A0A087X2U8_POEFO Loading...

Biogenesis of lysosome-related organelles complex 1 subunit 7

AlphaFold DB , UniProt , Accession A0A087X2U8, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 129 aa.

						>A0A087X2U8_POEFO|A0A087X2U8
MAAVAVVDAFSGTDPVAEGLLELIKPAIHQLDLHVHSVRESQVELREHIDNLATELFRINEHQKIALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHNVAKETARRKTMLEASGVFTPRSPSKP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.4	Very low	47.8	Very low	249 Å²	249	127.6 Å²	127.6	100%	1.227	79%	0.787	S	S	*	*				0	63.4	0	-71.5	-88.8	-141.9	0	0	110
2	A	46.2	Very low	48.4	Very low	84 Å²	84	121.8 Å²	121.8	69%	0.694	77%	0.771	S	S	*	*			trans	-157.2	-18	178.5	0	0	0	0	0	113.1	V4	A2-V4 VanDerWaalsContact C-N 3.32Å; A2-V4 PolarHBondContact O-N 3.43Å
3	A	43.9	Very low	49.4	Very low	91 Å²	91	119.7 Å²	119.7	75%	0.752	76%	0.756	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81	-4.6	-178.5	0	0	0	0	0	114.9
4	V	50.6	Low	51.6	Low	131 Å²	131	117.9 Å²	117.9	79%	0.794	74%	0.739	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.6	-13.3	-177.4	-179	0	0	0	0	112.1	A2	A2-V4 VanDerWaalsContact C-N 3.32Å; A2-V4 PolarHBondContact O-N 3.43Å
5	A	48.6	Very low	53.7	Low	80 Å²	80	117.1 Å²	117.1	66%	0.661	74%	0.735	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.5	-6.5	-173	0	0	0	0	0	115.2
6	V	49.8	Very low	55.8	Low	121 Å²	121	116.1 Å²	116.1	73%	0.733	73%	0.727	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88	-11.8	-179	-176.5	0	0	0	0	112.2
7	V	49	Very low	57.7	Low	124 Å²	124	112.6 Å²	112.6	75%	0.752	71%	0.713	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86	-10.6	-178.5	-171.7	0	0	0	0	112.2
8	D	41.6	Very low	59.5	Low	140 Å²	140	111.6 Å²	111.6	75%	0.749	70%	0.697	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.2	19	-171.6	-138.4	10.8	0	0	0	114.6
9	A	45.3	Very low	61.1	Low	81 Å²	81	107.9 Å²	107.9	67%	0.669	68%	0.683	S	S	*	*	S	Bend	trans	-112.7	24.5	-179.9	0	0	0	0	0	114.4
10	F	51.1	Low	62.6	Low	188 Å²	188	107.7 Å²	107.7	83%	0.825	68%	0.676	S	S	*	*			trans	-119.4	35	166.7	-79	-81.4	0	0	0	111.3	G12	F10-G12 PolarHBondContact O-N 3.09Å
11	S	52.4	Low	64	Low	115 Å²	115	107 Å²	107	80%	0.804	67%	0.667	S	S	*	*	S	Bend	trans	-73.1	81.8	168.1	64.8	0	0	0	0	109.4
12	G	54.7	Low	66.1	Low	58 Å²	58	100.6 Å²	100.6	60%	0.598	63%	0.634	S	S	*	*	S	Bend	trans	128.7	89.7	179.2	0	0	0	0	0	110	F10 D14	F10-G12 PolarHBondContact O-N 3.09Å; G12-D14 PolarHBondContact O-N 2.89Å; G12-D14 VanDerWaalsContact O-N 3.09Å
13	T	62.1	Low	68.5	Low	94 Å²	94	102.9 Å²	102.9	58%	0.577	63%	0.634	S	S	*	*			trans	-53	117.9	154	37.9	0	0	0	0	106.3	P15 E18	T13-P15 VanDerWaalsContact O-CD 3.29Å; T13-P15 WeakPolarHBondContact O-CD 3.39Å; T13-E18 VanDerWaalsContact CB-OE2 3.29Å; T13-E18 WeakPolarHBondContact CB-OE2 3.45Å; T13-E18 PolarHBondContact OG1-OE2 2.71Å
14	D	79.1	Confident	70.9	Confident	95 Å²	95	102.4 Å²	102.4	51%	0.508	62%	0.618	S	S	.	*			trans	-53.9	116.5	172.7	-177.4	-9.9	0	0	0	106.1	G12 V16 A17 E18	G12-D14 PolarHBondContact O-N 2.89Å; G12-D14 VanDerWaalsContact O-N 3.09Å; D14-V16 CarbonylContact O-C 3.55Å; D14-V16 PolarHBondContact O-N 3.23Å; D14-V16 WeakPolarHBondContact OD1-CB 3.4Å; D14-V16 PolarHBondContact OD1-N 2.99Å; D14-A17 HydrophobicContact CB-CB 3.95Å; D14-A17 WeakPolarHBondContact O-CA 3.47Å; D14-A17 WeakPolarHBondContact O-CB 3.29Å; D14-A17 PolarHBondContact O-N 2.95Å; D14-E18 PolarHBondContact O-N 2.79Å
15	P	83.2	Confident	73.1	Confident	105 Å²	105	100.8 Å²	100.8	68%	0.682	60%	0.6	S	S	*	*	H	α-helix	trans	-58.2	-23.1	-173.9	22.2	-33.9	0	0	0	111.5	T13 G19	T13-P15 VanDerWaalsContact O-CD 3.29Å; T13-P15 WeakPolarHBondContact O-CD 3.39Å; P15-G19 PolarHBondContact O-N 2.98Å
16	V	88.2	Confident	75.3	Confident	101 Å²	101	100.4 Å²	100.4	61%	0.612	59%	0.591	S	S	*	*	H	α-helix	trans	-69.4	-45.7	171.2	-177.3	0	0	0	0	111.4	D14 E18 G19 L20	D14-V16 CarbonylContact O-C 3.55Å; D14-V16 PolarHBondContact O-N 3.23Å; D14-V16 WeakPolarHBondContact OD1-CB 3.4Å; D14-V16 PolarHBondContact OD1-N 2.99Å; V16-E18 VanDerWaalsContact C-N 3.34Å; V16-G19 PolarHBondContact O-N 3.26Å; V16-L20 WeakPolarHBondContact O-CB 3.38Å; V16-L20 PolarHBondContact O-N 3.37Å
17	A	88.6	Confident	77.6	Confident	58 Å²	58	97.4 Å²	97.4	48%	0.479	58%	0.579	S	S	.	*	H	α-helix	trans	-65.5	-38.2	177.3	0	0	0	0	0	111.9	D14 L20 L21	D14-A17 HydrophobicContact CB-CB 3.95Å; D14-A17 WeakPolarHBondContact O-CA 3.47Å; D14-A17 WeakPolarHBondContact O-CB 3.29Å; D14-A17 PolarHBondContact O-N 2.95Å; A17-L20 PolarHBondContact O-N 3.17Å; A17-L21 WeakPolarHBondContact O-CB 3.29Å; A17-L21 PolarHBondContact O-N 3.41Å
18	E	89.3	Confident	79.8	Confident	94 Å²	94	95.4 Å²	95.4	44%	0.439	56%	0.563	S	S	.	*	H	α-helix	trans	-67.3	-43.2	175.7	-169.7	158.1	-171.3	0	0	111.7	T13 D14 V16 L20 L21 E22	T13-E18 VanDerWaalsContact CB-OE2 3.29Å; T13-E18 WeakPolarHBondContact CB-OE2 3.45Å; T13-E18 PolarHBondContact OG1-OE2 2.71Å; D14-E18 PolarHBondContact O-N 2.79Å; V16-E18 VanDerWaalsContact C-N 3.34Å; E18-L20 PolarHBondContact O-N 3.45Å; E18-L21 PolarHBondContact O-N 3Å; E18-E22 VanDerWaalsContact O-CG 3.29Å; E18-E22 WeakPolarHBondContact O-CG 3.36Å; E18-E22 PolarHBondContact O-N 2.9Å
19	G	89.6	Confident	82.5	Confident	41 Å²	41	94.3 Å²	94.3	42%	0.423	55%	0.553	S	S	.	*	H	α-helix	trans	-63.6	-37.5	173.6	0	0	0	0	0	113.6	P15 V16 L23	P15-G19 PolarHBondContact O-N 2.98Å; V16-G19 PolarHBondContact O-N 3.26Å; G19-L23 PolarHBondContact O-N 2.74Å; G19-L23 VanDerWaalsContact O-N 3.1Å
20	L	91.9	Very high	85	Confident	104 Å²	104	96.2 Å²	96.2	55%	0.545	55%	0.548	S	S	.	.	H	α-helix	trans	-67.4	-37.9	175	-139.2	91.9	0	0	0	111.6	V16 A17 E18 L23 I24	V16-L20 WeakPolarHBondContact O-CB 3.38Å; V16-L20 PolarHBondContact O-N 3.37Å; A17-L20 PolarHBondContact O-N 3.17Å; E18-L20 PolarHBondContact O-N 3.45Å; L20-L23 PolarHBondContact O-N 3.47Å; L20-I24 HydrophobicContact CD2-CD1 4.4Å; L20-I24 WeakPolarHBondContact O-CG1 3.29Å; L20-I24 PolarHBondContact O-N 2.91Å
21	L	91	Very high	87.2	Confident	93 Å²	93	92.3 Å²	92.3	49%	0.487	54%	0.535	S	S	.	.	H	α-helix	trans	-67	-44.8	176.3	-176.3	66.7	0	0	0	111.1	A17 E18 L23 I24 K25	A17-L21 WeakPolarHBondContact O-CB 3.29Å; A17-L21 PolarHBondContact O-N 3.41Å; E18-L21 PolarHBondContact O-N 3Å; L21-L23 PolarHBondContact O-N 3.14Å; L21-I24 PolarHBondContact O-N 3.1Å; L21-I24 VanDerWaalsContact O-N 3.14Å; L21-K25 HydrophobicContact CG-CG 4.45Å; L21-K25 VanDerWaalsContact O-CG 3.3Å; L21-K25 WeakPolarHBondContact O-CG 3.5Å; L21-K25 PolarHBondContact O-N 3.44Å
22	E	92.8	Very high	89.4	Confident	114 Å²	114	91.4 Å²	91.4	53%	0.533	52%	0.522	S	S	.	.	H	α-helix	trans	-54.3	-40.7	173	-74.7	-86.6	114.3	0	0	111.8	E18 K25 P26	E18-E22 VanDerWaalsContact O-CG 3.29Å; E18-E22 WeakPolarHBondContact O-CG 3.36Å; E18-E22 PolarHBondContact O-N 2.9Å; E22-K25 IonicContact OE1-NZ 2.74Å; E22-K25 PolarHBondContact OE1-NZ 3.42Å; E22-P26 VanDerWaalsContact O-CD 3.31Å; E22-P26 WeakPolarHBondContact O-CD 3.44Å
23	L	95.1	Very high	91.4	Very high	133 Å²	133	93.2 Å²	93.2	70%	0.696	52%	0.517	S	S	*	.	H	α-helix	trans	-67.2	-36.2	177.9	-173.5	67.4	0	0	0	113	G19 L20 L21 P26	G19-L23 PolarHBondContact O-N 2.74Å; G19-L23 VanDerWaalsContact O-N 3.1Å; L20-L23 PolarHBondContact O-N 3.47Å; L21-L23 PolarHBondContact O-N 3.14Å; L23-P26 WeakPolarHBondContact O-CD 3.32Å; L23-P26 WeakPolarHBondContact O-CG 3.43Å
24	I	95.4	Very high	93.2	Very high	80 Å²	80	94.6 Å²	94.6	41%	0.41	52%	0.517	S	S	.	.	H	α-helix	trans	-90	-27.9	-174.4	-64.4	169.9	0	0	0	112.6	L20 L21 P26 A27 I28	L20-I24 HydrophobicContact CD2-CD1 4.4Å; L20-I24 WeakPolarHBondContact O-CG1 3.29Å; L20-I24 PolarHBondContact O-N 2.91Å; L21-I24 PolarHBondContact O-N 3.1Å; L21-I24 VanDerWaalsContact O-N 3.14Å; I24-P26 VanDerWaalsContact C-CD 3.44Å; I24-A27 WeakPolarHBondContact O-CB 3.3Å; I24-A27 PolarHBondContact O-N 3.33Å; I24-I28 HydrophobicContact CG2-CD1 3.79Å; I24-I28 HydrophobicContact CG2-CG1 3.93Å; I24-I28 PolarHBondContact O-N 2.91Å; I24-I28 VanDerWaalsContact O-N 3.08Å
25	K	95.7	Very high	94.1	Very high	98 Å²	98	94.1 Å²	94.1	43%	0.426	52%	0.517	S	S	.	.	H	α-helix	trans	-42.1	-49.1	175.3	-87.5	174.7	-171.9	169.8	0	114.6	L21 E22 A27 I28 H29	L21-K25 HydrophobicContact CG-CG 4.45Å; L21-K25 VanDerWaalsContact O-CG 3.3Å; L21-K25 WeakPolarHBondContact O-CG 3.5Å; L21-K25 PolarHBondContact O-N 3.44Å; E22-K25 IonicContact OE1-NZ 2.74Å; E22-K25 PolarHBondContact OE1-NZ 3.42Å; K25-A27 VanDerWaalsContact C-N 3.31Å; K25-A27 PolarHBondContact O-N 2.93Å; K25-I28 PolarHBondContact O-N 3.16Å; K25-H29 PolarHBondContact O-N 2.88Å
26	P	96.4	Very high	94.8	Very high	72 Å²	72	94.1 Å²	94.1	47%	0.468	51%	0.508	S	S	.	.	H	α-helix	trans	-64.2	-34.6	-180	22.8	-33.4	0	0	0	113.1	E22 L23 I24 H29 Q30	E22-P26 VanDerWaalsContact O-CD 3.31Å; E22-P26 WeakPolarHBondContact O-CD 3.44Å; L23-P26 WeakPolarHBondContact O-CD 3.32Å; L23-P26 WeakPolarHBondContact O-CG 3.43Å; I24-P26 VanDerWaalsContact C-CD 3.44Å; P26-H29 PolarHBondContact O-N 2.97Å; P26-Q30 WeakPolarHBondContact O-CG 3.45Å; P26-Q30 PolarHBondContact O-N 3.34Å
27	A	96.6	Very high	95.3	Very high	58 Å²	58	92.2 Å²	92.2	48%	0.479	50%	0.499	S	S	.	.	H	α-helix	trans	-69.4	-39.4	176.6	0	0	0	0	0	111.7	I24 K25 Q30 L31	I24-A27 WeakPolarHBondContact O-CB 3.3Å; I24-A27 PolarHBondContact O-N 3.33Å; K25-A27 VanDerWaalsContact C-N 3.31Å; K25-A27 PolarHBondContact O-N 2.93Å; A27-Q30 PolarHBondContact O-N 2.86Å; A27-L31 WeakPolarHBondContact O-CB 3.31Å; A27-L31 PolarHBondContact O-N 3.44Å
28	I	96.3	Very high	95.8	Very high	82 Å²	82	93.1 Å²	93.1	42%	0.421	50%	0.499	S	S	.	.	H	α-helix	trans	-62.9	-45.6	173.5	-65.8	170.7	0	0	0	110.1	I24 K25 Q30 L31 D32	I24-I28 HydrophobicContact CG2-CD1 3.79Å; I24-I28 HydrophobicContact CG2-CG1 3.93Å; I24-I28 PolarHBondContact O-N 2.91Å; I24-I28 VanDerWaalsContact O-N 3.08Å; K25-I28 PolarHBondContact O-N 3.16Å; I28-Q30 VanDerWaalsContact C-N 3.34Å; I28-Q30 PolarHBondContact O-N 3.28Å; I28-L31 WeakPolarHBondContact O-CB 3.42Å; I28-L31 PolarHBondContact O-N 3.08Å; I28-L31 VanDerWaalsContact O-N 3.16Å; I28-D32 PolarHBondContact O-N 3.39Å
29	H	97.3	Very high	96.2	Very high	116 Å²	116	96.3 Å²	96.3	54%	0.537	51%	0.507	S	S	.	.	H	α-helix	trans	-61.6	-42	178.6	-173.5	61.8	0	0	0	112.3	K25 P26 L31 D32 L33	K25-H29 PolarHBondContact O-N 2.88Å; P26-H29 PolarHBondContact O-N 2.97Å; H29-L31 VanDerWaalsContact C-N 3.35Å; H29-D32 PolarHBondContact O-N 3.18Å; H29-L33 WeakPolarHBondContact O-CG 3.45Å; H29-L33 PolarHBondContact O-N 3.02Å
30	Q	97.6	Very high	96.6	Very high	121 Å²	121	99.2 Å²	99.2	57%	0.565	51%	0.509	S	S	*	.	H	α-helix	trans	-63.2	-40.3	174.3	-77.9	-176	-10.1	0	0	112.6	P26 A27 I28 L33 H34	P26-Q30 WeakPolarHBondContact O-CG 3.45Å; P26-Q30 PolarHBondContact O-N 3.34Å; A27-Q30 PolarHBondContact O-N 2.86Å; I28-Q30 VanDerWaalsContact C-N 3.34Å; I28-Q30 PolarHBondContact O-N 3.28Å; Q30-L33 PolarHBondContact O-N 3.36Å; Q30-H34 PolarHBondContact O-N 3.5Å
31	L	97.8	Very high	96.9	Very high	106 Å²	106	97.4 Å²	97.4	56%	0.555	51%	0.505	S	S	*	.	H	α-helix	trans	-61.7	-44.9	175.1	179.6	62.6	0	0	0	111.2	A27 I28 H29 L33 H34 V35	A27-L31 WeakPolarHBondContact O-CB 3.31Å; A27-L31 PolarHBondContact O-N 3.44Å; I28-L31 WeakPolarHBondContact O-CB 3.42Å; I28-L31 PolarHBondContact O-N 3.08Å; I28-L31 VanDerWaalsContact O-N 3.16Å; H29-L31 VanDerWaalsContact C-N 3.35Å; L31-L33 VanDerWaalsContact C-N 3.32Å; L31-L33 PolarHBondContact O-N 2.9Å; L31-H34 PolarHBondContact O-N 3.33Å; L31-V35 HydrophobicContact CD1-CG2 4.32Å; L31-V35 HydrophobicContact CG-CG2 4.43Å; L31-V35 WeakPolarHBondContact O-CG2 3.42Å; L31-V35 PolarHBondContact O-N 2.97Å
32	D	98.2	Very high	97.3	Very high	97 Å²	97	98.9 Å²	98.9	52%	0.519	51%	0.51	S	S	.	.	H	α-helix	trans	-60.3	-42.1	177.7	-76.8	-18.7	0	0	0	111.8	I28 H29 H34 V35 H36	I28-D32 PolarHBondContact O-N 3.39Å; H29-D32 PolarHBondContact O-N 3.18Å; D32-H34 PolarHBondContact O-N 3.42Å; D32-V35 PolarHBondContact O-N 3.05Å; D32-H36 WeakPolarHBondContact O-CB 3.39Å; D32-H36 PolarHBondContact O-N 3.11Å
33	L	98.2	Very high	97.6	Very high	96 Å²	96	97.5 Å²	97.5	50%	0.503	51%	0.509	S	S	.	.	H	α-helix	trans	-61.5	-43.7	175	-69.8	174.4	0	0	0	111.9	H29 Q30 L31 H36 S37	H29-L33 WeakPolarHBondContact O-CG 3.45Å; H29-L33 PolarHBondContact O-N 3.02Å; Q30-L33 PolarHBondContact O-N 3.36Å; L31-L33 VanDerWaalsContact C-N 3.32Å; L31-L33 PolarHBondContact O-N 2.9Å; L33-H36 PolarHBondContact O-N 3.07Å; L33-S37 WeakPolarHBondContact O-CB 3.26Å; L33-S37 PolarHBondContact O-N 3.41Å
34	H	98.2	Very high	97.7	Very high	122 Å²	122	96.5 Å²	96.5	57%	0.565	50%	0.5	S	S	*	.	H	α-helix	trans	-65.6	-41.2	176.8	-69.9	173.3	0	0	0	112.2	Q30 L31 D32 H36 S37 V38	Q30-H34 PolarHBondContact O-N 3.5Å; L31-H34 PolarHBondContact O-N 3.33Å; D32-H34 PolarHBondContact O-N 3.42Å; H34-H36 VanDerWaalsContact C-N 3.29Å; H34-H36 PolarHBondContact O-N 2.98Å; H34-S37 PolarHBondContact O-N 3.37Å; H34-V38 WeakPolarHBondContact O-CB 3.46Å; H34-V38 VanDerWaalsContact O-CG2 3.28Å; H34-V38 WeakPolarHBondContact O-CG2 3.28Å; H34-V38 PolarHBondContact O-N 3.43Å
35	V	98.4	Very high	97.9	Very high	85 Å²	85	97.6 Å²	97.6	52%	0.515	51%	0.507	S	S	.	.	H	α-helix	trans	-60.6	-42.1	175.3	169.4	0	0	0	0	110.5	L31 D32 R39	L31-V35 HydrophobicContact CD1-CG2 4.32Å; L31-V35 HydrophobicContact CG-CG2 4.43Å; L31-V35 WeakPolarHBondContact O-CG2 3.42Å; L31-V35 PolarHBondContact O-N 2.97Å; D32-V35 PolarHBondContact O-N 3.05Å; V35-R39 WeakPolarHBondContact O-CB 3.39Å; V35-R39 PolarHBondContact O-N 3.4Å
36	H	98.4	Very high	98	Very high	105 Å²	105	100.5 Å²	100.5	49%	0.486	52%	0.515	S	S	.	.	H	α-helix	trans	-62.8	-50.5	176.7	-158.7	78.7	0	0	0	111.7	D32 L33 H34 V38 R39 E40	D32-H36 WeakPolarHBondContact O-CB 3.39Å; D32-H36 PolarHBondContact O-N 3.11Å; L33-H36 PolarHBondContact O-N 3.07Å; H34-H36 VanDerWaalsContact C-N 3.29Å; H34-H36 PolarHBondContact O-N 2.98Å; H36-V38 PolarHBondContact O-N 3.28Å; H36-R39 WeakPolarHBondContact O-CB 3.42Å; H36-R39 PolarHBondContact O-N 2.94Å; H36-R39 VanDerWaalsContact O-N 3.1Å; H36-E40 IonicContact CD2-OE1 3.43Å; H36-E40 PolarHBondContact CD2-OE1 2.95Å; H36-E40 IonicContact NE2-OE1 3.36Å; H36-E40 PolarHBondContact NE2-OE1 3.36Å; H36-E40 WeakPolarHBondContact O-CG 3.49Å; H36-E40 PolarHBondContact O-N 3.33Å
37	S	98.4	Very high	98.1	Very high	61 Å²	61	102.7 Å²	102.7	43%	0.427	52%	0.519	S	S	.	.	H	α-helix	trans	-59.3	-44.2	179.3	175.5	0	0	0	0	112.4	L33 H34 R39 E40 S41	L33-S37 WeakPolarHBondContact O-CB 3.26Å; L33-S37 PolarHBondContact O-N 3.41Å; H34-S37 PolarHBondContact O-N 3.37Å; S37-R39 VanDerWaalsContact C-N 3.3Å; S37-R39 PolarHBondContact O-N 2.94Å; S37-E40 PolarHBondContact O-N 2.92Å; S37-S41 PolarHBondContact O-N 3.03Å; S37-S41 PolarHBondContact O-OG 3.36Å
38	V	98.5	Very high	98.2	Very high	78 Å²	78	105.8 Å²	105.8	47%	0.473	52%	0.523	S	S	.	.	H	α-helix	trans	-62.4	-40.9	176.4	169.4	0	0	0	0	110.9	H34 H36 S41 Q42	H34-V38 WeakPolarHBondContact O-CB 3.46Å; H34-V38 VanDerWaalsContact O-CG2 3.28Å; H34-V38 WeakPolarHBondContact O-CG2 3.28Å; H34-V38 PolarHBondContact O-N 3.43Å; H36-V38 PolarHBondContact O-N 3.28Å; V38-S41 PolarHBondContact O-N 3.1Å; V38-Q42 HydrophobicContact CG1-CG 4.37Å; V38-Q42 WeakPolarHBondContact O-CB 3.49Å; V38-Q42 VanDerWaalsContact O-CG 3.26Å; V38-Q42 WeakPolarHBondContact O-CG 3.49Å; V38-Q42 PolarHBondContact O-N 3.03Å
39	R	98.4	Very high	98.3	Very high	161 Å²	161	105.9 Å²	105.9	61%	0.608	52%	0.524	S	S	*	.	H	α-helix	trans	-63.9	-41.5	177.9	-174.6	174.6	-179.3	-85	-1.4	111.7	V35 H36 S37 Q42 V43	V35-R39 WeakPolarHBondContact O-CB 3.39Å; V35-R39 PolarHBondContact O-N 3.4Å; H36-R39 WeakPolarHBondContact O-CB 3.42Å; H36-R39 PolarHBondContact O-N 2.94Å; H36-R39 VanDerWaalsContact O-N 3.1Å; S37-R39 VanDerWaalsContact C-N 3.3Å; S37-R39 PolarHBondContact O-N 2.94Å; R39-Q42 PolarHBondContact O-N 3.4Å; R39-V43 WeakPolarHBondContact O-CG2 3.37Å; R39-V43 PolarHBondContact O-N 2.93Å; R39-V43 VanDerWaalsContact O-N 3.11Å
40	E	98.4	Very high	98.3	Very high	102 Å²	102	104.3 Å²	104.3	48%	0.477	52%	0.519	S	S	.	.	H	α-helix	trans	-59.8	-51.2	174.4	-70.4	177.1	152.4	0	0	111	H36 S37 Q42 V43 E44	H36-E40 IonicContact CD2-OE1 3.43Å; H36-E40 PolarHBondContact CD2-OE1 2.95Å; H36-E40 IonicContact NE2-OE1 3.36Å; H36-E40 PolarHBondContact NE2-OE1 3.36Å; H36-E40 WeakPolarHBondContact O-CG 3.49Å; H36-E40 PolarHBondContact O-N 3.33Å; S37-E40 PolarHBondContact O-N 2.92Å; E40-Q42 VanDerWaalsContact C-N 3.26Å; E40-Q42 PolarHBondContact O-N 3.43Å; E40-V43 PolarHBondContact O-N 3.3Å; E40-E44 PolarHBondContact O-N 2.95Å
41	S	98.3	Very high	98.4	Very high	65 Å²	65	102.4 Å²	102.4	46%	0.455	51%	0.513	S	S	.	.	H	α-helix	trans	-61	-33.3	178.1	-58.5	0	0	0	0	113.2	S37 V38 L45	S37-S41 PolarHBondContact O-N 3.03Å; S37-S41 PolarHBondContact O-OG 3.36Å; V38-S41 PolarHBondContact O-N 3.1Å; S41-L45 VanDerWaalsContact O-CB 3.29Å; S41-L45 WeakPolarHBondContact O-CB 3.35Å; S41-L45 PolarHBondContact O-N 3.18Å
42	Q	98.4	Very high	98.4	Very high	125 Å²	125	102.4 Å²	102.4	58%	0.584	51%	0.513	S	S	*	.	H	α-helix	trans	-68.4	-36.4	175.4	-76.7	175.8	2.1	0	0	112.7	V38 R39 E40 R46	V38-Q42 HydrophobicContact CG1-CG 4.37Å; V38-Q42 WeakPolarHBondContact O-CB 3.49Å; V38-Q42 VanDerWaalsContact O-CG 3.26Å; V38-Q42 WeakPolarHBondContact O-CG 3.49Å; V38-Q42 PolarHBondContact O-N 3.03Å; R39-Q42 PolarHBondContact O-N 3.4Å; E40-Q42 VanDerWaalsContact C-N 3.26Å; E40-Q42 PolarHBondContact O-N 3.43Å; Q42-R46 WeakPolarHBondContact O-CB 3.39Å; Q42-R46 PolarHBondContact O-N 3.48Å; Q42-R46 VanDerWaalsContact O-N 3.07Å
43	V	98.6	Very high	98.3	Very high	85 Å²	85	100.3 Å²	100.3	52%	0.515	51%	0.509	S	S	.	.	H	α-helix	trans	-68.5	-46.1	175.7	172	0	0	0	0	110.3	R39 E40 L45 R46 E47	R39-V43 WeakPolarHBondContact O-CG2 3.37Å; R39-V43 PolarHBondContact O-N 2.93Å; R39-V43 VanDerWaalsContact O-N 3.11Å; E40-V43 PolarHBondContact O-N 3.3Å; V43-L45 PolarHBondContact O-N 2.93Å; V43-R46 WeakPolarHBondContact O-CB 3.47Å; V43-R46 PolarHBondContact O-N 3.39Å; V43-E47 PolarHBondContact O-N 3.16Å
44	E	98.5	Very high	98.3	Very high	111 Å²	111	99.5 Å²	99.5	52%	0.519	51%	0.508	S	S	.	.	H	α-helix	trans	-60.5	-44.4	176.2	-69.9	179.1	169.4	0	0	111.8	E40 R46 E47 H48	E40-E44 PolarHBondContact O-N 2.95Å; E44-R46 VanDerWaalsContact C-N 3.3Å; E44-R46 PolarHBondContact O-N 3.21Å; E44-E47 WeakPolarHBondContact O-CB 3.48Å; E44-E47 PolarHBondContact O-N 3.29Å; E44-H48 PolarHBondContact O-CD2 3.45Å; E44-H48 PolarHBondContact O-N 2.87Å
45	L	98.4	Very high	98.2	Very high	104 Å²	104	97.9 Å²	97.9	55%	0.545	50%	0.501	S	S	.	.	H	α-helix	trans	-61.8	-39.8	177.3	179.8	61.4	0	0	0	111.8	S41 V43 E47 H48 I49	S41-L45 VanDerWaalsContact O-CB 3.29Å; S41-L45 WeakPolarHBondContact O-CB 3.35Å; S41-L45 PolarHBondContact O-N 3.18Å; V43-L45 PolarHBondContact O-N 2.93Å; L45-E47 VanDerWaalsContact C-N 3.35Å; L45-H48 PolarHBondContact O-N 3.43Å; L45-I49 HydrophobicContact CD1-CD1 4.25Å; L45-I49 HydrophobicContact CD1-CG1 4.36Å; L45-I49 HydrophobicContact CG-CD1 3.99Å; L45-I49 VanDerWaalsContact O-CG1 3.27Å; L45-I49 WeakPolarHBondContact O-CG1 3.29Å; L45-I49 PolarHBondContact O-N 2.96Å
46	R	98.4	Very high	98.1	Very high	158 Å²	158	98.6 Å²	98.6	60%	0.596	50%	0.502	S	S	*	.	H	α-helix	trans	-59.2	-48.9	175	177.4	66.4	65.4	-179.6	1.9	110.5	Q42 V43 E44 H48 I49 D50	Q42-R46 WeakPolarHBondContact O-CB 3.39Å; Q42-R46 PolarHBondContact O-N 3.48Å; Q42-R46 VanDerWaalsContact O-N 3.07Å; V43-R46 WeakPolarHBondContact O-CB 3.47Å; V43-R46 PolarHBondContact O-N 3.39Å; E44-R46 VanDerWaalsContact C-N 3.3Å; E44-R46 PolarHBondContact O-N 3.21Å; R46-H48 VanDerWaalsContact C-N 3.33Å; R46-H48 PolarHBondContact O-N 3.36Å; R46-I49 PolarHBondContact O-N 3.46Å; R46-D50 PolarHBondContact O-N 3.01Å
47	E	98.5	Very high	97.9	Very high	118 Å²	118	99.2 Å²	99.2	55%	0.551	50%	0.503	S	S	*	.	H	α-helix	trans	-59.7	-43.8	178.5	-170.4	-175	164.4	0	0	111.5	V43 E44 L45 I49 D50 N51	V43-E47 PolarHBondContact O-N 3.16Å; E44-E47 WeakPolarHBondContact O-CB 3.48Å; E44-E47 PolarHBondContact O-N 3.29Å; L45-E47 VanDerWaalsContact C-N 3.35Å; E47-I49 PolarHBondContact O-N 3.01Å; E47-D50 PolarHBondContact O-N 2.86Å; E47-N51 VanDerWaalsContact O-CB 3.32Å; E47-N51 WeakPolarHBondContact O-CB 3.27Å; E47-N51 PolarHBondContact O-N 3.01Å; E47-N51 PolarHBondContact O-ND2 2.9Å
48	H	98.3	Very high	97.6	Very high	123 Å²	123	102.3 Å²	102.3	57%	0.569	51%	0.505	S	S	*	.	H	α-helix	trans	-62	-40.4	175.5	-73.5	-49	0	0	0	113.2	E44 L45 R46 L52	E44-H48 PolarHBondContact O-CD2 3.45Å; E44-H48 PolarHBondContact O-N 2.87Å; L45-H48 PolarHBondContact O-N 3.43Å; R46-H48 VanDerWaalsContact C-N 3.33Å; R46-H48 PolarHBondContact O-N 3.36Å; H48-L52 VanDerWaalsContact O-CB 3.3Å; H48-L52 WeakPolarHBondContact O-CB 3.49Å; H48-L52 PolarHBondContact O-N 3.2Å
49	I	98.4	Very high	97.3	Very high	85 Å²	85	102.4 Å²	102.4	44%	0.436	50%	0.502	S	S	.	.	H	α-helix	trans	-62.8	-46.9	175.7	-71.9	166.8	0	0	0	110.2	L45 R46 E47 L52 A53	L45-I49 HydrophobicContact CD1-CD1 4.25Å; L45-I49 HydrophobicContact CD1-CG1 4.36Å; L45-I49 HydrophobicContact CG-CD1 3.99Å; L45-I49 VanDerWaalsContact O-CG1 3.27Å; L45-I49 WeakPolarHBondContact O-CG1 3.29Å; L45-I49 PolarHBondContact O-N 2.96Å; R46-I49 PolarHBondContact O-N 3.46Å; E47-I49 PolarHBondContact O-N 3.01Å; I49-L52 PolarHBondContact O-N 3.24Å; I49-A53 WeakPolarHBondContact O-CB 3.5Å; I49-A53 PolarHBondContact O-N 3.24Å
50	D	98.4	Very high	96.8	Very high	82 Å²	82	98.6 Å²	98.6	44%	0.439	49%	0.494	S	S	.	.	H	α-helix	trans	-66.4	-40.1	-177.8	-67.1	-22.2	0	0	0	111.4	R46 E47 A53 T54	R46-D50 PolarHBondContact O-N 3.01Å; E47-D50 PolarHBondContact O-N 2.86Å; D50-A53 PolarHBondContact O-N 3.24Å; D50-T54 WeakPolarHBondContact O-CB 3.48Å; D50-T54 PolarHBondContact O-N 2.89Å; D50-T54 PolarHBondContact O-OG1 2.86Å
51	N	98.3	Very high	96.2	Very high	81 Å²	81	98.5 Å²	98.5	43%	0.433	49%	0.493	S	S	.	.	H	α-helix	trans	-62.3	-46.3	173.1	-74.4	-25.9	0	0	0	111.6	E47 A53 T54 E55	E47-N51 VanDerWaalsContact O-CB 3.32Å; E47-N51 WeakPolarHBondContact O-CB 3.27Å; E47-N51 PolarHBondContact O-N 3.01Å; E47-N51 PolarHBondContact O-ND2 2.9Å; N51-A53 PolarHBondContact O-N 3.04Å; N51-T54 WeakPolarHBondContact O-CB 3.32Å; N51-T54 PolarHBondContact O-N 3.45Å; N51-E55 PolarHBondContact O-N 3.5Å
52	L	97.9	Very high	95.3	Very high	106 Å²	106	101.6 Å²	101.6	56%	0.555	50%	0.501	S	S	*	.	H	α-helix	trans	-63.2	-42.7	177.5	178.8	61.9	0	0	0	111.7	H48 I49 T54 E55 L56	H48-L52 VanDerWaalsContact O-CB 3.3Å; H48-L52 WeakPolarHBondContact O-CB 3.49Å; H48-L52 PolarHBondContact O-N 3.2Å; I49-L52 PolarHBondContact O-N 3.24Å; L52-T54 VanDerWaalsContact C-N 3.28Å; L52-T54 PolarHBondContact O-N 3.27Å; L52-E55 PolarHBondContact O-N 2.89Å; L52-L56 HydrophobicContact CD1-CD1 4.25Å; L52-L56 HydrophobicContact CD1-CG 4.08Å; L52-L56 HydrophobicContact CG-CD1 4.06Å; L52-L56 HydrophobicContact CG-CG 4.32Å; L52-L56 WeakPolarHBondContact O-CB 3.42Å; L52-L56 VanDerWaalsContact O-CG 3.3Å; L52-L56 WeakPolarHBondContact O-CG 3.3Å; L52-L56 PolarHBondContact O-N 3.42Å
53	A	97.8	Very high	94	Very high	54 Å²	54	102.3 Å²	102.3	45%	0.446	50%	0.504	S	S	.	.	H	α-helix	trans	-59.8	-42.4	176.6	0	0	0	0	0	111.2	I49 D50 N51 L56 F57	I49-A53 WeakPolarHBondContact O-CB 3.5Å; I49-A53 PolarHBondContact O-N 3.24Å; D50-A53 PolarHBondContact O-N 3.24Å; N51-A53 PolarHBondContact O-N 3.04Å; A53-L56 PolarHBondContact O-N 3.37Å; A53-F57 WeakPolarHBondContact O-CB 3.5Å; A53-F57 PolarHBondContact O-N 3.19Å
54	T	97.2	Very high	92.3	Very high	79 Å²	79	105 Å²	105	49%	0.485	51%	0.509	S	S	.	.	H	α-helix	trans	-62.5	-47.9	176.6	-57.5	0	0	0	0	111.3	D50 N51 L52 F57 R58	D50-T54 WeakPolarHBondContact O-CB 3.48Å; D50-T54 PolarHBondContact O-N 2.89Å; D50-T54 PolarHBondContact O-OG1 2.86Å; N51-T54 WeakPolarHBondContact O-CB 3.32Å; N51-T54 PolarHBondContact O-N 3.45Å; L52-T54 VanDerWaalsContact C-N 3.28Å; L52-T54 PolarHBondContact O-N 3.27Å; T54-F57 WeakPolarHBondContact O-CB 3.41Å; T54-F57 PolarHBondContact O-N 3.31Å; T54-R58 WeakPolarHBondContact O-CG 3.14Å; T54-R58 PolarHBondContact O-N 2.91Å
55	E	96.3	Very high	90.5	Very high	87 Å²	87	105.9 Å²	105.9	41%	0.407	52%	0.516	S	S	.	.	H	α-helix	trans	-65.2	-41	178.5	-72.4	-58.6	125.8	0	0	112.3	N51 L52 F57 R58 I59	N51-E55 PolarHBondContact O-N 3.5Å; L52-E55 PolarHBondContact O-N 2.89Å; E55-F57 VanDerWaalsContact C-N 3.32Å; E55-F57 PolarHBondContact O-N 3.48Å; E55-R58 PolarHBondContact O-N 3.44Å; E55-R58 WeakPolarHBondContact OE1-CD 3.3Å; E55-R58 IonicContact OE1-CZ 2.79Å; E55-R58 IonicContact OE1-NH1 3.3Å; E55-R58 PolarHBondContact OE1-NH1 3.31Å; E55-R58 IonicContact OE2-NH1 2.93Å; E55-I59 VanDerWaalsContact O-CG1 3.29Å; E55-I59 WeakPolarHBondContact O-CG1 3.38Å; E55-I59 PolarHBondContact O-N 3.44Å
56	L	95.6	Very high	89	Confident	101 Å²	101	105 Å²	105	53%	0.529	52%	0.523	S	S	.	.	H	α-helix	trans	-62.5	-39.5	174.2	-72.4	177	0	0	0	111.9	L52 A53 I59 N60	L52-L56 HydrophobicContact CD1-CD1 4.25Å; L52-L56 HydrophobicContact CD1-CG 4.08Å; L52-L56 HydrophobicContact CG-CD1 4.06Å; L52-L56 HydrophobicContact CG-CG 4.32Å; L52-L56 WeakPolarHBondContact O-CB 3.42Å; L52-L56 VanDerWaalsContact O-CG 3.3Å; L52-L56 WeakPolarHBondContact O-CG 3.3Å; L52-L56 PolarHBondContact O-N 3.42Å; A53-L56 PolarHBondContact O-N 3.37Å; L56-I59 PolarHBondContact O-N 2.93Å; L56-N60 VanDerWaalsContact O-CB 3.3Å; L56-N60 WeakPolarHBondContact O-CB 3.3Å; L56-N60 PolarHBondContact O-N 2.97Å
57	F	94.3	Very high	87.8	Confident	118 Å²	118	103.1 Å²	103.1	52%	0.518	53%	0.525	S	S	.	.	H	α-helix	trans	-63.5	-45.9	174.1	-177	-94.3	0	0	0	111.3	A53 T54 E55 I59 N60 E61	A53-F57 WeakPolarHBondContact O-CB 3.5Å; A53-F57 PolarHBondContact O-N 3.19Å; T54-F57 WeakPolarHBondContact O-CB 3.41Å; T54-F57 PolarHBondContact O-N 3.31Å; E55-F57 VanDerWaalsContact C-N 3.32Å; E55-F57 PolarHBondContact O-N 3.48Å; F57-I59 PolarHBondContact O-N 3.2Å; F57-N60 WeakPolarHBondContact O-CB 3.49Å; F57-N60 PolarHBondContact O-N 2.7Å; F57-E61 HydrophobicContact CD1-CG 4.24Å; F57-E61 HydrophobicContact CE1-CG 3.76Å; F57-E61 HydrophobicContact CZ-CG 3.98Å; F57-E61 PolarHBondContact O-N 3.44Å
58	R	93	Very high	87	Confident	125 Å²	125	102.2 Å²	102.2	47%	0.472	52%	0.523	S	S	.	.	H	α-helix	trans	-58	-49.5	174.8	-69.6	175.7	76.3	-167.4	4.2	110.9	T54 E55 N60 E61 H62	T54-R58 WeakPolarHBondContact O-CG 3.14Å; T54-R58 PolarHBondContact O-N 2.91Å; E55-R58 PolarHBondContact O-N 3.44Å; E55-R58 WeakPolarHBondContact OE1-CD 3.3Å; E55-R58 IonicContact OE1-CZ 2.79Å; E55-R58 IonicContact OE1-NH1 3.3Å; E55-R58 PolarHBondContact OE1-NH1 3.31Å; E55-R58 IonicContact OE2-NH1 2.93Å; R58-N60 VanDerWaalsContact C-N 3.28Å; R58-N60 PolarHBondContact O-N 3.47Å; R58-E61 PolarHBondContact O-N 3.27Å; R58-H62 PolarHBondContact O-N 3.33Å; R58-H62 PolarHBondContact O-ND1 3.02Å
59	I	91	Very high	86.6	Confident	81 Å²	81	101.4 Å²	101.4	42%	0.415	52%	0.523	S	S	.	.	H	α-helix	trans	-57.5	-45.2	177.2	-68.9	169.4	0	0	0	110.3	E55 L56 F57 E61 H62 Q63	E55-I59 VanDerWaalsContact O-CG1 3.29Å; E55-I59 WeakPolarHBondContact O-CG1 3.38Å; E55-I59 PolarHBondContact O-N 3.44Å; L56-I59 PolarHBondContact O-N 2.93Å; F57-I59 PolarHBondContact O-N 3.2Å; I59-E61 PolarHBondContact O-N 2.84Å; I59-H62 PolarHBondContact O-N 3Å; I59-Q63 HydrophobicContact CG2-CG 4.1Å; I59-Q63 VanDerWaalsContact O-CB 3.3Å; I59-Q63 WeakPolarHBondContact O-CB 3.29Å; I59-Q63 VanDerWaalsContact O-CG 3.3Å; I59-Q63 WeakPolarHBondContact O-CG 3.32Å; I59-Q63 PolarHBondContact O-N 3.06Å
60	N	88.3	Confident	86.3	Confident	81 Å²	81	102 Å²	102	43%	0.433	53%	0.527	S	S	.	.	H	α-helix	trans	-59.6	-44.4	178.5	-169.9	-83.3	0	0	0	111.8	L56 F57 R58 Q63 K64	L56-N60 VanDerWaalsContact O-CB 3.3Å; L56-N60 WeakPolarHBondContact O-CB 3.3Å; L56-N60 PolarHBondContact O-N 2.97Å; F57-N60 WeakPolarHBondContact O-CB 3.49Å; F57-N60 PolarHBondContact O-N 2.7Å; R58-N60 VanDerWaalsContact C-N 3.28Å; R58-N60 PolarHBondContact O-N 3.47Å; N60-Q63 PolarHBondContact O-N 3.25Å; N60-K64 WeakPolarHBondContact O-CG 3.32Å; N60-K64 PolarHBondContact O-N 2.91Å; N60-K64 WeakPolarHBondContact OD1-CE 3.3Å
61	E	86.5	Confident	86.1	Confident	99 Å²	99	100.6 Å²	100.6	46%	0.463	52%	0.522	S	S	.	.	H	α-helix	trans	-63.2	-42.4	175.6	-73.3	-161.5	133.1	0	0	113	F57 R58 I59 Q63 K64	F57-E61 HydrophobicContact CD1-CG 4.24Å; F57-E61 HydrophobicContact CE1-CG 3.76Å; F57-E61 HydrophobicContact CZ-CG 3.98Å; F57-E61 PolarHBondContact O-N 3.44Å; R58-E61 PolarHBondContact O-N 3.27Å; I59-E61 PolarHBondContact O-N 2.84Å; E61-Q63 VanDerWaalsContact C-N 3.32Å; E61-Q63 PolarHBondContact O-N 2.95Å; E61-K64 WeakPolarHBondContact O-CB 3.5Å; E61-K64 PolarHBondContact O-N 2.79Å
62	H	79.2	Confident	85.9	Confident	130 Å²	130	103.5 Å²	103.5	60%	0.602	53%	0.528	S	S	*	.	H	α-helix	trans	-69.5	-31.6	177.7	-68.7	78.6	0	0	0	111.9	R58 I59	R58-H62 PolarHBondContact O-N 3.33Å; R58-H62 PolarHBondContact O-ND1 3.02Å; I59-H62 PolarHBondContact O-N 3Å
63	Q	71.5	Confident	85.9	Confident	140 Å²	140	101.9 Å²	101.9	65%	0.654	52%	0.522	S	S	*	.	H	α-helix	trans	-77.8	-16.4	175.8	-75.3	-177.9	-5.6	0	0	113.8	I59 N60 E61 I65 A66	I59-Q63 HydrophobicContact CG2-CG 4.1Å; I59-Q63 VanDerWaalsContact O-CB 3.3Å; I59-Q63 WeakPolarHBondContact O-CB 3.29Å; I59-Q63 VanDerWaalsContact O-CG 3.3Å; I59-Q63 WeakPolarHBondContact O-CG 3.32Å; I59-Q63 PolarHBondContact O-N 3.06Å; N60-Q63 PolarHBondContact O-N 3.25Å; E61-Q63 VanDerWaalsContact C-N 3.32Å; E61-Q63 PolarHBondContact O-N 2.95Å; Q63-I65 CarbonylContact O-C 3.6Å; Q63-I65 PolarHBondContact O-N 3.41Å; Q63-A66 PolarHBondContact O-N 3.05Å
64	K	62	Low	85.8	Confident	142 Å²	142	105.6 Å²	105.6	62%	0.617	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63	-10	173.5	-79.9	174.9	-170.9	171.2	0	113.5	N60 E61 A66	N60-K64 WeakPolarHBondContact O-CG 3.32Å; N60-K64 PolarHBondContact O-N 2.91Å; N60-K64 WeakPolarHBondContact OD1-CE 3.3Å; E61-K64 WeakPolarHBondContact O-CB 3.5Å; E61-K64 PolarHBondContact O-N 2.79Å; K64-A66 PolarHBondContact O-N 2.82Å
65	I	61	Low	85.9	Confident	129 Å²	129	108.4 Å²	108.4	66%	0.662	53%	0.534	S	S	*	.			trans	-82.7	64.5	164.1	-50.6	168.3	0	0	0	108.2	Q63 L67	Q63-I65 CarbonylContact O-C 3.6Å; Q63-I65 PolarHBondContact O-N 3.41Å; I65-L67 VanDerWaalsContact C-N 3.31Å; I65-L67 HydrophobicContact CG2-CD1 4.3Å; I65-L67 PolarHBondContact O-N 2.87Å
66	A	67.1	Low	85.9	Confident	86 Å²	86	110.2 Å²	110.2	71%	0.711	55%	0.546	S	S	*	.			trans	-67.3	100.1	157.4	0	0	0	0	0	105.5	Q63 K64 D68	Q63-A66 PolarHBondContact O-N 3.05Å; K64-A66 PolarHBondContact O-N 2.82Å; A66-D68 PolarHBondContact O-N 3.26Å
67	L	72.6	Confident	86.1	Confident	119 Å²	119	109.2 Å²	109.2	62%	0.623	54%	0.541	S	S	*	.			trans	-50.7	119.3	169.1	-95.3	96.9	0	0	0	107.1	I65 L69	I65-L67 VanDerWaalsContact C-N 3.31Å; I65-L67 HydrophobicContact CG2-CD1 4.3Å; I65-L67 PolarHBondContact O-N 2.87Å; L67-L69 HydrophobicContact CB-CD2 4.3Å; L67-L69 PolarHBondContact O-N 3.44Å
68	D	81.9	Confident	86.3	Confident	98 Å²	98	107.3 Å²	107.3	52%	0.524	54%	0.536	S	S	.	.			trans	-65.4	102.2	172.6	-178.9	12.1	0	0	0	107.5	A66 D70 P71	A66-D68 PolarHBondContact O-N 3.26Å; D68-D70 VanDerWaalsContact C-N 3.29Å; D68-D70 VanDerWaalsContact OD1-CB 3.25Å; D68-D70 WeakPolarHBondContact OD1-CB 3.21Å; D68-D70 PolarHBondContact OD1-N 3.38Å; D68-P71 WeakPolarHBondContact O-CD 3.33Å; D68-P71 WeakPolarHBondContact OD1-CD 3.25Å; D68-P71 VanDerWaalsContact OD2-CD 3.32Å; D68-P71 WeakPolarHBondContact OD2-CD 3.3Å
69	L	89.6	Confident	86.5	Confident	107 Å²	107	103.6 Å²	103.6	56%	0.56	53%	0.532	S	S	*	.			trans	-80.8	-14.3	179.3	-64.5	-179.3	0	0	0	111.2	L67 Y72 V73	L67-L69 HydrophobicContact CB-CD2 4.3Å; L67-L69 PolarHBondContact O-N 3.44Å; L69-Y72 WeakPolarHBondContact O-CA 3.36Å; L69-Y72 WeakPolarHBondContact O-CB 3.47Å; L69-Y72 PolarHBondContact O-N 3.39Å; L69-V73 WeakPolarHBondContact O-CG2 3.49Å; L69-V73 PolarHBondContact O-N 2.86Å
70	D	92.1	Very high	86.9	Confident	97 Å²	97	107.7 Å²	107.7	52%	0.519	54%	0.542	S	S	.	.	H	α-helix	trans	-58.2	-41.4	-176.8	-72.3	-12.7	0	0	0	113.1	D68 Y72 V73 K74	D68-D70 VanDerWaalsContact C-N 3.29Å; D68-D70 VanDerWaalsContact OD1-CB 3.25Å; D68-D70 WeakPolarHBondContact OD1-CB 3.21Å; D68-D70 PolarHBondContact OD1-N 3.38Å; D70-Y72 VanDerWaalsContact C-N 3.29Å; D70-Y72 PolarHBondContact O-N 3.03Å; D70-V73 PolarHBondContact O-N 2.89Å; D70-K74 WeakPolarHBondContact O-CB 3.33Å; D70-K74 WeakPolarHBondContact O-CG 3.32Å; D70-K74 PolarHBondContact O-N 3.02Å
71	P	94.8	Very high	87.4	Confident	53 Å²	53	111.6 Å²	111.6	34%	0.344	55%	0.551	S	S	.	*	H	α-helix	trans	-58.5	-38.8	172.6	-24.8	33.6	0	0	0	113	D68 K75	D68-P71 WeakPolarHBondContact O-CD 3.33Å; D68-P71 WeakPolarHBondContact OD1-CD 3.25Å; D68-P71 VanDerWaalsContact OD2-CD 3.32Å; D68-P71 WeakPolarHBondContact OD2-CD 3.3Å; P71-K75 VanDerWaalsContact O-CG 3.32Å; P71-K75 WeakPolarHBondContact O-CG 3.32Å; P71-K75 PolarHBondContact O-N 3.45Å
72	Y	95	Very high	87.9	Confident	141 Å²	141	116 Å²	116	55%	0.553	56%	0.563	S	S	*	*	H	α-helix	trans	-75	-42	-179.7	-66	-85.2	0	0	0	111.6	L69 D70 K74 K75 L76	L69-Y72 WeakPolarHBondContact O-CA 3.36Å; L69-Y72 WeakPolarHBondContact O-CB 3.47Å; L69-Y72 PolarHBondContact O-N 3.39Å; D70-Y72 VanDerWaalsContact C-N 3.29Å; D70-Y72 PolarHBondContact O-N 3.03Å; Y72-K74 VanDerWaalsContact C-N 3.32Å; Y72-K74 PolarHBondContact O-N 3.03Å; Y72-K75 PolarHBondContact O-N 2.84Å; Y72-L76 WeakPolarHBondContact O-CB 3.38Å; Y72-L76 PolarHBondContact O-N 3.25Å
73	V	96.3	Very high	88.9	Confident	72 Å²	72	114.5 Å²	114.5	44%	0.436	56%	0.563	S	S	.	*	H	α-helix	trans	-59.3	-44.2	172.5	173.9	0	0	0	0	110.3	L69 D70 K75 L76 L77	L69-V73 WeakPolarHBondContact O-CG2 3.49Å; L69-V73 PolarHBondContact O-N 2.86Å; D70-V73 PolarHBondContact O-N 2.89Å; V73-K75 PolarHBondContact O-N 3.49Å; V73-L76 PolarHBondContact O-N 3.24Å; V73-L77 HydrophobicContact CG1-CD1 4.1Å; V73-L77 HydrophobicContact CG1-CG 4.4Å; V73-L77 WeakPolarHBondContact O-CB 3.42Å; V73-L77 WeakPolarHBondContact O-CG 3.47Å; V73-L77 PolarHBondContact O-N 3.22Å
74	K	97.6	Very high	90.1	Very high	132 Å²	132	111 Å²	111	57%	0.574	55%	0.551	S	S	*	*	H	α-helix	trans	-60.9	-44.1	175	-75.2	169.4	-174.2	168.3	0	112.1	D70 Y72 L76 L77 N78	D70-K74 WeakPolarHBondContact O-CB 3.33Å; D70-K74 WeakPolarHBondContact O-CG 3.32Å; D70-K74 PolarHBondContact O-N 3.02Å; Y72-K74 VanDerWaalsContact C-N 3.32Å; Y72-K74 PolarHBondContact O-N 3.03Å; K74-L76 VanDerWaalsContact C-N 3.35Å; K74-L76 PolarHBondContact O-N 3.5Å; K74-L77 PolarHBondContact O-N 2.9Å; K74-N78 WeakPolarHBondContact O-CB 3.47Å; K74-N78 PolarHBondContact O-N 3.38Å; K74-N78 PolarHBondContact O-ND2 3.45Å
75	K	97.4	Very high	91.9	Very high	139 Å²	139	109.2 Å²	109.2	60%	0.604	55%	0.548	S	S	*	.	H	α-helix	trans	-59.9	-44.5	174.8	-75.8	173.5	-176.7	177.9	0	111.3	P71 Y72 V73 N78 A79	P71-K75 VanDerWaalsContact O-CG 3.32Å; P71-K75 WeakPolarHBondContact O-CG 3.32Å; P71-K75 PolarHBondContact O-N 3.45Å; Y72-K75 PolarHBondContact O-N 2.84Å; V73-K75 PolarHBondContact O-N 3.49Å; K75-N78 PolarHBondContact O-N 3.39Å; K75-A79 PolarHBondContact O-N 3.35Å
76	L	98.1	Very high	93.7	Very high	125 Å²	125	107.5 Å²	107.5	65%	0.654	54%	0.543	S	S	*	.	H	α-helix	trans	-65	-44	178.8	-176	62.2	0	0	0	112.1	Y72 V73 K74 N78 A79 R80	Y72-L76 WeakPolarHBondContact O-CB 3.38Å; Y72-L76 PolarHBondContact O-N 3.25Å; V73-L76 PolarHBondContact O-N 3.24Å; K74-L76 VanDerWaalsContact C-N 3.35Å; K74-L76 PolarHBondContact O-N 3.5Å; L76-N78 VanDerWaalsContact C-N 3.32Å; L76-N78 PolarHBondContact O-N 2.95Å; L76-A79 PolarHBondContact O-N 2.97Å; L76-R80 WeakPolarHBondContact O-CB 3.3Å; L76-R80 PolarHBondContact O-N 3.39Å
77	L	98.3	Very high	95.2	Very high	79 Å²	79	107.1 Å²	107.1	41%	0.414	53%	0.529	S	S	.	.	H	α-helix	trans	-62	-40.8	175.8	-74.4	176	0	0	0	111.9	V73 K74 R80 R81	V73-L77 HydrophobicContact CG1-CD1 4.1Å; V73-L77 HydrophobicContact CG1-CG 4.4Å; V73-L77 WeakPolarHBondContact O-CB 3.42Å; V73-L77 WeakPolarHBondContact O-CG 3.47Å; V73-L77 PolarHBondContact O-N 3.22Å; K74-L77 PolarHBondContact O-N 2.9Å; L77-R80 PolarHBondContact O-N 2.96Å; L77-R81 VanDerWaalsContact O-CG 3.3Å; L77-R81 WeakPolarHBondContact O-CG 3.41Å; L77-R81 PolarHBondContact O-N 3.44Å
78	N	98.4	Very high	96.4	Very high	78 Å²	78	105 Å²	105	42%	0.417	52%	0.519	S	S	.	.	H	α-helix	trans	-64.9	-41.9	175.1	-76.9	-30.6	0	0	0	112	K74 K75 L76 R81 R82	K74-N78 WeakPolarHBondContact O-CB 3.47Å; K74-N78 PolarHBondContact O-N 3.38Å; K74-N78 PolarHBondContact O-ND2 3.45Å; K75-N78 PolarHBondContact O-N 3.39Å; L76-N78 VanDerWaalsContact C-N 3.32Å; L76-N78 PolarHBondContact O-N 2.95Å; N78-R81 PolarHBondContact O-N 3.25Å; N78-R81 PolarHBondContact OD1-NH1 3.23Å; N78-R82 WeakPolarHBondContact O-CG 3.49Å; N78-R82 PolarHBondContact O-N 3Å
79	A	98.5	Very high	97.2	Very high	47 Å²	47	105.3 Å²	105.3	39%	0.388	52%	0.519	S	S	.	.	H	α-helix	trans	-60.8	-46.9	173.7	0	0	0	0	0	111.3	K75 L76 R81 R82 V83	K75-A79 PolarHBondContact O-N 3.35Å; L76-A79 PolarHBondContact O-N 2.97Å; A79-R81 PolarHBondContact O-N 2.94Å; A79-R82 PolarHBondContact O-N 3.46Å; A79-R82 VanDerWaalsContact O-N 3.16Å; A79-V83 WeakPolarHBondContact O-CG2 3.36Å; A79-V83 PolarHBondContact O-N 3Å
80	R	98.3	Very high	97.6	Very high	168 Å²	168	104.8 Å²	104.8	63%	0.634	52%	0.516	S	S	*	.	H	α-helix	trans	-55.9	-47.3	175.7	-176.7	-178.6	-178.2	-86.4	0.1	111.9	L76 L77 R82 V83 V84	L76-R80 WeakPolarHBondContact O-CB 3.3Å; L76-R80 PolarHBondContact O-N 3.39Å; L77-R80 PolarHBondContact O-N 2.96Å; R80-R82 VanDerWaalsContact C-N 3.34Å; R80-R82 PolarHBondContact O-N 3.46Å; R80-V83 PolarHBondContact O-N 2.93Å; R80-V84 WeakPolarHBondContact O-CG2 3.47Å; R80-V84 PolarHBondContact O-N 3.3Å
81	R	98.6	Very high	97.9	Very high	162 Å²	162	105.1 Å²	105.1	61%	0.611	52%	0.515	S	S	*	.	H	α-helix	trans	-58.7	-44.3	177.3	-72.7	170.1	-175	167.2	-2.6	111.8	L77 N78 A79 V84 L85	L77-R81 VanDerWaalsContact O-CG 3.3Å; L77-R81 WeakPolarHBondContact O-CG 3.41Å; L77-R81 PolarHBondContact O-N 3.44Å; N78-R81 PolarHBondContact O-N 3.25Å; N78-R81 PolarHBondContact OD1-NH1 3.23Å; A79-R81 PolarHBondContact O-N 2.94Å; R81-V84 PolarHBondContact O-N 2.93Å; R81-L85 PolarHBondContact O-N 3.16Å
82	R	98.4	Very high	98.1	Very high	191 Å²	191	107.6 Å²	107.6	72%	0.721	53%	0.525	S	S	*	.	H	α-helix	trans	-63.5	-43.4	177.3	-71.4	178	-179.4	-171.3	-0.1	112.1	N78 A79 R80 V84 L85 V86	N78-R82 WeakPolarHBondContact O-CG 3.49Å; N78-R82 PolarHBondContact O-N 3Å; A79-R82 PolarHBondContact O-N 3.46Å; A79-R82 VanDerWaalsContact O-N 3.16Å; R80-R82 VanDerWaalsContact C-N 3.34Å; R80-R82 PolarHBondContact O-N 3.46Å; R82-V84 VanDerWaalsContact C-N 3.34Å; R82-V84 PolarHBondContact O-N 3.07Å; R82-L85 WeakPolarHBondContact O-CB 3.4Å; R82-L85 PolarHBondContact O-N 3.44Å; R82-V86 WeakPolarHBondContact O-CG2 3.38Å; R82-V86 PolarHBondContact O-N 3.37Å
83	V	98.5	Very high	98.3	Very high	100 Å²	100	103.3 Å²	103.3	61%	0.606	52%	0.519	S	S	*	.	H	α-helix	trans	-59.9	-45	176.4	170.3	0	0	0	0	111.1	A79 R80 L85 V86 N87	A79-V83 WeakPolarHBondContact O-CG2 3.36Å; A79-V83 PolarHBondContact O-N 3Å; R80-V83 PolarHBondContact O-N 2.93Å; V83-L85 VanDerWaalsContact C-N 3.34Å; V83-L85 PolarHBondContact O-N 2.86Å; V83-V86 PolarHBondContact O-N 3.09Å; V83-N87 WeakPolarHBondContact O-CB 3.4Å; V83-N87 PolarHBondContact O-N 3.29Å
84	V	98.6	Very high	98.4	Very high	66 Å²	66	103.8 Å²	103.8	40%	0.4	52%	0.516	S	S	.	.	H	α-helix	trans	-61.6	-42.9	176.6	171.6	0	0	0	0	111.3	R80 R81 R82 N87 N88	R80-V84 WeakPolarHBondContact O-CG2 3.47Å; R80-V84 PolarHBondContact O-N 3.3Å; R81-V84 PolarHBondContact O-N 2.93Å; R82-V84 VanDerWaalsContact C-N 3.34Å; R82-V84 PolarHBondContact O-N 3.07Å; V84-N87 PolarHBondContact O-N 3.01Å; V84-N88 PolarHBondContact O-N 3.38Å; V84-N88 PolarHBondContact O-ND2 2.9Å; V84-N88 VanDerWaalsContact O-ND2 3.09Å
85	L	98.6	Very high	98.4	Very high	105 Å²	105	101 Å²	101	55%	0.55	51%	0.505	S	S	.	.	H	α-helix	trans	-60.9	-48	176.4	179.4	64.2	0	0	0	111.9	R81 R82 V83 N87 N88 I89	R81-L85 PolarHBondContact O-N 3.16Å; R82-L85 WeakPolarHBondContact O-CB 3.4Å; R82-L85 PolarHBondContact O-N 3.44Å; V83-L85 VanDerWaalsContact C-N 3.34Å; V83-L85 PolarHBondContact O-N 2.86Å; L85-N87 VanDerWaalsContact C-N 3.3Å; L85-N87 PolarHBondContact O-N 2.81Å; L85-N88 PolarHBondContact O-N 3.25Å; L85-I89 HydrophobicContact CD1-CD1 4.3Å; L85-I89 HydrophobicContact CG-CD1 4.09Å; L85-I89 WeakPolarHBondContact O-CG1 3.4Å; L85-I89 PolarHBondContact O-N 3.34Å
86	V	98.7	Very high	98.4	Very high	92 Å²	92	103.5 Å²	103.5	56%	0.558	51%	0.511	S	S	*	.	H	α-helix	trans	-61.1	-41.5	178.2	172	0	0	0	0	110.9	R82 V83 I89 L90	R82-V86 WeakPolarHBondContact O-CG2 3.38Å; R82-V86 PolarHBondContact O-N 3.37Å; V83-V86 PolarHBondContact O-N 3.09Å; V86-I89 PolarHBondContact O-N 3.42Å; V86-L90 WeakPolarHBondContact O-CB 3.46Å; V86-L90 PolarHBondContact O-N 3.07Å
87	N	98.4	Very high	98.4	Very high	78 Å²	78	102.1 Å²	102.1	42%	0.417	50%	0.504	S	S	.	.	H	α-helix	trans	-60.4	-47.3	176.4	-168.8	-33.5	0	0	0	111.2	V83 V84 L85 I89 L90 Q91	V83-N87 WeakPolarHBondContact O-CB 3.4Å; V83-N87 PolarHBondContact O-N 3.29Å; V84-N87 PolarHBondContact O-N 3.01Å; L85-N87 VanDerWaalsContact C-N 3.3Å; L85-N87 PolarHBondContact O-N 2.81Å; N87-I89 VanDerWaalsContact C-N 3.34Å; N87-I89 PolarHBondContact O-N 3.35Å; N87-L90 PolarHBondContact O-N 2.91Å; N87-Q91 WeakPolarHBondContact O-CG 3.43Å; N87-Q91 PolarHBondContact O-N 3.34Å; N87-Q91 VanDerWaalsContact OD1-CD 3.32Å; N87-Q91 WeakPolarHBondContact OD1-CG 3.44Å; N87-Q91 PolarHBondContact OD1-NE2 3.49Å; N87-Q91 VanDerWaalsContact OD1-NE2 3.1Å
88	N	98.4	Very high	98.4	Very high	76 Å²	76	106 Å²	106	41%	0.406	51%	0.513	S	S	.	.	H	α-helix	trans	-58.4	-43.9	176	-78.8	-49.6	0	0	0	112.4	V84 L85 N92	V84-N88 PolarHBondContact O-N 3.38Å; V84-N88 PolarHBondContact O-ND2 2.9Å; V84-N88 VanDerWaalsContact O-ND2 3.09Å; L85-N88 PolarHBondContact O-N 3.25Å; N88-N92 WeakPolarHBondContact O-CB 3.39Å; N88-N92 PolarHBondContact O-N 2.99Å; N88-N92 VanDerWaalsContact O-N 3.07Å; N88-N92 PolarHBondContact O-ND2 2.87Å
89	I	98.5	Very high	98.4	Very high	104 Å²	104	109.5 Å²	109.5	53%	0.533	52%	0.52	S	S	.	.	H	α-helix	trans	-62.9	-45.6	177.5	-67.8	167.2	0	0	0	110.3	L85 V86 N87 N92 A93	L85-I89 HydrophobicContact CD1-CD1 4.3Å; L85-I89 HydrophobicContact CG-CD1 4.09Å; L85-I89 WeakPolarHBondContact O-CG1 3.4Å; L85-I89 PolarHBondContact O-N 3.34Å; V86-I89 PolarHBondContact O-N 3.42Å; N87-I89 VanDerWaalsContact C-N 3.34Å; N87-I89 PolarHBondContact O-N 3.35Å; I89-N92 PolarHBondContact O-N 3.1Å; I89-A93 WeakPolarHBondContact O-CB 3.38Å; I89-A93 PolarHBondContact O-N 2.86Å
90	L	98.6	Very high	98.4	Very high	95 Å²	95	112 Å²	112	50%	0.497	53%	0.526	S	S	.	.	H	α-helix	trans	-62.8	-46	-179.5	-176	63.3	0	0	0	111.7	V86 N87 N92 A93 Q94	V86-L90 WeakPolarHBondContact O-CB 3.46Å; V86-L90 PolarHBondContact O-N 3.07Å; N87-L90 PolarHBondContact O-N 2.91Å; L90-N92 VanDerWaalsContact C-N 3.34Å; L90-N92 PolarHBondContact O-N 2.92Å; L90-A93 PolarHBondContact O-N 3.19Å; L90-Q94 HydrophobicContact CD1-CG 4.35Å; L90-Q94 HydrophobicContact CG-CG 4.42Å; L90-Q94 WeakPolarHBondContact O-CB 3.34Å; L90-Q94 VanDerWaalsContact O-CG 3.25Å; L90-Q94 WeakPolarHBondContact O-CG 3.4Å; L90-Q94 PolarHBondContact O-N 3.1Å
91	Q	98.3	Very high	98.3	Very high	104 Å²	104	108.5 Å²	108.5	49%	0.486	52%	0.52	S	S	.	.	H	α-helix	trans	-58.8	-45.6	176.3	-74.5	-176.8	-6.4	0	0	111.6	N87 A93 Q94 E95	N87-Q91 WeakPolarHBondContact O-CG 3.43Å; N87-Q91 PolarHBondContact O-N 3.34Å; N87-Q91 VanDerWaalsContact OD1-CD 3.32Å; N87-Q91 WeakPolarHBondContact OD1-CG 3.44Å; N87-Q91 PolarHBondContact OD1-NE2 3.49Å; N87-Q91 VanDerWaalsContact OD1-NE2 3.1Å; Q91-A93 PolarHBondContact O-N 3.45Å; Q91-Q94 PolarHBondContact O-N 2.94Å; Q91-E95 WeakPolarHBondContact O-CB 3.43Å; Q91-E95 PolarHBondContact O-N 3.36Å
92	N	98.5	Very high	98.3	Very high	105 Å²	105	106.9 Å²	106.9	56%	0.561	52%	0.52	S	S	*	.	H	α-helix	trans	-62.9	-42.4	177.2	-81.9	-64.1	0	0	0	112.5	N88 I89 L90 R96	N88-N92 WeakPolarHBondContact O-CB 3.39Å; N88-N92 PolarHBondContact O-N 2.99Å; N88-N92 VanDerWaalsContact O-N 3.07Å; N88-N92 PolarHBondContact O-ND2 2.87Å; I89-N92 PolarHBondContact O-N 3.1Å; L90-N92 VanDerWaalsContact C-N 3.34Å; L90-N92 PolarHBondContact O-N 2.92Å; N92-R96 WeakPolarHBondContact O-CG 3.25Å; N92-R96 PolarHBondContact O-N 3.27Å; N92-R96 VanDerWaalsContact O-N 3.1Å
93	A	98.6	Very high	98.3	Very high	51 Å²	51	102.5 Å²	102.5	42%	0.421	51%	0.51	S	S	.	.	H	α-helix	trans	-64.2	-44.4	176.8	0	0	0	0	0	111.6	I89 L90 Q91 E95 R96 L97	I89-A93 WeakPolarHBondContact O-CB 3.38Å; I89-A93 PolarHBondContact O-N 2.86Å; L90-A93 PolarHBondContact O-N 3.19Å; Q91-A93 PolarHBondContact O-N 3.45Å; A93-E95 PolarHBondContact O-N 2.97Å; A93-R96 PolarHBondContact O-N 3.42Å; A93-L97 WeakPolarHBondContact O-CB 3.5Å; A93-L97 PolarHBondContact O-N 2.89Å
94	Q	98.2	Very high	98.2	Very high	83 Å²	83	101.5 Å²	101.5	39%	0.388	50%	0.504	S	S	.	.	H	α-helix	trans	-61.3	-43.6	177.3	-75.4	175.5	-21.6	0	0	112	L90 Q91 L97 R98	L90-Q94 HydrophobicContact CD1-CG 4.35Å; L90-Q94 HydrophobicContact CG-CG 4.42Å; L90-Q94 WeakPolarHBondContact O-CB 3.34Å; L90-Q94 VanDerWaalsContact O-CG 3.25Å; L90-Q94 WeakPolarHBondContact O-CG 3.4Å; L90-Q94 PolarHBondContact O-N 3.1Å; Q91-Q94 PolarHBondContact O-N 2.94Å; Q94-L97 PolarHBondContact O-N 2.79Å; Q94-R98 WeakPolarHBondContact O-CG 3.37Å; Q94-R98 PolarHBondContact O-N 2.93Å
95	E	98.4	Very high	98.1	Very high	73 Å²	73	101.1 Å²	101.1	34%	0.341	51%	0.508	S	S	.	.	H	α-helix	trans	-63.2	-45.5	178	178.4	56.6	-160.6	0	0	111.8	Q91 A93 L97 R98 R99	Q91-E95 WeakPolarHBondContact O-CB 3.43Å; Q91-E95 PolarHBondContact O-N 3.36Å; A93-E95 PolarHBondContact O-N 2.97Å; E95-L97 VanDerWaalsContact C-N 3.32Å; E95-L97 PolarHBondContact O-N 3.39Å; E95-R98 PolarHBondContact O-N 3.38Å; E95-R99 WeakPolarHBondContact O-CG 3.44Å; E95-R99 PolarHBondContact O-N 3.28Å; E95-R99 IonicContact OE1-CZ 2.79Å; E95-R99 VanDerWaalsContact OE1-CZ 3.3Å; E95-R99 IonicContact OE1-NE 3.8Å; E95-R99 PolarHBondContact OE1-NE 3.34Å; E95-R99 IonicContact OE1-NH2 3.73Å; E95-R99 PolarHBondContact OE1-NH2 3.48Å
96	R	98.2	Very high	98	Very high	192 Å²	192	103 Å²	103	73%	0.725	51%	0.512	S	S	*	.	H	α-helix	trans	-60.5	-42.3	175.2	-71.8	171.9	63.9	-169.6	-0.1	111.9	N92 A93 R99 L100	N92-R96 WeakPolarHBondContact O-CG 3.25Å; N92-R96 PolarHBondContact O-N 3.27Å; N92-R96 VanDerWaalsContact O-N 3.1Å; A93-R96 PolarHBondContact O-N 3.42Å; R96-R99 PolarHBondContact O-N 3.02Å; R96-L100 WeakPolarHBondContact O-CB 3.41Å; R96-L100 PolarHBondContact O-N 3.49Å
97	L	98.4	Very high	97.8	Very high	96 Å²	96	102 Å²	102	50%	0.503	50%	0.501	S	S	.	.	H	α-helix	trans	-64.6	-42.2	177.5	-176.9	62.9	0	0	0	111.7	A93 Q94 E95 R99 L100 N101	A93-L97 WeakPolarHBondContact O-CB 3.5Å; A93-L97 PolarHBondContact O-N 2.89Å; Q94-L97 PolarHBondContact O-N 2.79Å; E95-L97 VanDerWaalsContact C-N 3.32Å; E95-L97 PolarHBondContact O-N 3.39Å; L97-R99 PolarHBondContact O-N 3.39Å; L97-L100 PolarHBondContact O-N 2.94Å; L97-N101 WeakPolarHBondContact O-CB 3.42Å; L97-N101 PolarHBondContact O-N 3.4Å
98	R	98.1	Very high	97.6	Very high	159 Å²	159	101.2 Å²	101.2	60%	0.6	50%	0.499	S	S	*	.	H	α-helix	trans	-59.3	-45.9	175.1	-77.1	179	-177.2	139.3	1	111.7	Q94 E95 N101 H102	Q94-R98 WeakPolarHBondContact O-CG 3.37Å; Q94-R98 PolarHBondContact O-N 2.93Å; E95-R98 PolarHBondContact O-N 3.38Å; R98-N101 PolarHBondContact O-N 3.32Å; R98-H102 WeakPolarHBondContact O-CB 3.45Å; R98-H102 PolarHBondContact O-N 2.94Å
99	R	97.8	Very high	97.4	Very high	153 Å²	153	100.2 Å²	100.2	58%	0.577	50%	0.501	S	S	*	.	H	α-helix	trans	-61.5	-43.7	176	-68.5	178.6	-167.8	-175	3.3	112.1	E95 R96 L97 H102 N103	E95-R99 WeakPolarHBondContact O-CG 3.44Å; E95-R99 PolarHBondContact O-N 3.28Å; E95-R99 IonicContact OE1-CZ 2.79Å; E95-R99 VanDerWaalsContact OE1-CZ 3.3Å; E95-R99 IonicContact OE1-NE 3.8Å; E95-R99 PolarHBondContact OE1-NE 3.34Å; E95-R99 IonicContact OE1-NH2 3.73Å; E95-R99 PolarHBondContact OE1-NH2 3.48Å; R96-R99 PolarHBondContact O-N 3.02Å; L97-R99 PolarHBondContact O-N 3.39Å; R99-H102 PolarHBondContact O-N 3.28Å; R99-N103 VanDerWaalsContact O-CG 3.29Å; R99-N103 PolarHBondContact O-N 2.94Å; R99-N103 PolarHBondContact O-ND2 3.37Å
100	L	97.9	Very high	97.1	Very high	99 Å²	99	102.5 Å²	102.5	52%	0.518	50%	0.503	S	S	.	.	H	α-helix	trans	-61.8	-48.4	177.5	-178.9	62.2	0	0	0	111.4	R96 L97 H102 N103 V104	R96-L100 WeakPolarHBondContact O-CB 3.41Å; R96-L100 PolarHBondContact O-N 3.49Å; L97-L100 PolarHBondContact O-N 2.94Å; L100-H102 VanDerWaalsContact C-N 3.3Å; L100-H102 PolarHBondContact O-N 2.88Å; L100-N103 PolarHBondContact O-N 2.86Å; L100-N103 VanDerWaalsContact O-N 3.17Å; L100-V104 HydrophobicContact CD1-CG2 4.29Å; L100-V104 HydrophobicContact CG-CG2 4.45Å; L100-V104 WeakPolarHBondContact O-CG2 3.33Å; L100-V104 PolarHBondContact O-N 2.9Å
101	N	97.6	Very high	96.7	Very high	95 Å²	95	105.1 Å²	105.1	51%	0.508	51%	0.506	S	S	.	.	H	α-helix	trans	-59	-41.9	177.1	-76.6	-16	0	0	0	111.7	L97 R98 V104 A105	L97-N101 WeakPolarHBondContact O-CB 3.42Å; L97-N101 PolarHBondContact O-N 3.4Å; R98-N101 PolarHBondContact O-N 3.32Å; N101-V104 PolarHBondContact O-N 3.17Å; N101-A105 WeakPolarHBondContact O-CB 3.34Å; N101-A105 PolarHBondContact O-N 3.38Å
102	H	97.7	Very high	96.2	Very high	128 Å²	128	106.4 Å²	106.4	59%	0.593	51%	0.51	S	S	*	.	H	α-helix	trans	-61.7	-45.4	175.3	-176.2	77.6	0	0	0	112.1	R98 R99 L100 A105 K106	R98-H102 WeakPolarHBondContact O-CB 3.45Å; R98-H102 PolarHBondContact O-N 2.94Å; R99-H102 PolarHBondContact O-N 3.28Å; L100-H102 VanDerWaalsContact C-N 3.3Å; L100-H102 PolarHBondContact O-N 2.88Å; H102-A105 PolarHBondContact O-N 2.84Å; H102-K106 WeakPolarHBondContact O-CB 3.37Å; H102-K106 PolarHBondContact O-N 3.42Å
103	N	97.3	Very high	95.7	Very high	99 Å²	99	105.1 Å²	105.1	53%	0.529	51%	0.507	S	S	.	.	H	α-helix	trans	-63.3	-43.2	177.4	-71.6	-22.2	0	0	0	112.1	R99 L100 K106 E107	R99-N103 VanDerWaalsContact O-CG 3.29Å; R99-N103 PolarHBondContact O-N 2.94Å; R99-N103 PolarHBondContact O-ND2 3.37Å; L100-N103 PolarHBondContact O-N 2.86Å; L100-N103 VanDerWaalsContact O-N 3.17Å; N103-K106 PolarHBondContact O-N 2.9Å; N103-E107 WeakPolarHBondContact O-CB 3.35Å; N103-E107 PolarHBondContact O-N 3.4Å
104	V	97.1	Very high	95	Very high	78 Å²	78	107.8 Å²	107.8	47%	0.473	51%	0.512	S	S	.	.	H	α-helix	trans	-62.7	-45.1	176.3	170	0	0	0	0	110.8	L100 N101 E107 T108	L100-V104 HydrophobicContact CD1-CG2 4.29Å; L100-V104 HydrophobicContact CG-CG2 4.45Å; L100-V104 WeakPolarHBondContact O-CG2 3.33Å; L100-V104 PolarHBondContact O-N 2.9Å; N101-V104 PolarHBondContact O-N 3.17Å; V104-E107 PolarHBondContact O-N 3.38Å; V104-T108 VanDerWaalsContact O-CB 3.24Å; V104-T108 WeakPolarHBondContact O-CB 3.42Å; V104-T108 PolarHBondContact O-N 2.91Å; V104-T108 PolarHBondContact O-OG1 2.93Å
105	A	96.2	Very high	94.1	Very high	58 Å²	58	109.4 Å²	109.4	48%	0.479	52%	0.522	S	S	.	.	H	α-helix	trans	-62.1	-44.8	177.7	0	0	0	0	0	111.6	N101 H102 T108 A109	N101-A105 WeakPolarHBondContact O-CB 3.34Å; N101-A105 PolarHBondContact O-N 3.38Å; H102-A105 PolarHBondContact O-N 2.84Å; A105-T108 PolarHBondContact O-N 2.7Å; A105-A109 WeakPolarHBondContact O-CB 3.36Å; A105-A109 PolarHBondContact O-N 3.14Å
106	K	96.4	Very high	93.1	Very high	146 Å²	146	112.7 Å²	112.7	64%	0.635	54%	0.537	S	S	*	.	H	α-helix	trans	-61.1	-47.4	176.8	-175.8	179.8	-179.7	179.3	0	112	H102 N103 A109 R110	H102-K106 WeakPolarHBondContact O-CB 3.37Å; H102-K106 PolarHBondContact O-N 3.42Å; N103-K106 PolarHBondContact O-N 2.9Å; K106-A109 PolarHBondContact O-N 2.85Å; K106-R110 WeakPolarHBondContact O-CB 3.24Å; K106-R110 PolarHBondContact O-N 3.32Å
107	E	94.9	Very high	91.9	Very high	69 Å²	69	107.8 Å²	107.8	32%	0.322	54%	0.538	S	S	.	.	H	α-helix	trans	-66.6	-39.2	178.4	-179.4	60.1	-164.1	0	0	111.7	N103 V104 R110 R111	N103-E107 WeakPolarHBondContact O-CB 3.35Å; N103-E107 PolarHBondContact O-N 3.4Å; V104-E107 PolarHBondContact O-N 3.38Å; E107-R110 PolarHBondContact O-N 2.83Å; E107-R111 WeakPolarHBondContact O-CG 3.4Å; E107-R111 PolarHBondContact O-N 3.43Å; E107-R111 IonicContact OE1-CZ 3.38Å; E107-R111 IonicContact OE1-NE 2.84Å; E107-R111 PolarHBondContact OE1-NE 2.92Å; E107-R111 IonicContact OE1-NH2 3.14Å; E107-R111 PolarHBondContact OE1-NH2 3.41Å; E107-R111 VanDerWaalsContact OE1-NH2 3.14Å
108	T	95	Very high	90.5	Very high	63 Å²	63	107.3 Å²	107.3	39%	0.387	54%	0.543	S	S	.	.	H	α-helix	trans	-62.7	-44.7	175.3	-58.7	0	0	0	0	111.1	V104 A105 R111 K112	V104-T108 VanDerWaalsContact O-CB 3.24Å; V104-T108 WeakPolarHBondContact O-CB 3.42Å; V104-T108 PolarHBondContact O-N 2.91Å; V104-T108 PolarHBondContact O-OG1 2.93Å; A105-T108 PolarHBondContact O-N 2.7Å; T108-R111 PolarHBondContact O-N 3.39Å; T108-K112 WeakPolarHBondContact O-CG 3.43Å; T108-K112 PolarHBondContact O-N 3.25Å
109	A	92.9	Very high	88.7	Confident	54 Å²	54	102.4 Å²	102.4	45%	0.446	54%	0.541	S	S	.	.	H	α-helix	trans	-62.1	-45.1	174.8	0	0	0	0	0	111.4	A105 K106 R111 K112 T113	A105-A109 WeakPolarHBondContact O-CB 3.36Å; A105-A109 PolarHBondContact O-N 3.14Å; K106-A109 PolarHBondContact O-N 2.85Å; A109-R111 PolarHBondContact O-N 2.95Å; A109-K112 PolarHBondContact O-N 3.04Å; A109-T113 WeakPolarHBondContact O-CG2 3.46Å; A109-T113 PolarHBondContact O-N 2.93Å; A109-T113 PolarHBondContact O-OG1 3.4Å
110	R	92.9	Very high	86.8	Confident	153 Å²	153	100.5 Å²	100.5	58%	0.577	55%	0.547	S	S	*	.	H	α-helix	trans	-59.5	-43.1	176.3	-174.9	-175.5	-178.9	177.8	2.9	112.5	K106 E107 T113 M114	K106-R110 WeakPolarHBondContact O-CB 3.24Å; K106-R110 PolarHBondContact O-N 3.32Å; E107-R110 PolarHBondContact O-N 2.83Å; R110-T113 PolarHBondContact O-N 3.45Å; R110-T113 PolarHBondContact O-OG1 3.42Å; R110-M114 HydrophobicContact CG-SD 4.29Å; R110-M114 WeakPolarHBondContact O-CB 3.42Å; R110-M114 WeakPolarHBondContact O-CG 3.23Å; R110-M114 PolarHBondContact O-N 2.99Å
111	R	90.9	Very high	84.7	Confident	149 Å²	149	104.5 Å²	104.5	56%	0.562	56%	0.56	S	S	*	*	H	α-helix	trans	-64.9	-41.3	177	-74.4	177.4	-170.3	173.1	1.2	111.8	E107 T108 A109 M114 L115	E107-R111 WeakPolarHBondContact O-CG 3.4Å; E107-R111 PolarHBondContact O-N 3.43Å; E107-R111 IonicContact OE1-CZ 3.38Å; E107-R111 IonicContact OE1-NE 2.84Å; E107-R111 PolarHBondContact OE1-NE 2.92Å; E107-R111 IonicContact OE1-NH2 3.14Å; E107-R111 PolarHBondContact OE1-NH2 3.41Å; E107-R111 VanDerWaalsContact OE1-NH2 3.14Å; T108-R111 PolarHBondContact O-N 3.39Å; A109-R111 PolarHBondContact O-N 2.95Å; R111-M114 PolarHBondContact O-N 2.87Å; R111-L115 WeakPolarHBondContact O-CB 3.33Å; R111-L115 WeakPolarHBondContact O-CD1 3.26Å; R111-L115 VanDerWaalsContact O-CG 3.26Å; R111-L115 WeakPolarHBondContact O-CG 3.48Å; R111-L115 PolarHBondContact O-N 3.43Å
112	K	88.1	Confident	82.6	Confident	131 Å²	131	105.9 Å²	105.9	57%	0.57	57%	0.572	S	S	*	*	H	α-helix	trans	-58.8	-49.1	174.3	-74.1	-177.7	179.4	-172.4	0	111.3	T108 A109 M114 L115 E116	T108-K112 WeakPolarHBondContact O-CG 3.43Å; T108-K112 PolarHBondContact O-N 3.25Å; A109-K112 PolarHBondContact O-N 3.04Å; K112-M114 PolarHBondContact O-N 3.48Å; K112-L115 PolarHBondContact O-N 3.47Å; K112-E116 WeakPolarHBondContact O-CG 3.48Å; K112-E116 PolarHBondContact O-N 2.94Å
113	T	88.2	Confident	80.3	Confident	79 Å²	79	105.2 Å²	105.2	49%	0.485	58%	0.579	S	S	.	*	H	α-helix	trans	-65.6	-36.6	179.3	59.8	0	0	0	0	112.9	A109 R110 E116 A117	A109-T113 WeakPolarHBondContact O-CG2 3.46Å; A109-T113 PolarHBondContact O-N 2.93Å; A109-T113 PolarHBondContact O-OG1 3.4Å; R110-T113 PolarHBondContact O-N 3.45Å; R110-T113 PolarHBondContact O-OG1 3.42Å; T113-E116 PolarHBondContact O-N 2.94Å; T113-A117 VanDerWaalsContact O-CB 3.23Å; T113-A117 WeakPolarHBondContact O-CB 3.33Å; T113-A117 PolarHBondContact O-N 3.44Å
114	M	82.9	Confident	78.3	Confident	107 Å²	107	112.1 Å²	112.1	53%	0.527	60%	0.598	S	S	.	*	H	α-helix	trans	-67.4	-37.8	174.8	-72.9	-174.7	76.4	0	0	112.7	R110 R111 K112 A117 S118	R110-M114 HydrophobicContact CG-SD 4.29Å; R110-M114 WeakPolarHBondContact O-CB 3.42Å; R110-M114 WeakPolarHBondContact O-CG 3.23Å; R110-M114 PolarHBondContact O-N 2.99Å; R111-M114 PolarHBondContact O-N 2.87Å; K112-M114 PolarHBondContact O-N 3.48Å; M114-A117 PolarHBondContact O-N 2.71Å; M114-S118 WeakPolarHBondContact O-CB 3.35Å; M114-S118 PolarHBondContact O-N 2.93Å; M114-S118 PolarHBondContact O-OG 3.32Å
115	L	80	Confident	76.4	Confident	116 Å²	116	113.1 Å²	113.1	61%	0.607	61%	0.608	S	S	*	*	H	α-helix	trans	-67.4	-41	175.1	-74.5	164.1	0	0	0	111.6	R111 K112 S118	R111-L115 WeakPolarHBondContact O-CB 3.33Å; R111-L115 WeakPolarHBondContact O-CD1 3.26Å; R111-L115 VanDerWaalsContact O-CG 3.26Å; R111-L115 WeakPolarHBondContact O-CG 3.48Å; R111-L115 PolarHBondContact O-N 3.43Å; K112-L115 PolarHBondContact O-N 3.47Å; L115-S118 PolarHBondContact O-N 3.26Å
116	E	76	Confident	74.7	Confident	142 Å²	142	116.5 Å²	116.5	66%	0.664	63%	0.625	S	S	*	*	H	α-helix	trans	-64.3	-40.4	173	-72.1	172.5	178.1	0	0	111.7	K112 T113	K112-E116 WeakPolarHBondContact O-CG 3.48Å; K112-E116 PolarHBondContact O-N 2.94Å; T113-E116 PolarHBondContact O-N 2.94Å
117	A	73	Confident	72.6	Confident	89 Å²	89	115.3 Å²	115.3	74%	0.736	64%	0.635	S	S	*	*	H	α-helix	trans	-73.6	-25.5	178.4	0	0	0	0	0	114.1	T113 M114 G119	T113-A117 VanDerWaalsContact O-CB 3.23Å; T113-A117 WeakPolarHBondContact O-CB 3.33Å; T113-A117 PolarHBondContact O-N 3.44Å; M114-A117 PolarHBondContact O-N 2.71Å; A117-G119 PolarHBondContact O-N 3.44Å
118	S	70.1	Confident	70.4	Confident	87 Å²	87	121.1 Å²	121.1	61%	0.608	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.2	7.2	179.5	-56.7	0	0	0	0	113.6	M114 L115 V120	M114-S118 WeakPolarHBondContact O-CB 3.35Å; M114-S118 PolarHBondContact O-N 2.93Å; M114-S118 PolarHBondContact O-OG 3.32Å; L115-S118 PolarHBondContact O-N 3.26Å; S118-V120 PolarHBondContact O-N 3.2Å
119	G	60.5	Low	68.7	Low	55 Å²	55	127.2 Å²	127.2	57%	0.567	70%	0.7	S	S	*	*	T	Hydrogen-bonded Turn	trans	73.6	17.5	166.5	0	0	0	0	0	116.3	A117 F121	A117-G119 PolarHBondContact O-N 3.44Å; G119-F121 PolarHBondContact O-N 3.34Å
120	V	57.3	Low	67.5	Low	113 Å²	113	130.9 Å²	130.9	69%	0.685	71%	0.713	S	S	*	*			trans	-85	25.1	175.7	-168.2	0	0	0	0	112	S118	S118-V120 PolarHBondContact O-N 3.2Å
121	F	54.3	Low	66.1	Low	183 Å²	183	129.7 Å²	129.7	80%	0.803	72%	0.72	S	S	*	*			trans	-140.3	91.8	165.6	-92.6	-85.2	0	0	0	108.9	G119 P123	G119-F121 PolarHBondContact O-N 3.34Å; F121-P123 WeakPolarHBondContact O-CD 3.33Å
122	T	52.5	Low	64.7	Low	125 Å²	125	128.6 Å²	128.6	77%	0.767	73%	0.729	S	S	*	*			trans	-69.4	115.1	153.3	52.3	0	0	0	0	107.3	R124	T122-R124 PolarHBondContact O-N 3.05Å
123	P	50.4	Low	63.4	Low	113 Å²	113	128.5 Å²	128.5	73%	0.734	74%	0.738	S	S	*	*			trans	-68.2	111.2	169.2	28.9	-29.2	0	0	0	106.4	F121 S125	F121-P123 WeakPolarHBondContact O-CD 3.33Å; P123-S125 PolarHBondContact O-N 2.95Å
124	R	54.5	Low	61.8	Low	245 Å²	245	131.6 Å²	131.6	93%	0.925	75%	0.754	S	S	*	*			trans	-60	107.4	169.8	-178.9	175.4	173.1	171.8	-2.4	107.1	T122	T122-R124 PolarHBondContact O-N 3.05Å
125	S	56.8	Low	60.4	Low	98 Å²	98	133.2 Å²	133.2	69%	0.685	77%	0.769	S	S	*	*			trans	-56.4	145	178.1	-54.5	0	0	0	0	111.2	P123 S127	P123-S125 PolarHBondContact O-N 2.95Å; S125-S127 PolarHBondContact O-N 3.49Å
126	P	61.9	Low	59	Low	130 Å²	130	134.4 Å²	134.4	84%	0.844	78%	0.78	S	S	*	*			trans	-77.1	114.4	172.7	31.5	-28.9	0	0	0	108.5	K128	P126-K128 PolarHBondContact O-N 3.34Å
127	S	50.6	Low	57.7	Low	120 Å²	120	133.8 Å²	133.8	84%	0.839	79%	0.789	S	S	*	*			trans	-81.9	113.3	171.6	47.6	0	0	0	0	110.1	S125	S125-S127 PolarHBondContact O-N 3.49Å
128	K	48.7	Very low	56.4	Low	191 Å²	191	137.6 Å²	137.6	83%	0.83	79%	0.794	S	S	*	*			trans	-86.5	164.2	160	-110.2	-177.1	-179	-175.6	0	109.4	P126	P126-K128 PolarHBondContact O-N 3.34Å
129	P	59.6	Low	55.2	Low	191 Å²	191	142.2 Å²	142.2	100%	1.24	81%	0.811	S	S	*	*			cis	-110.1	0	37.4	23.3	-4.8	0	0	0	115.7

Retrieved 129 of 129 residues in 55.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).