113 Å²	113	68.1 Å²	68.1	49%	0.491	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69	130.4	172.9	-174.8	179.9	-179.4	176.2	0	109.5	D84 F86	K77-D84 WeakPolarHBondContact CE-OD1 3.47Å; K77-D84 WeakPolarHBondContact CE-OD2 3.17Å; K77-D84 IonicContact NZ-OD1 3.03Å; K77-D84 PolarHBondContact NZ-OD1 3.25Å; K77-D84 IonicContact NZ-OD2 2.69Å; K77-D84 PolarHBondContact NZ-OD2 3.42Å; K77-F86 HydrophobicContact CB-CD1 4.36Å; K77-F86 HydrophobicContact CB-CE1 4.08Å; K77-F86 HydrophobicContact CG-CE1 4.29Å
78	V	93.6	Very high	92.4	Very high	26 Å²	26	63.8 Å²	63.8	16%	0.158	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	127.1	175.9	-173.8	0	0	0	0	108	F6 L14 L80 Y85 L87	F6-V78 HydrophobicContact CE2-CG1 4.22Å; F6-V78 HydrophobicContact CZ-CG1 4.47Å; L14-V78 HydrophobicContact CD1-CB 4.44Å; V78-L80 HydrophobicContact CG1-CD2 3.99Å; V78-L80 HydrophobicContact CG1-CG 3.98Å; V78-Y85 PolarHBondContact N-O 3.37Å; V78-Y85 WeakPolarHBondContact O-CA 3.41Å; V78-Y85 PolarHBondContact O-N 2.75Å; V78-Y85 VanDerWaalsContact O-O 3.14Å; V78-L87 HydrophobicContact CG2-CB 4.04Å
79	V	92.6	Very high	92.4	Very high	85 Å²	85	69.8 Å²	69.8	52%	0.515	36%	0.356	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.7	120.8	176.3	-174.2	0	0	0	0	108.3	K83	V79-K83 WeakPolarHBondContact CA-O 3.34Å
80	L	92.1	Very high	92.3	Very high	24 Å²	24	68.3 Å²	68.3	13%	0.126	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.9	122.2	177.6	-59.2	173.3	0	0	0	109.2	F3 F6 L14 V78 E82 K83 Y85	F3-L80 HydrophobicContact CD1-CD1 4.44Å; F6-L80 HydrophobicContact CB-CD1 3.63Å; F6-L80 HydrophobicContact CB-CD2 3.94Å; F6-L80 HydrophobicContact CB-CG 4.47Å; F6-L80 HydrophobicContact CD1-CD1 4.29Å; F6-L80 HydrophobicContact CD2-CD2 4.09Å; F6-L80 HydrophobicContact CG-CD1 3.93Å; F6-L80 HydrophobicContact CG-CD2 4.19Å; L14-L80 HydrophobicContact CD2-CD1 3.73Å; V78-L80 HydrophobicContact CG1-CD2 3.99Å; V78-L80 HydrophobicContact CG1-CG 3.98Å; L80-E82 VanDerWaalsContact C-N 3.26Å; L80-E82 PolarHBondContact O-N 2.88Å; L80-K83 PolarHBondContact N-O 3.02Å; L80-K83 PolarHBondContact O-N 3.38Å; L80-K83 VanDerWaalsContact O-N 3.09Å; L80-Y85 HydrophobicContact CB-CD2 3.85Å; L80-Y85 HydrophobicContact CB-CE2 3.78Å; L80-Y85 HydrophobicContact CD1-CD2 4.08Å; L80-Y85 HydrophobicContact CD1-CE2 4.44Å; L80-Y85 HydrophobicContact CG-CD2 4.1Å; L80-Y85 HydrophobicContact CG-CE2 4.48Å
81	E	90.1	Very high	92.3	Very high	122 Å²	122	71.8 Å²	71.8	57%	0.57	38%	0.384	S	S	*	.	T	Hydrogen-bonded Turn	trans	48.1	51.4	-177.8	-58.3	174.6	-178.2	0	0	111.3	R4 K83	R4-E81 HydrophobicContact CB-CG 4.47Å; R4-E81 VanDerWaalsContact CD-CD 3.43Å; R4-E81 WeakPolarHBondContact CD-OE2 3.25Å; R4-E81 WeakPolarHBondContact CG-OE1 3.23Å; R4-E81 IonicContact CZ-OE2 3.06Å; R4-E81 IonicContact NE-OE2 3.78Å; R4-E81 PolarHBondContact NE-OE2 2.83Å; R4-E81 IonicContact NH1-OE2 2.73Å; R4-E81 PolarHBondContact NH1-OE2 3.08Å; R4-E81 IonicContact NH2-OE2 3.03Å; R4-E81 PolarHBondContact NH2-OE2 3.39Å; E81-K83 PolarHBondContact O-N 2.89Å
82	E	88.7	Confident	92.3	Very high	194 Å²	194	74.1 Å²	74.1	91%	0.907	40%	0.396	S	S	*	.	T	Hydrogen-bonded Turn	trans	62.6	11.8	177	-52.3	179.3	137.6	0	0	115.4	L80	L80-E82 VanDerWaalsContact C-N 3.26Å; L80-E82 PolarHBondContact O-N 2.88Å
83	K	89.3	Confident	92.6	Very high	94 Å²	94	70 Å²	70	41%	0.409	38%	0.377	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	143.8	173	-69.2	-169.5	177.9	-170.3	0	111.9	V79 L80 E81 Y85	V79-K83 WeakPolarHBondContact CA-O 3.34Å; L80-K83 PolarHBondContact N-O 3.02Å; L80-K83 PolarHBondContact O-N 3.38Å; L80-K83 VanDerWaalsContact O-N 3.09Å; E81-K83 PolarHBondContact O-N 2.89Å; K83-Y85 HydrophobicContact CB-CD2 4.42Å; K83-Y85 HydrophobicContact CB-CE2 3.57Å; K83-Y85 WeakPolarHBondContact O-CD2 3.31Å; K83-Y85 WeakPolarHBondContact O-CE2 3.45Å
84	D	91.4	Very high	92.9	Very high	80 Å²	80	67.7 Å²	67.7	43%	0.428	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.6	118.9	179.1	-74.7	-17.6	0	0	0	111.4	K77	K77-D84 WeakPolarHBondContact CE-OD1 3.47Å; K77-D84 WeakPolarHBondContact CE-OD2 3.17Å; K77-D84 IonicContact NZ-OD1 3.03Å; K77-D84 PolarHBondContact NZ-OD1 3.25Å; K77-D84 IonicContact NZ-OD2 2.69Å; K77-D84 PolarHBondContact NZ-OD2 3.42Å
85	Y	94.1	Very high	93.2	Very high	1 Å²	1	66.5 Å²	66.5	0%	0.004	36%	0.363	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.3	165.4	171.2	-58.7	-87	0	0	0	110.2	F3 R4 L14 E16 V44 V78 L80 K83	F3-Y85 HydrophobicContact CE1-CD1 4.44Å; F3-Y85 AromaticContact CE1-CE1 3.65Å; F3-Y85 HydrophobicContact CE1-CE1 3.65Å; F3-Y85 HydrophobicContact CE1-CE2 4.21Å; F3-Y85 AromaticContact CE1-CZ 3.52Å; F3-Y85 WeakPolarHBondContact CE1-OH 3.49Å; F3-Y85 HydrophobicContact CZ-CE1 4.11Å; R4-Y85 PolarHBondContact NE-OH 2.97Å; R4-Y85 PolarHBondContact NH1-OH 2.82Å; L14-Y85 HydrophobicContact CD2-CG 4.4Å; E16-Y85 HydrophobicContact CB-CD1 3.87Å; E16-Y85 HydrophobicContact CB-CE1 3.91Å; E16-Y85 HydrophobicContact CG-CD1 4.28Å; E16-Y85 HydrophobicContact CG-CE1 4.05Å; V44-Y85 HydrophobicContact CG1-CE1 4.39Å; V44-Y85 HydrophobicContact CG2-CD1 3.89Å; V44-Y85 HydrophobicContact CG2-CE1 4.19Å; V78-Y85 PolarHBondContact N-O 3.37Å; V78-Y85 WeakPolarHBondContact O-CA 3.41Å; V78-Y85 PolarHBondContact O-N 2.75Å; V78-Y85 VanDerWaalsContact O-O 3.14Å; L80-Y85 HydrophobicContact CB-CD2 3.85Å; L80-Y85 HydrophobicContact CB-CE2 3.78Å; L80-Y85 HydrophobicContact CD1-CD2 4.08Å; L80-Y85 HydrophobicContact CD1-CE2 4.44Å; L80-Y85 HydrophobicContact CG-CD2 4.1Å; L80-Y85 HydrophobicContact CG-CE2 4.48Å; K83-Y85 HydrophobicContact CB-CD2 4.42Å; K83-Y85 HydrophobicContact CB-CE2 3.57Å; K83-Y85 WeakPolarHBondContact O-CD2 3.31Å; K83-Y85 WeakPolarHBondContact O-CE2 3.45Å
86	F	94.6	Very high	93.4	Very high	33 Å²	33	69.3 Å²	69.3	15%	0.145	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	139.4	175.9	-64.6	-93.4	0	0	0	110.2	L14 V15 R17 T76 K77 F88	L14-F86 WeakPolarHBondContact CA-O 3.32Å; V15-F86 HydrophobicContact CG2-CB 4.01Å; V15-F86 WeakPolarHBondContact CG2-O 3.5Å; V15-F86 PolarHBondContact N-O 2.81Å; V15-F86 PolarHBondContact O-N 3.36Å; R17-F86 HydrophobicContact CG-CD2 3.89Å; R17-F86 HydrophobicContact CG-CE2 4.07Å; T76-F86 CarbonylContact O-C 3.57Å; T76-F86 WeakPolarHBondContact O-CA 3.06Å; K77-F86 HydrophobicContact CB-CD1 4.36Å; K77-F86 HydrophobicContact CB-CE1 4.08Å; K77-F86 HydrophobicContact CG-CE1 4.29Å; F86-F88 HydrophobicContact CB-CD2 4.14Å; F86-F88 HydrophobicContact CB-CE2 3.53Å; F86-F88 HydrophobicContact CB-CZ 4.45Å; F86-F88 HydrophobicContact CG-CE2 4.46Å
87	L	95.4	Very high	93.3	Very high	25 Å²	25	69.2 Å²	69.2	13%	0.131	36%	0.355	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.3	121	-179.8	-167.3	70.7	0	0	0	109.3	F6 P8 R12 V13 L14 G75 T76 V78	F6-L87 HydrophobicContact CE1-CD1 3.97Å; F6-L87 HydrophobicContact CZ-CD1 4.34Å; F6-L87 HydrophobicContact CZ-CD2 4.18Å; P8-L87 HydrophobicContact CB-CD1 4.18Å; P8-L87 HydrophobicContact CG-CD1 4.31Å; R12-L87 HydrophobicContact CB-CD1 4.06Å; R12-L87 HydrophobicContact CB-CG 4.28Å; V13-L87 WeakPolarHBondContact O-CA 3.46Å; L14-L87 HydrophobicContact CB-CD1 4.04Å; L14-L87 HydrophobicContact CD1-CB 4.3Å; L14-L87 HydrophobicContact CD1-CD1 3.92Å; G75-L87 CarbonylContact C-O 3.6Å; G75-L87 WeakPolarHBondContact CA-O 3.48Å; T76-L87 PolarHBondContact N-O 3.23Å; T76-L87 PolarHBondContact O-N 3.36Å; V78-L87 HydrophobicContact CG2-CB 4.04Å
88	F	95.7	Very high	93.1	Very high	4 Å²	4	69.6 Å²	69.6	2%	0.018	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.3	166.9	178	-71.7	-92.4	0	0	0	110.6	R12 V13 V15 L70 P71 G74 G75 F86 D92	R12-F88 CarbonylContact C-O 3.38Å; R12-F88 WeakPolarHBondContact CA-O 3.3Å; V13-F88 PolarHBondContact N-O 3.02Å; V13-F88 PolarHBondContact O-N 3.46Å; V15-F88 HydrophobicContact CG2-CD2 3.81Å; V15-F88 HydrophobicContact CG2-CE2 3.95Å; L70-F88 HydrophobicContact CB-CZ 4.35Å; L70-F88 HydrophobicContact CD1-CE2 3.73Å; L70-F88 HydrophobicContact CD1-CZ 4.11Å; L70-F88 HydrophobicContact CD2-CD2 3.95Å; L70-F88 HydrophobicContact CD2-CE2 3.92Å; L70-F88 HydrophobicContact CD2-CG 4.44Å; L70-F88 HydrophobicContact CD2-CZ 4.4Å; L70-F88 HydrophobicContact CG-CE2 4.3Å; P71-F88 HydrophobicContact CG-CD1 4.18Å; P71-F88 HydrophobicContact CG-CE1 3.85Å; G74-F88 VanDerWaalsContact C-CE1 3.49Å; G75-F88 VanDerWaalsContact N-CE1 3.35Å; F86-F88 HydrophobicContact CB-CD2 4.14Å; F86-F88 HydrophobicContact CB-CE2 3.53Å; F86-F88 HydrophobicContact CB-CZ 4.45Å; F86-F88 HydrophobicContact CG-CE2 4.46Å; F88-D92 HydrophobicContact CD1-CB 4.46Å
89	R	95	Very high	91.8	Very high	126 Å²	126	77.9 Å²	77.9	48%	0.475	41%	0.41	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.8	150.6	162	-66.3	177.7	177.9	-110	10.5	109.7	D11 G91 D92	D11-R89 CarbonylContact O-C 3.58Å; D11-R89 WeakPolarHBondContact O-CA 3.48Å; D11-R89 IonicContact OD1-NH1 3.71Å; D11-R89 IonicContact OD2-NH1 3.09Å; D11-R89 PolarHBondContact OD2-NH1 3.06Å; D11-R89 VanDerWaalsContact OD2-NH1 3.09Å; R89-G91 PolarHBondContact O-N 3.48Å; R89-D92 WeakPolarHBondContact CB-OD2 3.29Å; R89-D92 PolarHBondContact O-N 2.87Å
90	D	93.4	Very high	91.8	Very high	27 Å²	27	77.5 Å²	77.5	14%	0.144	41%	0.405	C	S	.	.	G	3₁₀ helix	trans	-53.6	-40	174.8	-170.1	55.5	0	0	0	111.7	D11 V13 V60 S61 D92 I93	D11-D90 PolarHBondContact O-N 3.45Å; V13-D90 HydrophobicContact CG2-CB 4.15Å; V60-D90 HydrophobicContact CB-CB 4.28Å; V60-D90 HydrophobicContact CG1-CB 4.02Å; S61-D90 PolarHBondContact N-OD1 3.24Å; S61-D90 VanDerWaalsContact N-OD1 3.13Å; S61-D90 PolarHBondContact N-OD2 2.82Å; S61-D90 PolarHBondContact OG-OD2 3.42Å; S61-D90 VanDerWaalsContact OG-OD2 3.08Å; D90-D92 VanDerWaalsContact C-N 3.31Å; D90-D92 PolarHBondContact O-N 2.94Å; D90-I93 PolarHBondContact O-N 3.14Å
91	G	93.4	Very high	91.8	Very high	72 Å²	72	80.3 Å²	80.3	74%	0.742	42%	0.42	S	S	*	.	G	3₁₀ helix	trans	-73	-14.8	178.5	0	0	0	0	0	115.8	R89	R89-G91 PolarHBondContact O-N 3.48Å
92	D	94.3	Very high	91.9	Very high	74 Å²	74	78 Å²	78	40%	0.396	41%	0.411	S	S	.	.	G	3₁₀ helix	trans	-85.8	-16.3	177.4	-62.2	-25.9	0	0	0	111.7	P71 F88 R89 D90 L94	P71-D92 VanDerWaalsContact CD-O 3.31Å; P71-D92 WeakPolarHBondContact CD-O 3.36Å; P71-D92 WeakPolarHBondContact CG-O 3.48Å; F88-D92 HydrophobicContact CD1-CB 4.46Å; R89-D92 WeakPolarHBondContact CB-OD2 3.29Å; R89-D92 PolarHBondContact O-N 2.87Å; D90-D92 VanDerWaalsContact C-N 3.31Å; D90-D92 PolarHBondContact O-N 2.94Å; D92-L94 PolarHBondContact O-N 3.26Å
93	I	94.9	Very high	92	Very high	23 Å²	23	71.2 Å²	71.2	12%	0.118	38%	0.382	C	S	.	.			trans	-73	123.9	-179.2	-62.8	175.1	0	0	0	108.8	V13 V62 V68 D90	V13-I93 HydrophobicContact CB-CD1 4.01Å; V13-I93 HydrophobicContact CG1-CD1 3.92Å; V13-I93 HydrophobicContact CG2-CD1 4.13Å; V62-I93 HydrophobicContact CG1-CD1 4.28Å; V62-I93 HydrophobicContact CG2-CD1 4.1Å; V68-I93 HydrophobicContact CB-CG2 3.76Å; V68-I93 HydrophobicContact CG1-CG2 4.05Å; V68-I93 HydrophobicContact CG2-CG2 4.34Å; D90-I93 PolarHBondContact O-N 3.14Å
94	L	95.1	Very high	92.2	Very high	117 Å²	117	69.8 Å²	69.8	61%	0.613	38%	0.38	S	S	*	.			trans	-79	-29.9	-169.8	-61.6	-178.4	0	0	0	113.2	L69 P71 D92	L69-L94 HydrophobicContact CD2-CB 4.28Å; L69-L94 HydrophobicContact CD2-CD1 4.44Å; L69-L94 HydrophobicContact CG-CB 4.37Å; L69-L94 PolarHBondContact O-N 2.92Å; P71-L94 HydrophobicContact CB-CD1 4.25Å; P71-L94 HydrophobicContact CB-CD2 4.48Å; P71-L94 HydrophobicContact CB-CG 4.29Å; D92-L94 PolarHBondContact O-N 3.26Å
95	G	95	Very high	92.3	Very high	31 Å²	31	69.1 Å²	69.1	32%	0.32	38%	0.377	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-174.6	163.3	-177.7	0	0	0	0	0	113.2	V68 L69	V68-G95 CarbonylContact C-O 3.6Å; V68-G95 VanDerWaalsContact CA-O 3.29Å; V68-G95 WeakPolarHBondContact CA-O 3.35Å; V68-G95 WeakPolarHBondContact CB-O 3.21Å; L69-G95 PolarHBondContact N-O 2.87Å
96	K	94.3	Very high	92.1	Very high	92 Å²	92	73.9 Å²	73.9	40%	0.4	40%	0.404	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.3	134.1	174.1	178.6	172.4	73	179.1	0	109.4	E66 V98	E66-K96 HydrophobicContact CB-CD 4.07Å; E66-K96 HydrophobicContact CB-CG 4.5Å; E66-K96 HydrophobicContact CG-CD 4.09Å; E66-K96 WeakPolarHBondContact OE1-CD 3.3Å; E66-K96 IonicContact OE1-NZ 2.9Å; E66-K96 PolarHBondContact OE1-NZ 2.97Å; E66-K96 WeakPolarHBondContact OE2-CD 3.37Å; E66-K96 IonicContact OE2-NZ 3.45Å; K96-V98 PolarHBondContact O-N 3.02Å
97	Y	92.9	Very high	91.9	Very high	91 Å²	91	77.1 Å²	77.1	36%	0.357	42%	0.424	S	S	.	.			trans	-75.5	121.8	168.3	-65.4	-80.5	0	0	0	108.6	Q40 K67 L69	Q40-Y97 HydrophobicContact CG-CE2 4.02Å; Q40-Y97 WeakPolarHBondContact CG-OH 3.42Å; Q40-Y97 PolarHBondContact NE2-OH 3.09Å; K67-Y97 HydrophobicContact CB-CD2 3.86Å; K67-Y97 HydrophobicContact CB-CG 4.35Å; K67-Y97 PolarHBondContact O-N 2.79Å; L69-Y97 HydrophobicContact CB-CE2 4.33Å
98	V	89.7	Confident	91.7	Very high	121 Å²	121	81.4 Å²	81.4	73%	0.733	45%	0.448	S	S	*	.			trans	-106.4	108	173.7	-170.9	0	0	0	0	105.6	K96	K96-V98 PolarHBondContact O-N 3.02Å
99	D	66.3	Low	91.3	Very high	199 Å²	199	88.5 Å²	88.5	100%	1.064	49%	0.487	S	S	*	.			trans	-79.9	0	167.1	-75.3	-47.5	0	0	0	109.5	K67	K67-D99 IonicContact NZ-OD2 3.5Å

Retrieved 99 of 99 residues in 42.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).