A0A087X3M0_POEFO Loading...

Short coiled-coil protein

Positive regulator of amino acid starvation-induced autophagy.

AlphaFold DB , UniProt , Accession A0A087X3M0, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 82 aa.

						>A0A087X3M0_POEFO|A0A087X3M0
RNQCFMAAGDLENQAELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKQK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	R	59.1	Low	62.5	Low	275 Å²	275	127.7 Å²	127.7	100%	1.038	67%	0.668	S	S	*	*				0	-36.2	0	-157.2	171.3	166.5	-177	-5.8	112.8
2	N	55.6	Low	63.6	Low	142 Å²	142	129.6 Å²	129.6	76%	0.759	67%	0.671	S	S	*	*			trans	-78.8	-25.7	-179.9	-62	-8.5	0	0	0	114.7	F5	N2-F5 PolarHBondContact O-N 3.38Å
3	Q	57.9	Low	65.1	Low	176 Å²	176	127.8 Å²	127.8	82%	0.822	66%	0.663	S	S	*	*	H	α-helix	trans	-69.8	-34	178.7	-79.8	171.7	2.1	0	0	114	F5 A7	Q3-F5 PolarHBondContact O-N 3.41Å; Q3-A7 PolarHBondContact O-N 3.39Å
4	C	59.8	Low	66.4	Low	103 Å²	103	126.8 Å²	126.8	70%	0.696	65%	0.654	S	S	*	*	H	α-helix	trans	-67.3	-25.7	175.3	-73.8	0	0	0	0	113.1	A8	C4-A8 PolarHBondContact O-N 2.94Å
5	F	59.2	Low	67.7	Low	175 Å²	175	121.9 Å²	121.9	77%	0.768	64%	0.64	S	S	*	*	H	α-helix	trans	-78	-35.4	-178.4	-128.4	-85.7	0	0	0	112	N2 Q3 G9	N2-F5 PolarHBondContact O-N 3.38Å; Q3-F5 PolarHBondContact O-N 3.41Å; F5-G9 PolarHBondContact O-N 2.89Å
6	M	61.8	Low	69.1	Low	149 Å²	149	120.1 Å²	120.1	73%	0.734	63%	0.627	S	S	*	*	H	α-helix	trans	-69.1	-42.6	173.6	-75.4	-163.1	165.4	0	0	112.1	A8 G9 D10	M6-A8 PolarHBondContact O-N 3.46Å; M6-G9 PolarHBondContact O-N 2.9Å; M6-G9 VanDerWaalsContact O-N 3.16Å; M6-D10 PolarHBondContact O-N 2.97Å; M6-D10 VanDerWaalsContact O-N 3.08Å
7	A	62.1	Low	70.3	Confident	52 Å²	52	119.2 Å²	119.2	43%	0.43	62%	0.623	S	S	.	*	H	α-helix	trans	-60.8	-32.3	176.7	0	0	0	0	0	113.1	Q3 L11	Q3-A7 PolarHBondContact O-N 3.39Å; A7-L11 WeakPolarHBondContact O-CD1 3.36Å; A7-L11 PolarHBondContact O-N 3.2Å
8	A	63.9	Low	71.6	Confident	56 Å²	56	118.1 Å²	118.1	46%	0.463	61%	0.613	S	S	.	*	H	α-helix	trans	-70.6	-39.7	176	0	0	0	0	0	112.7	C4 M6 L11 E12	C4-A8 PolarHBondContact O-N 2.94Å; M6-A8 PolarHBondContact O-N 3.46Å; A8-L11 PolarHBondContact O-N 3.02Å; A8-E12 PolarHBondContact O-N 3.26Å; A8-E12 VanDerWaalsContact O-N 3.16Å
9	G	68.1	Low	72.7	Confident	35 Å²	35	118.4 Å²	118.4	36%	0.361	61%	0.612	S	S	.	*	H	α-helix	trans	-67.6	-35.7	176.3	0	0	0	0	0	113.2	F5 M6 E12 N13	F5-G9 PolarHBondContact O-N 2.89Å; M6-G9 PolarHBondContact O-N 2.9Å; M6-G9 VanDerWaalsContact O-N 3.16Å; G9-E12 PolarHBondContact O-N 2.98Å; G9-N13 PolarHBondContact O-N 3.5Å; G9-N13 VanDerWaalsContact O-N 3.12Å
10	D	70.5	Confident	73.7	Confident	115 Å²	115	117.8 Å²	117.8	62%	0.615	60%	0.604	S	S	*	*	H	α-helix	trans	-68.1	-36.6	176.2	-67.6	-27.6	0	0	0	112.1	M6 Q14	M6-D10 PolarHBondContact O-N 2.97Å; M6-D10 VanDerWaalsContact O-N 3.08Å; D10-Q14 WeakPolarHBondContact O-CB 3.38Å; D10-Q14 PolarHBondContact O-N 3.02Å
11	L	70.2	Confident	74.7	Confident	127 Å²	127	115.3 Å²	115.3	67%	0.665	60%	0.595	S	S	*	*	H	α-helix	trans	-66.7	-38.4	174.8	-98.5	147.3	0	0	0	112.8	A7 A8 Q14 A15	A7-L11 WeakPolarHBondContact O-CD1 3.36Å; A7-L11 PolarHBondContact O-N 3.2Å; A8-L11 PolarHBondContact O-N 3.02Å; L11-Q14 PolarHBondContact O-N 2.78Å; L11-A15 PolarHBondContact O-N 3.11Å
12	E	75	Confident	76.5	Confident	150 Å²	150	110.9 Å²	110.9	70%	0.701	58%	0.578	S	S	*	*	H	α-helix	trans	-68	-41.4	177.1	-169	169.1	-163.2	0	0	111.4	A8 G9 Q14 A15 E16	A8-E12 PolarHBondContact O-N 3.26Å; A8-E12 VanDerWaalsContact O-N 3.16Å; G9-E12 PolarHBondContact O-N 2.98Å; E12-Q14 PolarHBondContact O-N 3.04Å; E12-A15 PolarHBondContact O-N 3.12Å; E12-E16 PolarHBondContact O-N 3.3Å
13	N	82.8	Confident	78.5	Confident	107 Å²	107	108.5 Å²	108.5	57%	0.572	57%	0.565	S	S	*	*	H	α-helix	trans	-67.4	-35.1	176.1	-165.6	42.6	0	0	0	112.5	G9 L17	G9-N13 PolarHBondContact O-N 3.5Å; G9-N13 VanDerWaalsContact O-N 3.12Å; N13-L17 WeakPolarHBondContact O-CB 3.34Å; N13-L17 PolarHBondContact O-N 3.5Å
14	Q	84.3	Confident	80.3	Confident	113 Å²	113	104.8 Å²	104.8	53%	0.528	55%	0.55	S	S	.	.	H	α-helix	trans	-63.5	-45.2	172.4	-174.4	87.6	23.3	0	0	111.3	D10 L11 E12 E16 L17 E18	D10-Q14 WeakPolarHBondContact O-CB 3.38Å; D10-Q14 PolarHBondContact O-N 3.02Å; L11-Q14 PolarHBondContact O-N 2.78Å; E12-Q14 PolarHBondContact O-N 3.04Å; Q14-E16 PolarHBondContact O-N 3.23Å; Q14-L17 PolarHBondContact O-N 3.38Å; Q14-E18 WeakPolarHBondContact O-CG 3.36Å; Q14-E18 PolarHBondContact O-N 2.83Å
15	A	85.7	Confident	82.1	Confident	54 Å²	54	103.9 Å²	103.9	45%	0.446	54%	0.538	S	S	.	.	H	α-helix	trans	-63.4	-41.1	178.4	0	0	0	0	0	112	L11 E12 L17 E18 E19	L11-A15 PolarHBondContact O-N 3.11Å; E12-A15 PolarHBondContact O-N 3.12Å; A15-L17 VanDerWaalsContact C-N 3.33Å; A15-L17 PolarHBondContact O-N 2.99Å; A15-E18 PolarHBondContact O-N 2.98Å; A15-E19 PolarHBondContact O-N 2.88Å
16	E	90.5	Very high	83.9	Confident	92 Å²	92	100.9 Å²	100.9	43%	0.43	53%	0.526	S	S	.	.	H	α-helix	trans	-63.3	-39.5	175.3	-167.7	-173.3	162.7	0	0	111.7	E12 Q14 E19 K20	E12-E16 PolarHBondContact O-N 3.3Å; Q14-E16 PolarHBondContact O-N 3.23Å; E16-E19 PolarHBondContact O-N 2.98Å; E16-K20 HydrophobicContact CG-CD 4.47Å; E16-K20 WeakPolarHBondContact O-CB 3.21Å; E16-K20 WeakPolarHBondContact O-CG 3.17Å; E16-K20 PolarHBondContact O-N 3.39Å; E16-K20 WeakPolarHBondContact OE1-CE 3.44Å; E16-K20 IonicContact OE1-NZ 3.92Å; E16-K20 PolarHBondContact OE1-NZ 3.22Å
17	L	89.6	Confident	85.6	Confident	106 Å²	106	97.4 Å²	97.4	56%	0.555	51%	0.513	S	S	*	.	H	α-helix	trans	-66.2	-39.8	177	-172.2	67.3	0	0	0	112	N13 Q14 A15 T21	N13-L17 WeakPolarHBondContact O-CB 3.34Å; N13-L17 PolarHBondContact O-N 3.5Å; Q14-L17 PolarHBondContact O-N 3.38Å; A15-L17 VanDerWaalsContact C-N 3.33Å; A15-L17 PolarHBondContact O-N 2.99Å; L17-T21 WeakPolarHBondContact O-CB 3.47Å; L17-T21 PolarHBondContact O-N 3.37Å; L17-T21 PolarHBondContact O-OG1 3.47Å
18	E	92.6	Very high	87.3	Confident	98 Å²	98	99.4 Å²	99.4	46%	0.458	52%	0.516	S	S	.	.	H	α-helix	trans	-65	-42.3	175.3	-74.5	178.2	-167.3	0	0	111.8	Q14 A15 T21 R22	Q14-E18 WeakPolarHBondContact O-CG 3.36Å; Q14-E18 PolarHBondContact O-N 2.83Å; A15-E18 PolarHBondContact O-N 2.98Å; E18-T21 PolarHBondContact O-N 3.39Å; E18-R22 WeakPolarHBondContact O-CG 3.48Å; E18-R22 PolarHBondContact O-N 3.23Å
19	E	93.1	Very high	88.9	Confident	124 Å²	124	103.1 Å²	103.1	58%	0.579	52%	0.524	S	S	*	.	H	α-helix	trans	-63.6	-46.5	176	-172.6	176.7	-178.6	0	0	111.5	A15 E16 T21 R22 L23	A15-E19 PolarHBondContact O-N 2.88Å; E16-E19 PolarHBondContact O-N 2.98Å; E19-T21 VanDerWaalsContact C-N 3.27Å; E19-T21 PolarHBondContact O-N 2.89Å; E19-R22 PolarHBondContact O-N 2.69Å; E19-R22 VanDerWaalsContact O-N 3.15Å; E19-L23 HydrophobicContact CG-CD1 4.4Å; E19-L23 WeakPolarHBondContact O-CG 3.32Å; E19-L23 PolarHBondContact O-N 3.36Å
20	K	93.6	Very high	90.3	Very high	107 Å²	107	106.7 Å²	106.7	47%	0.465	53%	0.534	S	S	.	.	H	α-helix	trans	-57	-42.8	173.8	-75.8	174.5	-176.3	166	0	111.5	E16 L23 I24	E16-K20 HydrophobicContact CG-CD 4.47Å; E16-K20 WeakPolarHBondContact O-CB 3.21Å; E16-K20 WeakPolarHBondContact O-CG 3.17Å; E16-K20 PolarHBondContact O-N 3.39Å; E16-K20 WeakPolarHBondContact OE1-CE 3.44Å; E16-K20 IonicContact OE1-NZ 3.92Å; E16-K20 PolarHBondContact OE1-NZ 3.22Å; K20-L23 PolarHBondContact O-N 2.93Å; K20-I24 WeakPolarHBondContact O-CD1 3.24Å; K20-I24 WeakPolarHBondContact O-CG1 3.37Å; K20-I24 PolarHBondContact O-N 3.5Å
21	T	94	Very high	91.6	Very high	66 Å²	66	106.1 Å²	106.1	41%	0.405	53%	0.528	S	S	.	.	H	α-helix	trans	-63.9	-41.5	178	-57.3	0	0	0	0	111.6	L17 E18 E19 I24 N25	L17-T21 WeakPolarHBondContact O-CB 3.47Å; L17-T21 PolarHBondContact O-N 3.37Å; L17-T21 PolarHBondContact O-OG1 3.47Å; E18-T21 PolarHBondContact O-N 3.39Å; E19-T21 VanDerWaalsContact C-N 3.27Å; E19-T21 PolarHBondContact O-N 2.89Å; T21-I24 PolarHBondContact O-N 3.37Å; T21-N25 PolarHBondContact O-N 3.27Å; T21-N25 PolarHBondContact O-ND2 2.98Å
22	R	96.8	Very high	92.8	Very high	182 Å²	182	105.4 Å²	105.4	69%	0.687	52%	0.521	S	S	*	.	H	α-helix	trans	-62.5	-44.8	175.2	-72.9	-179.2	-170.7	-165.4	5.4	112.2	E18 E19 N25 Q26	E18-R22 WeakPolarHBondContact O-CG 3.48Å; E18-R22 PolarHBondContact O-N 3.23Å; E19-R22 PolarHBondContact O-N 2.69Å; E19-R22 VanDerWaalsContact O-N 3.15Å; R22-N25 PolarHBondContact O-N 3.23Å; R22-Q26 PolarHBondContact O-N 3.41Å
23	L	97.1	Very high	93.8	Very high	91 Å²	91	102.4 Å²	102.4	48%	0.476	51%	0.513	S	S	.	.	H	α-helix	trans	-63.2	-41.7	177.7	-70.8	172.9	0	0	0	111.7	E19 K20 N25 Q26 V27	E19-L23 HydrophobicContact CG-CD1 4.4Å; E19-L23 WeakPolarHBondContact O-CG 3.32Å; E19-L23 PolarHBondContact O-N 3.36Å; K20-L23 PolarHBondContact O-N 2.93Å; L23-N25 VanDerWaalsContact C-N 3.35Å; L23-N25 PolarHBondContact O-N 3.45Å; L23-Q26 PolarHBondContact O-N 3.35Å; L23-V27 WeakPolarHBondContact O-CG2 3.45Å; L23-V27 PolarHBondContact O-N 3.48Å
24	I	96.1	Very high	94.6	Very high	99 Å²	99	102.9 Å²	102.9	51%	0.508	52%	0.515	S	S	.	.	H	α-helix	trans	-59.3	-47.3	175.4	-70.6	163.7	0	0	0	110.4	K20 T21 Q26 V27 L28	K20-I24 WeakPolarHBondContact O-CD1 3.24Å; K20-I24 WeakPolarHBondContact O-CG1 3.37Å; K20-I24 PolarHBondContact O-N 3.5Å; T21-I24 PolarHBondContact O-N 3.37Å; I24-Q26 VanDerWaalsContact C-N 3.33Å; I24-Q26 PolarHBondContact O-N 2.95Å; I24-V27 PolarHBondContact O-N 2.93Å; I24-L28 HydrophobicContact CG2-CD1 3.96Å; I24-L28 HydrophobicContact CG2-CG 4.37Å; I24-L28 WeakPolarHBondContact O-CG 3.32Å; I24-L28 PolarHBondContact O-N 3.29Å
25	N	96.6	Very high	95.2	Very high	83 Å²	83	104.2 Å²	104.2	44%	0.444	52%	0.521	S	S	.	.	H	α-helix	trans	-61	-42.6	178.3	-71.3	-27	0	0	0	111.9	T21 R22 L23 V27 L28 E29	T21-N25 PolarHBondContact O-N 3.27Å; T21-N25 PolarHBondContact O-ND2 2.98Å; R22-N25 PolarHBondContact O-N 3.23Å; L23-N25 VanDerWaalsContact C-N 3.35Å; L23-N25 PolarHBondContact O-N 3.45Å; N25-V27 VanDerWaalsContact C-N 3.33Å; N25-V27 PolarHBondContact O-N 3.06Å; N25-L28 PolarHBondContact O-N 3.16Å; N25-E29 WeakPolarHBondContact O-CG 3.46Å; N25-E29 PolarHBondContact O-N 2.97Å
26	Q	97.5	Very high	95.8	Very high	112 Å²	112	105.6 Å²	105.6	52%	0.523	52%	0.521	S	S	.	.	H	α-helix	trans	-62.8	-40.6	176.7	-171.4	178.6	7.9	0	0	112.1	R22 L23 I24 E29 L30	R22-Q26 PolarHBondContact O-N 3.41Å; L23-Q26 PolarHBondContact O-N 3.35Å; I24-Q26 VanDerWaalsContact C-N 3.33Å; I24-Q26 PolarHBondContact O-N 2.95Å; Q26-E29 PolarHBondContact O-N 2.91Å; Q26-L30 HydrophobicContact CG-CD1 4.39Å; Q26-L30 VanDerWaalsContact O-CG 3.29Å; Q26-L30 WeakPolarHBondContact O-CG 3.45Å; Q26-L30 PolarHBondContact O-N 3.01Å; Q26-L30 VanDerWaalsContact O-N 3.08Å
27	V	97.4	Very high	96.1	Very high	77 Å²	77	105.7 Å²	105.7	47%	0.467	52%	0.524	S	S	.	.	H	α-helix	trans	-63.8	-42.1	175.6	170.3	0	0	0	0	110.9	L23 I24 N25 L30 Q31	L23-V27 WeakPolarHBondContact O-CG2 3.45Å; L23-V27 PolarHBondContact O-N 3.48Å; I24-V27 PolarHBondContact O-N 2.93Å; N25-V27 VanDerWaalsContact C-N 3.33Å; N25-V27 PolarHBondContact O-N 3.06Å; V27-L30 PolarHBondContact O-N 3.28Å; V27-Q31 HydrophobicContact CG1-CG 4.39Å; V27-Q31 WeakPolarHBondContact O-CB 3.37Å; V27-Q31 VanDerWaalsContact O-CG 3.31Å; V27-Q31 WeakPolarHBondContact O-CG 3.33Å; V27-Q31 PolarHBondContact O-N 3.22Å
28	L	97.4	Very high	96.5	Very high	94 Å²	94	103.7 Å²	103.7	49%	0.492	52%	0.519	S	S	.	.	H	α-helix	trans	-63.8	-42.6	178.3	-71.1	172.5	0	0	0	112.2	I24 N25 L30 Q31 H32	I24-L28 HydrophobicContact CG2-CD1 3.96Å; I24-L28 HydrophobicContact CG2-CG 4.37Å; I24-L28 WeakPolarHBondContact O-CG 3.32Å; I24-L28 PolarHBondContact O-N 3.29Å; N25-L28 PolarHBondContact O-N 3.16Å; L28-L30 VanDerWaalsContact C-N 3.35Å; L28-L30 PolarHBondContact O-N 2.98Å; L28-Q31 PolarHBondContact O-N 3.37Å; L28-H32 PolarHBondContact O-N 3Å
29	E	97.2	Very high	96.8	Very high	134 Å²	134	102 Å²	102	63%	0.626	52%	0.521	S	S	*	.	H	α-helix	trans	-62.6	-41.8	175.9	-73.1	174.6	-175	0	0	112	N25 Q26 H32 T33	N25-E29 WeakPolarHBondContact O-CG 3.46Å; N25-E29 PolarHBondContact O-N 2.97Å; Q26-E29 PolarHBondContact O-N 2.91Å; E29-H32 PolarHBondContact O-N 3.42Å; E29-T33 WeakPolarHBondContact O-CB 3.43Å; E29-T33 PolarHBondContact O-N 3.36Å; E29-T33 PolarHBondContact O-OG1 3.47Å
30	L	97.9	Very high	97	Very high	110 Å²	110	104.6 Å²	104.6	58%	0.576	53%	0.526	S	S	*	.	H	α-helix	trans	-65.6	-40.1	176	-72.5	172.8	0	0	0	111.8	Q26 V27 L28 T33 L34	Q26-L30 HydrophobicContact CG-CD1 4.39Å; Q26-L30 VanDerWaalsContact O-CG 3.29Å; Q26-L30 WeakPolarHBondContact O-CG 3.45Å; Q26-L30 PolarHBondContact O-N 3.01Å; Q26-L30 VanDerWaalsContact O-N 3.08Å; V27-L30 PolarHBondContact O-N 3.28Å; L28-L30 VanDerWaalsContact C-N 3.35Å; L28-L30 PolarHBondContact O-N 2.98Å; L30-T33 PolarHBondContact O-N 3.31Å; L30-L34 VanDerWaalsContact O-CB 3.32Å; L30-L34 WeakPolarHBondContact O-CB 3.48Å; L30-L34 PolarHBondContact O-N 3Å
31	Q	97.4	Very high	97.2	Very high	102 Å²	102	102.5 Å²	102.5	48%	0.477	52%	0.522	S	S	.	.	H	α-helix	trans	-61.7	-47.7	175.8	-77.6	176.3	-18.3	0	0	111.3	V27 L28 T33 L34 E35	V27-Q31 HydrophobicContact CG1-CG 4.39Å; V27-Q31 WeakPolarHBondContact O-CB 3.37Å; V27-Q31 VanDerWaalsContact O-CG 3.31Å; V27-Q31 WeakPolarHBondContact O-CG 3.33Å; V27-Q31 PolarHBondContact O-N 3.22Å; L28-Q31 PolarHBondContact O-N 3.37Å; Q31-T33 VanDerWaalsContact C-N 3.35Å; Q31-T33 PolarHBondContact O-N 3.37Å; Q31-L34 PolarHBondContact O-N 3.26Å; Q31-E35 WeakPolarHBondContact O-CG 3.31Å; Q31-E35 PolarHBondContact O-N 2.95Å
32	H	96.3	Very high	97.4	Very high	112 Å²	112	103.2 Å²	103.2	52%	0.519	52%	0.523	S	S	.	.	H	α-helix	trans	-58.9	-46.3	176	-172.8	-61.3	0	0	0	111.7	L28 E29 L34 E35 D36	L28-H32 PolarHBondContact O-N 3Å; E29-H32 PolarHBondContact O-N 3.42Å; H32-L34 VanDerWaalsContact C-N 3.28Å; H32-L34 PolarHBondContact O-N 3.33Å; H32-E35 PolarHBondContact O-N 2.94Å; H32-D36 IonicContact CE1-OD1 3.03Å; H32-D36 IonicContact CE1-OD2 3.74Å; H32-D36 PolarHBondContact CE1-OD2 3.04Å; H32-D36 IonicContact ND1-OD1 2.89Å; H32-D36 IonicContact ND1-OD2 3.66Å; H32-D36 PolarHBondContact ND1-OD2 3.14Å; H32-D36 PolarHBondContact O-N 3.44Å
33	T	97.1	Very high	97.5	Very high	88 Å²	88	97.2 Å²	97.2	54%	0.54	51%	0.513	S	S	.	.	H	α-helix	trans	-62.1	-38.7	178.9	-56.2	0	0	0	0	111.7	E29 L30 Q31 L37	E29-T33 WeakPolarHBondContact O-CB 3.43Å; E29-T33 PolarHBondContact O-N 3.36Å; E29-T33 PolarHBondContact O-OG1 3.47Å; L30-T33 PolarHBondContact O-N 3.31Å; Q31-T33 VanDerWaalsContact C-N 3.35Å; Q31-T33 PolarHBondContact O-N 3.37Å; T33-L37 WeakPolarHBondContact O-CB 3.39Å; T33-L37 PolarHBondContact O-N 3.35Å
34	L	97.8	Very high	97.6	Very high	117 Å²	117	97.3 Å²	97.3	61%	0.613	52%	0.517	S	S	*	.	H	α-helix	trans	-68.5	-41.5	178.1	-177.6	63.7	0	0	0	111.7	L30 Q31 H32 L37 S38	L30-L34 VanDerWaalsContact O-CB 3.32Å; L30-L34 WeakPolarHBondContact O-CB 3.48Å; L30-L34 PolarHBondContact O-N 3Å; Q31-L34 PolarHBondContact O-N 3.26Å; H32-L34 VanDerWaalsContact C-N 3.28Å; H32-L34 PolarHBondContact O-N 3.33Å; L34-L37 PolarHBondContact O-N 2.92Å; L34-S38 WeakPolarHBondContact O-CB 3.48Å; L34-S38 PolarHBondContact O-N 3.03Å
35	E	97.7	Very high	97.7	Very high	140 Å²	140	98.3 Å²	98.3	65%	0.654	52%	0.517	S	S	*	.	H	α-helix	trans	-60.4	-48.2	175.2	-77	179	179.2	0	0	111.3	Q31 H32 L37 S38 A39	Q31-E35 WeakPolarHBondContact O-CG 3.31Å; Q31-E35 PolarHBondContact O-N 2.95Å; H32-E35 PolarHBondContact O-N 2.94Å; E35-L37 VanDerWaalsContact C-N 3.3Å; E35-L37 PolarHBondContact O-N 2.96Å; E35-S38 WeakPolarHBondContact O-CB 3.1Å; E35-S38 PolarHBondContact O-N 3.36Å; E35-A39 PolarHBondContact O-N 3.47Å
36	D	97.7	Very high	97.7	Very high	83 Å²	83	99.3 Å²	99.3	44%	0.444	52%	0.52	S	S	.	.	H	α-helix	trans	-58.2	-43.5	175.9	-72.4	-27.6	0	0	0	111.8	H32 A39 R40	H32-D36 IonicContact CE1-OD1 3.03Å; H32-D36 IonicContact CE1-OD2 3.74Å; H32-D36 PolarHBondContact CE1-OD2 3.04Å; H32-D36 IonicContact ND1-OD1 2.89Å; H32-D36 IonicContact ND1-OD2 3.66Å; H32-D36 PolarHBondContact ND1-OD2 3.14Å; H32-D36 PolarHBondContact O-N 3.44Å; D36-A39 PolarHBondContact O-N 3.17Å; D36-R40 VanDerWaalsContact O-CG 3.29Å; D36-R40 WeakPolarHBondContact O-CG 3.4Å; D36-R40 PolarHBondContact O-N 2.89Å
37	L	97.8	Very high	97.7	Very high	95 Å²	95	99.8 Å²	99.8	50%	0.497	52%	0.522	S	S	.	.	H	α-helix	trans	-66.6	-40.8	178.5	-175.5	61.3	0	0	0	111.3	T33 L34 E35 R40 V41	T33-L37 WeakPolarHBondContact O-CB 3.39Å; T33-L37 PolarHBondContact O-N 3.35Å; L34-L37 PolarHBondContact O-N 2.92Å; E35-L37 VanDerWaalsContact C-N 3.3Å; E35-L37 PolarHBondContact O-N 2.96Å; L37-R40 PolarHBondContact O-N 2.99Å; L37-V41 WeakPolarHBondContact O-CG2 3.47Å; L37-V41 PolarHBondContact O-N 3.29Å
38	S	97.8	Very high	97.8	Very high	63 Å²	63	99.7 Å²	99.7	44%	0.441	52%	0.518	S	S	.	.	H	α-helix	trans	-60.7	-47.8	176.4	-167.4	0	0	0	0	111	L34 E35 R40 V41 D42	L34-S38 WeakPolarHBondContact O-CB 3.48Å; L34-S38 PolarHBondContact O-N 3.03Å; E35-S38 WeakPolarHBondContact O-CB 3.1Å; E35-S38 PolarHBondContact O-N 3.36Å; S38-R40 VanDerWaalsContact C-N 3.31Å; S38-R40 PolarHBondContact O-N 3.04Å; S38-V41 WeakPolarHBondContact O-CB 3.4Å; S38-V41 PolarHBondContact O-N 3.14Å; S38-V41 VanDerWaalsContact O-N 3.14Å; S38-D42 PolarHBondContact O-N 2.93Å
39	A	97.9	Very high	97.8	Very high	62 Å²	62	100.8 Å²	100.8	51%	0.512	52%	0.524	S	S	.	.	H	α-helix	trans	-59.8	-41.4	177.3	0	0	0	0	0	112	E35 D36 D42 A43	E35-A39 PolarHBondContact O-N 3.47Å; D36-A39 PolarHBondContact O-N 3.17Å; A39-D42 PolarHBondContact O-N 2.92Å; A39-A43 PolarHBondContact O-N 3.03Å
40	R	98.3	Very high	97.9	Very high	179 Å²	179	100.3 Å²	100.3	68%	0.675	52%	0.52	S	S	*	.	H	α-helix	trans	-64.6	-40.3	175.4	-73	174.4	65.9	-171	0.4	112.4	D36 L37 S38 D42 A43 V44	D36-R40 VanDerWaalsContact O-CG 3.29Å; D36-R40 WeakPolarHBondContact O-CG 3.4Å; D36-R40 PolarHBondContact O-N 2.89Å; L37-R40 PolarHBondContact O-N 2.99Å; S38-R40 VanDerWaalsContact C-N 3.31Å; S38-R40 PolarHBondContact O-N 3.04Å; R40-D42 VanDerWaalsContact C-N 3.33Å; R40-A43 PolarHBondContact O-N 3.37Å; R40-V44 VanDerWaalsContact O-CG2 3.31Å; R40-V44 WeakPolarHBondContact O-CG2 3.34Å; R40-V44 PolarHBondContact O-N 3.46Å
41	V	98.5	Very high	97.9	Very high	63 Å²	63	99 Å²	99	38%	0.382	51%	0.513	S	S	.	.	H	α-helix	trans	-62.4	-43	176	165.7	0	0	0	0	110.6	L37 S38 V44 K45	L37-V41 WeakPolarHBondContact O-CG2 3.47Å; L37-V41 PolarHBondContact O-N 3.29Å; S38-V41 WeakPolarHBondContact O-CB 3.4Å; S38-V41 PolarHBondContact O-N 3.14Å; S38-V41 VanDerWaalsContact O-N 3.14Å; V41-V44 PolarHBondContact O-N 2.86Å; V41-K45 HydrophobicContact CG1-CD 4.16Å; V41-K45 HydrophobicContact CG1-CG 4.49Å; V41-K45 WeakPolarHBondContact O-CG 3.29Å; V41-K45 PolarHBondContact O-N 3.33Å
42	D	97.9	Very high	97.9	Very high	82 Å²	82	100.3 Å²	100.3	44%	0.439	52%	0.517	S	S	.	.	H	α-helix	trans	-66.5	-40.6	179.3	-68.3	-26.4	0	0	0	111.9	S38 A39 R40 V44 K45 E46	S38-D42 PolarHBondContact O-N 2.93Å; A39-D42 PolarHBondContact O-N 2.92Å; R40-D42 VanDerWaalsContact C-N 3.33Å; D42-V44 PolarHBondContact O-N 2.99Å; D42-K45 PolarHBondContact O-N 3.37Å; D42-K45 IonicContact OD1-NZ 2.63Å; D42-E46 PolarHBondContact O-N 3.48Å
43	A	97.9	Very high	98	Very high	56 Å²	56	98.1 Å²	98.1	46%	0.463	52%	0.515	S	S	.	.	H	α-helix	trans	-59.6	-45.7	173	0	0	0	0	0	112.4	A39 R40 K45 E46 E47	A39-A43 PolarHBondContact O-N 3.03Å; R40-A43 PolarHBondContact O-N 3.37Å; A43-K45 VanDerWaalsContact C-N 3.34Å; A43-K45 PolarHBondContact O-N 3.21Å; A43-E46 PolarHBondContact O-N 2.92Å; A43-E47 PolarHBondContact O-N 2.85Å
44	V	98.4	Very high	98	Very high	93 Å²	93	99.4 Å²	99.4	56%	0.564	52%	0.515	S	S	*	.	H	α-helix	trans	-64.4	-38.9	177.5	170.8	0	0	0	0	111.4	R40 V41 D42 N48	R40-V44 VanDerWaalsContact O-CG2 3.31Å; R40-V44 WeakPolarHBondContact O-CG2 3.34Å; R40-V44 PolarHBondContact O-N 3.46Å; V41-V44 PolarHBondContact O-N 2.86Å; D42-V44 PolarHBondContact O-N 2.99Å; V44-N48 WeakPolarHBondContact O-CB 3.46Å; V44-N48 PolarHBondContact O-N 3.29Å
45	K	98.2	Very high	98	Very high	119 Å²	119	98.9 Å²	98.9	52%	0.517	51%	0.513	S	S	.	.	H	α-helix	trans	-62.7	-43.9	175.1	-76.2	173.1	-176.8	166.1	0	111.4	V41 D42 A43 N48 L49	V41-K45 HydrophobicContact CG1-CD 4.16Å; V41-K45 HydrophobicContact CG1-CG 4.49Å; V41-K45 WeakPolarHBondContact O-CG 3.29Å; V41-K45 PolarHBondContact O-N 3.33Å; D42-K45 PolarHBondContact O-N 3.37Å; D42-K45 IonicContact OD1-NZ 2.63Å; A43-K45 VanDerWaalsContact C-N 3.34Å; A43-K45 PolarHBondContact O-N 3.21Å; K45-N48 PolarHBondContact O-N 2.9Å; K45-L49 WeakPolarHBondContact O-CG 3.34Å; K45-L49 PolarHBondContact O-N 3.34Å
46	E	98.1	Very high	98	Very high	105 Å²	105	99.1 Å²	99.1	49%	0.491	51%	0.514	S	S	.	.	H	α-helix	trans	-62.6	-46.2	178.7	-167.6	-170.4	152.1	0	0	111.6	D42 A43 N48 L49 K50	D42-E46 PolarHBondContact O-N 3.48Å; A43-E46 PolarHBondContact O-N 2.92Å; E46-N48 VanDerWaalsContact C-N 3.33Å; E46-N48 PolarHBondContact O-N 3.49Å; E46-L49 PolarHBondContact O-N 2.97Å; E46-K50 PolarHBondContact O-N 3.4Å; E46-K50 VanDerWaalsContact OE1-CE 3.24Å; E46-K50 WeakPolarHBondContact OE1-CE 3.48Å; E46-K50 IonicContact OE1-NZ 2.69Å; E46-K50 PolarHBondContact OE1-NZ 2.91Å
47	E	97.8	Very high	98	Very high	121 Å²	121	99.9 Å²	99.9	57%	0.565	52%	0.521	S	S	*	.	H	α-helix	trans	-60.5	-43	175.7	-173	177.7	-170	0	0	111.6	A43 L49 K50 L51	A43-E47 PolarHBondContact O-N 2.85Å; E47-L49 VanDerWaalsContact C-N 3.31Å; E47-L49 PolarHBondContact O-N 3.43Å; E47-K50 PolarHBondContact O-N 2.92Å; E47-L51 HydrophobicContact CG-CD1 4.35Å; E47-L51 WeakPolarHBondContact O-CG 3.31Å; E47-L51 PolarHBondContact O-N 2.97Å
48	N	98.1	Very high	98	Very high	75 Å²	75	99.3 Å²	99.3	40%	0.401	52%	0.518	S	S	.	.	H	α-helix	trans	-61.1	-39.6	176.9	-167.7	-99	0	0	0	112.5	V44 K45 E46 L51 K52	V44-N48 WeakPolarHBondContact O-CB 3.46Å; V44-N48 PolarHBondContact O-N 3.29Å; K45-N48 PolarHBondContact O-N 2.9Å; E46-N48 VanDerWaalsContact C-N 3.33Å; E46-N48 PolarHBondContact O-N 3.49Å; N48-L51 PolarHBondContact O-N 3.32Å; N48-K52 WeakPolarHBondContact O-CB 3.47Å; N48-K52 WeakPolarHBondContact O-CG 3.43Å; N48-K52 PolarHBondContact O-N 3.23Å; N48-K52 WeakPolarHBondContact OD1-CE 3.33Å; N48-K52 PolarHBondContact OD1-NZ 3.49Å; N48-K52 VanDerWaalsContact OD1-NZ 3.14Å
49	L	98.2	Very high	97.9	Very high	117 Å²	117	97.6 Å²	97.6	61%	0.613	51%	0.51	S	S	*	.	H	α-helix	trans	-64.9	-42.3	176.3	-73.1	173.2	0	0	0	111.7	K45 E46 E47 K52 S53	K45-L49 WeakPolarHBondContact O-CG 3.34Å; K45-L49 PolarHBondContact O-N 3.34Å; E46-L49 PolarHBondContact O-N 2.97Å; E47-L49 VanDerWaalsContact C-N 3.31Å; E47-L49 PolarHBondContact O-N 3.43Å; L49-K52 PolarHBondContact O-N 2.75Å; L49-S53 PolarHBondContact O-N 3.4Å
50	K	98.1	Very high	97.8	Very high	125 Å²	125	99 Å²	99	54%	0.543	51%	0.507	S	S	.	.	H	α-helix	trans	-59.6	-49	175.2	-71.4	173.9	-175.5	165.2	0	111.2	E46 E47 K52 S53 E54	E46-K50 PolarHBondContact O-N 3.4Å; E46-K50 VanDerWaalsContact OE1-CE 3.24Å; E46-K50 WeakPolarHBondContact OE1-CE 3.48Å; E46-K50 IonicContact OE1-NZ 2.69Å; E46-K50 PolarHBondContact OE1-NZ 2.91Å; E47-K50 PolarHBondContact O-N 2.92Å; K50-K52 VanDerWaalsContact C-N 3.35Å; K50-K52 PolarHBondContact O-N 3.03Å; K50-S53 WeakPolarHBondContact O-CB 3.46Å; K50-S53 PolarHBondContact O-N 3.35Å; K50-S53 VanDerWaalsContact O-N 3.16Å; K50-E54 PolarHBondContact O-N 3.08Å
51	L	98.3	Very high	97.6	Very high	83 Å²	83	97.3 Å²	97.3	44%	0.435	50%	0.501	S	S	.	.	H	α-helix	trans	-61.6	-40.4	177.9	-71	172.8	0	0	0	112.6	E47 N48 S53 E54 N55	E47-L51 HydrophobicContact CG-CD1 4.35Å; E47-L51 WeakPolarHBondContact O-CG 3.31Å; E47-L51 PolarHBondContact O-N 2.97Å; N48-L51 PolarHBondContact O-N 3.32Å; L51-S53 VanDerWaalsContact C-N 3.34Å; L51-E54 PolarHBondContact O-N 3.21Å; L51-N55 WeakPolarHBondContact O-CB 3.4Å; L51-N55 PolarHBondContact O-N 2.94Å; L51-N55 PolarHBondContact O-ND2 3.44Å
52	K	98	Very high	97.3	Very high	128 Å²	128	98.8 Å²	98.8	56%	0.557	51%	0.506	S	S	*	.	H	α-helix	trans	-62.4	-42	174.8	-79.7	177.5	177.1	167.6	0	112	N48 L49 K50 Q56	N48-K52 WeakPolarHBondContact O-CB 3.47Å; N48-K52 WeakPolarHBondContact O-CG 3.43Å; N48-K52 PolarHBondContact O-N 3.23Å; N48-K52 WeakPolarHBondContact OD1-CE 3.33Å; N48-K52 PolarHBondContact OD1-NZ 3.49Å; N48-K52 VanDerWaalsContact OD1-NZ 3.14Å; L49-K52 PolarHBondContact O-N 2.75Å; K50-K52 VanDerWaalsContact C-N 3.35Å; K50-K52 PolarHBondContact O-N 3.03Å; K52-Q56 WeakPolarHBondContact O-CB 3.32Å; K52-Q56 PolarHBondContact O-N 3.42Å
53	S	98	Very high	97	Very high	67 Å²	67	99.6 Å²	99.6	47%	0.469	51%	0.507	S	S	.	.	H	α-helix	trans	-64.2	-44.4	177	-177.9	0	0	0	0	111.6	L49 K50 L51 Q56 V57	L49-S53 PolarHBondContact O-N 3.4Å; K50-S53 WeakPolarHBondContact O-CB 3.46Å; K50-S53 PolarHBondContact O-N 3.35Å; K50-S53 VanDerWaalsContact O-N 3.16Å; L51-S53 VanDerWaalsContact C-N 3.34Å; S53-Q56 WeakPolarHBondContact O-CB 3.22Å; S53-Q56 PolarHBondContact O-N 2.93Å; S53-V57 WeakPolarHBondContact O-CG2 3.34Å; S53-V57 PolarHBondContact O-N 3Å; S53-V57 VanDerWaalsContact O-N 3.11Å
54	E	97.7	Very high	96.6	Very high	115 Å²	115	101.1 Å²	101.1	54%	0.537	51%	0.507	S	S	.	.	H	α-helix	trans	-62.9	-47.2	176.9	-173.4	175.3	178.2	0	0	111.5	K50 L51 Q56 V57 L58	K50-E54 PolarHBondContact O-N 3.08Å; L51-E54 PolarHBondContact O-N 3.21Å; E54-Q56 VanDerWaalsContact C-N 3.25Å; E54-Q56 PolarHBondContact O-N 3.29Å; E54-V57 PolarHBondContact O-N 3.48Å; E54-V57 VanDerWaalsContact O-N 3.12Å; E54-L58 HydrophobicContact CG-CD1 4.07Å; E54-L58 HydrophobicContact CG-CG 4.41Å; E54-L58 WeakPolarHBondContact O-CG 3.29Å; E54-L58 PolarHBondContact O-N 3.3Å
55	N	97.6	Very high	96.1	Very high	106 Å²	106	101 Å²	101	57%	0.567	50%	0.503	S	S	*	.	H	α-helix	trans	-60	-35.7	176.5	-79	-25.2	0	0	0	112.6	L51 G59	L51-N55 WeakPolarHBondContact O-CB 3.4Å; L51-N55 PolarHBondContact O-N 2.94Å; L51-N55 PolarHBondContact O-ND2 3.44Å; N55-G59 PolarHBondContact O-N 2.98Å
56	Q	97.6	Very high	95.5	Very high	144 Å²	144	99.2 Å²	99.2	67%	0.673	50%	0.497	S	S	*	.	H	α-helix	trans	-64.6	-45.8	175.1	-176.6	-178.5	-2.5	0	0	111.4	K52 S53 E54 G59 Q60	K52-Q56 WeakPolarHBondContact O-CB 3.32Å; K52-Q56 PolarHBondContact O-N 3.42Å; S53-Q56 WeakPolarHBondContact O-CB 3.22Å; S53-Q56 PolarHBondContact O-N 2.93Å; E54-Q56 VanDerWaalsContact C-N 3.25Å; E54-Q56 PolarHBondContact O-N 3.29Å; Q56-G59 PolarHBondContact O-N 2.93Å; Q56-Q60 PolarHBondContact O-N 3.47Å
57	V	97.6	Very high	94.7	Very high	99 Å²	99	98 Å²	98	60%	0.6	50%	0.5	S	S	*	.	H	α-helix	trans	-63.6	-44.9	178.2	173.7	0	0	0	0	110.8	S53 E54 Q60 Y61	S53-V57 WeakPolarHBondContact O-CG2 3.34Å; S53-V57 PolarHBondContact O-N 3Å; S53-V57 VanDerWaalsContact O-N 3.11Å; E54-V57 PolarHBondContact O-N 3.48Å; E54-V57 VanDerWaalsContact O-N 3.12Å; V57-Q60 PolarHBondContact O-N 3.25Å; V57-Y61 PolarHBondContact O-N 3.42Å
58	L	97.3	Very high	93.9	Very high	83 Å²	83	96.5 Å²	96.5	44%	0.435	51%	0.509	S	S	.	.	H	α-helix	trans	-63	-42.4	176.4	-68.5	175.4	0	0	0	111.8	E54 Q60 Y61 I62	E54-L58 HydrophobicContact CG-CD1 4.07Å; E54-L58 HydrophobicContact CG-CG 4.41Å; E54-L58 WeakPolarHBondContact O-CG 3.29Å; E54-L58 PolarHBondContact O-N 3.3Å; L58-Q60 PolarHBondContact O-N 3.06Å; L58-Y61 WeakPolarHBondContact O-CB 3.41Å; L58-Y61 PolarHBondContact O-N 3.15Å; L58-I62 WeakPolarHBondContact O-CG1 3.46Å; L58-I62 PolarHBondContact O-N 3.33Å
59	G	95.7	Very high	92.6	Very high	27 Å²	27	95.1 Å²	95.1	28%	0.278	51%	0.505	S	S	.	.	H	α-helix	trans	-57.7	-48.7	175.3	0	0	0	0	0	111.9	N55 Q56 Y61 I62 E63	N55-G59 PolarHBondContact O-N 2.98Å; Q56-G59 PolarHBondContact O-N 2.93Å; G59-Y61 VanDerWaalsContact C-N 3.32Å; G59-Y61 PolarHBondContact O-N 2.93Å; G59-I62 PolarHBondContact O-N 3.34Å; G59-E63 WeakPolarHBondContact O-CG 3.44Å; G59-E63 PolarHBondContact O-N 2.94Å
60	Q	95.9	Very high	90.8	Very high	93 Å²	93	93.9 Å²	93.9	44%	0.435	51%	0.507	S	S	.	.	H	α-helix	trans	-62.6	-39	176.9	-170.8	63.7	71.4	0	0	112.3	Q56 V57 L58 I62 E63 N64	Q56-Q60 PolarHBondContact O-N 3.47Å; V57-Q60 PolarHBondContact O-N 3.25Å; L58-Q60 PolarHBondContact O-N 3.06Å; Q60-I62 VanDerWaalsContact C-N 3.34Å; Q60-I62 PolarHBondContact O-N 3.29Å; Q60-E63 PolarHBondContact NE2-OE2 2.63Å; Q60-E63 PolarHBondContact O-N 2.98Å; Q60-N64 PolarHBondContact NE2-OD1 3.02Å; Q60-N64 WeakPolarHBondContact O-CB 3.33Å; Q60-N64 PolarHBondContact O-N 3.03Å; Q60-N64 PolarHBondContact O-ND2 3.5Å; Q60-N64 PolarHBondContact O-OD1 2.95Å
61	Y	95.3	Very high	89	Confident	142 Å²	142	93 Å²	93	56%	0.557	51%	0.512	S	S	*	.	H	α-helix	trans	-61.5	-44.1	176.8	-179.5	-108.7	0	0	0	111.4	V57 L58 G59 N64 L65	V57-Y61 PolarHBondContact O-N 3.42Å; L58-Y61 WeakPolarHBondContact O-CB 3.41Å; L58-Y61 PolarHBondContact O-N 3.15Å; G59-Y61 VanDerWaalsContact C-N 3.32Å; G59-Y61 PolarHBondContact O-N 2.93Å; Y61-N64 PolarHBondContact O-N 3.48Å; Y61-L65 HydrophobicContact CD1-CD1 3.94Å; Y61-L65 HydrophobicContact CE1-CD1 3.42Å; Y61-L65 VanDerWaalsContact CE1-CD1 3.42Å; Y61-L65 HydrophobicContact CE1-CG 4.24Å; Y61-L65 HydrophobicContact CE2-CD1 4.41Å; Y61-L65 HydrophobicContact CE2-CG 4.43Å; Y61-L65 WeakPolarHBondContact O-CG 3.46Å; Y61-L65 PolarHBondContact O-N 3.06Å
62	I	91.4	Very high	86.9	Confident	94 Å²	94	95.2 Å²	95.2	48%	0.482	52%	0.518	S	S	.	.	H	α-helix	trans	-63.3	-46.1	175.9	-65.9	164.6	0	0	0	110.7	L58 G59 Q60 N64 L65 M66	L58-I62 WeakPolarHBondContact O-CG1 3.46Å; L58-I62 PolarHBondContact O-N 3.33Å; G59-I62 PolarHBondContact O-N 3.34Å; Q60-I62 VanDerWaalsContact C-N 3.34Å; Q60-I62 PolarHBondContact O-N 3.29Å; I62-N64 VanDerWaalsContact C-N 3.31Å; I62-N64 PolarHBondContact O-N 3.49Å; I62-L65 PolarHBondContact O-N 3.29Å; I62-M66 HydrophobicContact CG2-CE 3.95Å; I62-M66 HydrophobicContact CG2-CG 4.38Å; I62-M66 HydrophobicContact CG2-SD 4.23Å; I62-M66 WeakPolarHBondContact O-CG 3.17Å; I62-M66 PolarHBondContact O-N 3.35Å
63	E	91.5	Very high	84.9	Confident	99 Å²	99	95 Å²	95	46%	0.463	52%	0.519	S	S	.	.	H	α-helix	trans	-58.3	-42.4	176.4	-75	176.6	-173.2	0	0	112.7	G59 Q60 L65 M66 S67	G59-E63 WeakPolarHBondContact O-CG 3.44Å; G59-E63 PolarHBondContact O-N 2.94Å; Q60-E63 PolarHBondContact NE2-OE2 2.63Å; Q60-E63 PolarHBondContact O-N 2.98Å; E63-L65 VanDerWaalsContact C-N 3.35Å; E63-M66 HydrophobicContact CG-CE 4.31Å; E63-M66 PolarHBondContact O-N 3.28Å; E63-S67 WeakPolarHBondContact O-CB 3.42Å; E63-S67 PolarHBondContact O-N 3.43Å; E63-S67 PolarHBondContact O-OG 3.25Å
64	N	89.6	Confident	82.6	Confident	89 Å²	89	96.9 Å²	96.9	48%	0.476	53%	0.528	S	S	.	.	H	α-helix	trans	-65	-40.8	178.1	-70.6	-10.4	0	0	0	111.2	Q60 Y61 I62 S67 A68	Q60-N64 PolarHBondContact NE2-OD1 3.02Å; Q60-N64 WeakPolarHBondContact O-CB 3.33Å; Q60-N64 PolarHBondContact O-N 3.03Å; Q60-N64 PolarHBondContact O-ND2 3.5Å; Q60-N64 PolarHBondContact O-OD1 2.95Å; Y61-N64 PolarHBondContact O-N 3.48Å; I62-N64 VanDerWaalsContact C-N 3.31Å; I62-N64 PolarHBondContact O-N 3.49Å; N64-S67 PolarHBondContact O-N 3.08Å; N64-A68 WeakPolarHBondContact O-CB 3.47Å; N64-A68 PolarHBondContact O-N 3.34Å
65	L	88.6	Confident	80.6	Confident	91 Å²	91	97.1 Å²	97.1	48%	0.476	54%	0.537	S	S	.	.	H	α-helix	trans	-65.5	-43.5	175.4	-72.6	178.5	0	0	0	112.1	Y61 I62 E63 S67 S69	Y61-L65 HydrophobicContact CD1-CD1 3.94Å; Y61-L65 HydrophobicContact CE1-CD1 3.42Å; Y61-L65 VanDerWaalsContact CE1-CD1 3.42Å; Y61-L65 HydrophobicContact CE1-CG 4.24Å; Y61-L65 HydrophobicContact CE2-CD1 4.41Å; Y61-L65 HydrophobicContact CE2-CG 4.43Å; Y61-L65 WeakPolarHBondContact O-CG 3.46Å; Y61-L65 PolarHBondContact O-N 3.06Å; I62-L65 PolarHBondContact O-N 3.29Å; E63-L65 VanDerWaalsContact C-N 3.35Å; L65-S67 VanDerWaalsContact C-N 3.34Å; L65-S69 WeakPolarHBondContact O-CB 3.46Å; L65-S69 PolarHBondContact O-N 3.12Å
66	M	84.6	Confident	78.5	Confident	80 Å²	80	98.7 Å²	98.7	39%	0.394	55%	0.545	S	S	.	.	H	α-helix	trans	-63.2	-40.6	176.4	-70.1	-171.5	-59	0	0	111.6	I62 E63	I62-M66 HydrophobicContact CG2-CE 3.95Å; I62-M66 HydrophobicContact CG2-CG 4.38Å; I62-M66 HydrophobicContact CG2-SD 4.23Å; I62-M66 WeakPolarHBondContact O-CG 3.17Å; I62-M66 PolarHBondContact O-N 3.35Å; E63-M66 HydrophobicContact CG-CE 4.31Å; E63-M66 PolarHBondContact O-N 3.28Å
67	S	81.3	Confident	76.3	Confident	79 Å²	79	97.5 Å²	97.5	55%	0.552	55%	0.548	S	S	*	.	H	α-helix	trans	-72.8	-38.2	-179	-55.8	0	0	0	0	113	E63 N64 L65 Q73	E63-S67 WeakPolarHBondContact O-CB 3.42Å; E63-S67 PolarHBondContact O-N 3.43Å; E63-S67 PolarHBondContact O-OG 3.25Å; N64-S67 PolarHBondContact O-N 3.08Å; L65-S67 VanDerWaalsContact C-N 3.34Å; S67-Q73 PolarHBondContact O-NE2 3.34Å
68	A	80.6	Confident	74	Confident	90 Å²	90	102.3 Å²	102.3	74%	0.744	56%	0.561	S	S	*	*	H	α-helix	trans	-79.3	-23.9	179.5	0	0	0	0	0	113.1	N64	N64-A68 WeakPolarHBondContact O-CB 3.47Å; N64-A68 PolarHBondContact O-N 3.34Å
69	S	72.3	Confident	71.8	Confident	47 Å²	47	104 Å²	104	33%	0.329	58%	0.58	S	S	.	*			trans	-82.4	116.1	175	-175.4	0	0	0	0	110.8	L65 V71 F72	L65-S69 WeakPolarHBondContact O-CB 3.46Å; L65-S69 PolarHBondContact O-N 3.12Å; S69-V71 PolarHBondContact O-N 3.16Å; S69-F72 PolarHBondContact O-N 3.16Å
70	S	59.9	Low	69.5	Low	91 Å²	91	112.7 Å²	112.7	64%	0.636	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.2	-9.8	177.3	120.1	0	0	0	0	113.8	F72	S70-F72 VanDerWaalsContact C-N 3.31Å; S70-F72 PolarHBondContact O-N 3.43Å
71	V	60.6	Low	67.4	Low	107 Å²	107	117.6 Å²	117.6	65%	0.648	63%	0.633	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.2	-28.6	178.3	172.5	0	0	0	0	112	S69	S69-V71 PolarHBondContact O-N 3.16Å
72	F	54.8	Low	64.8	Low	128 Å²	128	124.4 Å²	124.4	56%	0.561	67%	0.665	S	S	*	*	S	Bend	trans	-98.3	-6.6	-177	-74.8	-84.6	0	0	0	114.7	S69 S70	S69-F72 PolarHBondContact O-N 3.16Å; S70-F72 VanDerWaalsContact C-N 3.31Å; S70-F72 PolarHBondContact O-N 3.43Å
73	Q	54.8	Low	63.4	Low	124 Å²	124	126 Å²	126	58%	0.579	67%	0.674	S	S	*	*	G	3₁₀ helix	trans	-82.8	-7.2	-179.7	-65.3	-169.1	14.2	0	0	114.4	S67 T75	S67-Q73 PolarHBondContact O-NE2 3.34Å; Q73-T75 PolarHBondContact O-N 3.37Å
74	T	49.3	Very low	62	Low	107 Å²	107	127.4 Å²	127.4	66%	0.656	69%	0.685	S	S	*	*	G	3₁₀ helix	trans	-88.5	3.7	-169	56.5	0	0	0	0	115.4
75	T	56.4	Low	60.4	Low	119 Å²	119	129.5 Å²	129.5	73%	0.73	70%	0.697	S	S	*	*	G	3₁₀ helix	trans	-99.2	-9.6	-179.9	51.5	0	0	0	0	115.7	Q73	Q73-T75 PolarHBondContact O-N 3.37Å
76	D	54.4	Low	58.8	Low	140 Å²	140	131.8 Å²	131.8	75%	0.749	71%	0.71	S	S	*	*	S	Bend	trans	-105.5	0.9	-176.6	-73.1	-56.7	0	0	0	115.8	K78	D76-K78 PolarHBondContact O-N 3.37Å
77	T	51.4	Low	57.1	Low	118 Å²	118	135 Å²	135	72%	0.724	73%	0.73	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.8	53	179.6	65.5	0	0	0	0	113.2
78	K	49.5	Very low	55.5	Low	201 Å²	201	138.7 Å²	138.7	87%	0.874	74%	0.742	S	S	*	*	T	Hydrogen-bonded Turn	trans	-145.9	28.8	167.6	-76.6	-160.5	-176.4	176.5	0	115.7	D76	D76-K78 PolarHBondContact O-N 3.37Å
79	S	49.7	Very low	53.8	Low	118 Å²	118	142.2 Å²	142.2	83%	0.825	74%	0.741	S	S	*	*	S	Bend	trans	-125.3	11.1	174.6	-54.3	0	0	0	0	115.9
80	K	48.6	Very low	52.3	Low	210 Å²	210	149.5 Å²	149.5	91%	0.913	77%	0.773	S	S	*	*	S	Bend	trans	-127.9	63.5	169.5	-81.6	-175	178.3	172.8	0	112
81	Q	50.9	Low	51.7	Low	196 Å²	196	154.4 Å²	154.4	92%	0.916	79%	0.785	S	S	*	*			trans	-161.1	80.7	156.5	-123.7	179.9	-0.4	0	0	110.8
82	K	40.1	Very low	50.9	Low	285 Å²	285	158.7 Å²	158.7	100%	1.239	80%	0.797	S	S	*	*			trans	-172.3	0	131.9	-132.1	177.9	175.3	-174.8	0	110.8

Retrieved 82 of 82 residues in 71.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).