A0A087X3N0_POEFO Loading...

Coiled-coil domain-containing protein 167

AlphaFold DB , UniProt , Accession A0A087X3N0, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 105 aa.

						>A0A087X3N0_POEFO|A0A087X3N0
MAKMKDKKRENVSIASEIDRLEERRERCQDNLERAEFKSRKARLSEQERQELEKEMAIINERVQKLDKELAMLRGENRRNMVLSVALLTISALFYYVFFYNEDDT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.2	Very low	48.9	Very low	249 Å²	249	167.4 Å²	167.4	100%	1.227	80%	0.797	S	S	*	*				0	71.9	0	-68	-172.8	178.2	0	0	110.7
2	A	50.4	Low	49.4	Very low	91 Å²	91	161.8 Å²	161.8	75%	0.752	78%	0.782	S	S	*	*			trans	-146.2	36.7	-173.2	0	0	0	0	0	113.2
3	K	46	Very low	50.5	Low	209 Å²	209	154.2 Å²	154.2	91%	0.909	76%	0.755	S	S	*	*	S	Bend	trans	-126.3	16.1	179.3	-81.6	-156.2	175.5	-172.7	0	114.8
4	M	47.8	Very low	52.1	Low	183 Å²	183	150.9 Å²	150.9	90%	0.901	74%	0.741	S	S	*	*	S	Bend	trans	-117.1	-5.7	-178	-94.3	176.3	146.4	0	0	115.1
5	K	48.5	Very low	53.7	Low	184 Å²	184	144.3 Å²	144.3	80%	0.8	72%	0.72	S	S	*	*	S	Bend	trans	-97.4	-17.1	-175.2	-78.2	-174.1	175	179.8	0	115.5
6	D	50.2	Low	55.2	Low	121 Å²	121	138.1 Å²	138.1	65%	0.647	69%	0.694	S	S	*	*	S	Bend	trans	-82.3	-32	-176.2	-65.5	-50.5	0	0	0	113.7	K8 R9	D6-K8 PolarHBondContact O-N 3.26Å; D6-K8 VanDerWaalsContact O-N 3.11Å; D6-R9 PolarHBondContact O-N 3.11Å
7	K	49.7	Very low	56.8	Low	173 Å²	173	136.6 Å²	136.6	75%	0.752	69%	0.685	S	S	*	*	H	α-helix	trans	-70.3	-11.3	-178	-164.3	155.4	-177.5	156.9	0	114.5
8	K	48.5	Very low	58.3	Low	171 Å²	171	133.6 Å²	133.6	74%	0.743	67%	0.67	S	S	*	*	H	α-helix	trans	-92.5	-15.6	179.2	-156.2	177.4	-177.2	-176.5	0	113.1	D6 V12	D6-K8 PolarHBondContact O-N 3.26Å; D6-K8 VanDerWaalsContact O-N 3.11Å; K8-V12 WeakPolarHBondContact O-CG2 3.45Å
9	R	50.8	Low	59.8	Low	208 Å²	208	131.9 Å²	131.9	79%	0.785	66%	0.663	S	S	*	*	H	α-helix	trans	-87.3	-25.8	-179.1	-80.4	-174.1	171.3	-139.3	-1.5	113.8	D6	D6-R9 PolarHBondContact O-N 3.11Å
10	E	53.7	Low	61.1	Low	139 Å²	139	133.8 Å²	133.8	65%	0.65	66%	0.662	S	S	*	*	H	α-helix	trans	-74.2	-37.7	177.4	-73.4	177.6	145.9	0	0	112.7	V12 S13 I14	E10-V12 VanDerWaalsContact C-N 3.32Å; E10-V12 PolarHBondContact O-N 3.02Å; E10-S13 PolarHBondContact O-N 3.4Å; E10-S13 VanDerWaalsContact O-N 3.17Å; E10-I14 PolarHBondContact O-N 2.97Å
11	N	51.6	Low	62.3	Low	113 Å²	113	132.3 Å²	132.3	60%	0.604	66%	0.657	S	S	*	*	H	α-helix	trans	-74.6	-19.8	-178.6	-66.1	-22.3	0	0	0	113.9	S13	N11-S13 VanDerWaalsContact C-N 3.31Å
12	V	54.6	Low	64.6	Low	101 Å²	101	126.1 Å²	126.1	61%	0.612	62%	0.624	S	S	*	*	H	α-helix	trans	-76.1	-23.7	172.5	175.3	0	0	0	0	110.8	K8 E10 S16	K8-V12 WeakPolarHBondContact O-CG2 3.45Å; E10-V12 VanDerWaalsContact C-N 3.32Å; E10-V12 PolarHBondContact O-N 3.02Å; V12-S16 WeakPolarHBondContact O-CB 3.31Å; V12-S16 PolarHBondContact O-OG 3.47Å
13	S	63.4	Low	66.4	Low	62 Å²	62	126.7 Å²	126.7	43%	0.434	61%	0.612	S	S	.	*	H	α-helix	trans	-80.4	-49.5	-177.3	-155.6	0	0	0	0	111.8	E10 N11 S16 E17	E10-S13 PolarHBondContact O-N 3.4Å; E10-S13 VanDerWaalsContact O-N 3.17Å; N11-S13 VanDerWaalsContact C-N 3.31Å; S13-S16 PolarHBondContact O-OG 2.89Å; S13-E17 VanDerWaalsContact O-CB 3.31Å; S13-E17 WeakPolarHBondContact O-CB 3.4Å; S13-E17 PolarHBondContact O-N 3.17Å
14	I	73.4	Confident	68.5	Low	109 Å²	109	125.4 Å²	125.4	56%	0.559	60%	0.601	S	S	*	*	H	α-helix	trans	-73.1	-43.3	-171.8	-60.8	173.2	0	0	0	112.2	E10 S16 E17 I18	E10-I14 PolarHBondContact O-N 2.97Å; I14-S16 PolarHBondContact O-N 3.5Å; I14-E17 PolarHBondContact O-N 3.16Å; I14-E17 VanDerWaalsContact O-N 3.16Å; I14-I18 HydrophobicContact CG2-CD1 3.88Å; I14-I18 HydrophobicContact CG2-CG1 4.37Å; I14-I18 VanDerWaalsContact O-CG1 3.32Å; I14-I18 WeakPolarHBondContact O-CG1 3.46Å; I14-I18 PolarHBondContact O-N 2.76Å
15	A	75.4	Confident	70.6	Confident	51 Å²	51	124.4 Å²	124.4	42%	0.421	59%	0.587	S	S	.	*	H	α-helix	trans	-62.3	-44.2	179.2	0	0	0	0	0	111.7	E17 I18 D19	A15-E17 PolarHBondContact O-N 3.16Å; A15-I18 PolarHBondContact O-N 3.25Å; A15-D19 VanDerWaalsContact O-CG 3.3Å; A15-D19 PolarHBondContact O-N 3.01Å
16	S	78.6	Confident	72.5	Confident	45 Å²	45	122.2 Å²	122.2	32%	0.315	58%	0.58	S	S	.	*	H	α-helix	trans	-65.3	-27	176.7	74.6	0	0	0	0	113.3	V12 S13 I14 R20	V12-S16 WeakPolarHBondContact O-CB 3.31Å; V12-S16 PolarHBondContact O-OG 3.47Å; S13-S16 PolarHBondContact O-OG 2.89Å; I14-S16 PolarHBondContact O-N 3.5Å; S16-R20 WeakPolarHBondContact O-CB 3.2Å; S16-R20 WeakPolarHBondContact O-CD 3.32Å; S16-R20 WeakPolarHBondContact O-CG 3.43Å; S16-R20 PolarHBondContact O-N 3.17Å; S16-R20 VanDerWaalsContact O-N 3.16Å
17	E	81.9	Confident	74.4	Confident	114 Å²	114	123.5 Å²	123.5	53%	0.533	58%	0.575	S	S	.	*	H	α-helix	trans	-80.7	-34.7	178.5	-161.1	133.4	-156.4	0	0	111.4	S13 I14 A15 L21	S13-E17 VanDerWaalsContact O-CB 3.31Å; S13-E17 WeakPolarHBondContact O-CB 3.4Å; S13-E17 PolarHBondContact O-N 3.17Å; I14-E17 PolarHBondContact O-N 3.16Å; I14-E17 VanDerWaalsContact O-N 3.16Å; A15-E17 PolarHBondContact O-N 3.16Å; E17-L21 WeakPolarHBondContact O-CB 3.41Å; E17-L21 WeakPolarHBondContact O-CG 3.46Å; E17-L21 PolarHBondContact O-N 2.92Å
18	I	83.6	Confident	76.1	Confident	82 Å²	82	119.3 Å²	119.3	42%	0.421	57%	0.567	S	S	.	*	H	α-helix	trans	-62.3	-52.2	168.3	-68.5	167.2	0	0	0	109.8	I14 A15 R20 L21 E22	I14-I18 HydrophobicContact CG2-CD1 3.88Å; I14-I18 HydrophobicContact CG2-CG1 4.37Å; I14-I18 VanDerWaalsContact O-CG1 3.32Å; I14-I18 WeakPolarHBondContact O-CG1 3.46Å; I14-I18 PolarHBondContact O-N 2.76Å; A15-I18 PolarHBondContact O-N 3.25Å; I18-R20 VanDerWaalsContact C-N 3.27Å; I18-R20 PolarHBondContact O-N 3.41Å; I18-L21 CarbonylContact O-C 3.58Å; I18-L21 WeakPolarHBondContact O-CA 3.49Å; I18-L21 WeakPolarHBondContact O-CB 3.2Å; I18-L21 PolarHBondContact O-N 2.81Å; I18-E22 HydrophobicContact CG2-CG 4.23Å; I18-E22 WeakPolarHBondContact O-CG 3.37Å; I18-E22 PolarHBondContact O-N 2.98Å
19	D	86.6	Confident	78.1	Confident	101 Å²	101	115.8 Å²	115.8	54%	0.54	55%	0.553	S	S	.	*	H	α-helix	trans	-56.8	-42.5	-180	-67.7	-17.2	0	0	0	111.5	A15 L21 E22 E23	A15-D19 VanDerWaalsContact O-CG 3.3Å; A15-D19 PolarHBondContact O-N 3.01Å; D19-L21 PolarHBondContact O-N 3.28Å; D19-E22 PolarHBondContact O-N 2.89Å; D19-E23 WeakPolarHBondContact O-CB 3.24Å; D19-E23 PolarHBondContact O-N 3.1Å
20	R	85.3	Confident	80	Confident	169 Å²	169	110.2 Å²	110.2	64%	0.638	54%	0.539	S	S	*	.	H	α-helix	trans	-65.8	-36.5	175.9	-77.3	173	177.8	-178.5	1.4	113	S16 I18 R24	S16-R20 WeakPolarHBondContact O-CB 3.2Å; S16-R20 WeakPolarHBondContact O-CD 3.32Å; S16-R20 WeakPolarHBondContact O-CG 3.43Å; S16-R20 PolarHBondContact O-N 3.17Å; S16-R20 VanDerWaalsContact O-N 3.16Å; I18-R20 VanDerWaalsContact C-N 3.27Å; I18-R20 PolarHBondContact O-N 3.41Å; R20-R24 WeakPolarHBondContact O-CB 3.35Å; R20-R24 WeakPolarHBondContact O-CG 3.49Å; R20-R24 PolarHBondContact O-N 3.49Å; R20-R24 VanDerWaalsContact O-N 3.1Å
21	L	88.3	Confident	81.6	Confident	104 Å²	104	108.1 Å²	108.1	55%	0.545	53%	0.532	S	S	.	.	H	α-helix	trans	-72	-39.2	176.9	-86.1	167.3	0	0	0	111.5	E17 I18 D19 R24 R25	E17-L21 WeakPolarHBondContact O-CB 3.41Å; E17-L21 WeakPolarHBondContact O-CG 3.46Å; E17-L21 PolarHBondContact O-N 2.92Å; I18-L21 CarbonylContact O-C 3.58Å; I18-L21 WeakPolarHBondContact O-CA 3.49Å; I18-L21 WeakPolarHBondContact O-CB 3.2Å; I18-L21 PolarHBondContact O-N 2.81Å; D19-L21 PolarHBondContact O-N 3.28Å; L21-R24 PolarHBondContact O-N 2.86Å; L21-R25 WeakPolarHBondContact O-CB 3.4Å; L21-R25 PolarHBondContact O-N 3.39Å
22	E	88.1	Confident	83.3	Confident	118 Å²	118	107.6 Å²	107.6	55%	0.551	53%	0.529	S	S	*	.	H	α-helix	trans	-64.4	-46.4	174.8	-72.8	-174.6	166.1	0	0	111	I18 D19 R24 R25 E26	I18-E22 HydrophobicContact CG2-CG 4.23Å; I18-E22 WeakPolarHBondContact O-CG 3.37Å; I18-E22 PolarHBondContact O-N 2.98Å; D19-E22 PolarHBondContact O-N 2.89Å; E22-R24 VanDerWaalsContact C-N 3.29Å; E22-R24 PolarHBondContact O-N 2.95Å; E22-R25 WeakPolarHBondContact O-CB 3.47Å; E22-R25 PolarHBondContact O-N 2.93Å; E22-R25 VanDerWaalsContact O-N 3.08Å; E22-E26 WeakPolarHBondContact O-CB 3.42Å; E22-E26 PolarHBondContact O-N 3.34Å
23	E	89.4	Confident	84.8	Confident	104 Å²	104	109.2 Å²	109.2	49%	0.486	53%	0.53	S	S	.	.	H	α-helix	trans	-61	-39.5	176.1	-164.4	-165.4	159.3	0	0	111.6	D19 R27	D19-E23 WeakPolarHBondContact O-CB 3.24Å; D19-E23 PolarHBondContact O-N 3.1Å; E23-R27 VanDerWaalsContact O-CB 3.24Å; E23-R27 WeakPolarHBondContact O-CB 3.25Å; E23-R27 PolarHBondContact O-N 3.26Å; E23-R27 IonicContact OE1-CZ 3.95Å; E23-R27 IonicContact OE1-NH2 2.76Å; E23-R27 PolarHBondContact OE1-NH2 3.34Å
24	R	90.2	Very high	85.8	Confident	181 Å²	181	113.4 Å²	113.4	68%	0.683	54%	0.536	S	S	*	.	H	α-helix	trans	-67.7	-37.8	174.8	-75.6	176.8	70.1	-165.2	1.1	112.1	R20 L21 E22 C28	R20-R24 WeakPolarHBondContact O-CB 3.35Å; R20-R24 WeakPolarHBondContact O-CG 3.49Å; R20-R24 PolarHBondContact O-N 3.49Å; R20-R24 VanDerWaalsContact O-N 3.1Å; L21-R24 PolarHBondContact O-N 2.86Å; E22-R24 VanDerWaalsContact C-N 3.29Å; E22-R24 PolarHBondContact O-N 2.95Å; R24-C28 VanDerWaalsContact O-CB 3.25Å; R24-C28 WeakPolarHBondContact O-CB 3.34Å; R24-C28 PolarHBondContact O-N 3.08Å
25	R	91.5	Very high	85.9	Confident	163 Å²	163	110.8 Å²	110.8	62%	0.615	53%	0.531	S	S	*	.	H	α-helix	trans	-65.4	-47.4	176.5	-177.4	-175.1	-174.4	-101.9	3	110.5	L21 E22 C28 Q29	L21-R25 WeakPolarHBondContact O-CB 3.4Å; L21-R25 PolarHBondContact O-N 3.39Å; E22-R25 WeakPolarHBondContact O-CB 3.47Å; E22-R25 PolarHBondContact O-N 2.93Å; E22-R25 VanDerWaalsContact O-N 3.08Å; R25-C28 CarbonylContact O-C 3.53Å; R25-C28 WeakPolarHBondContact O-CB 3.41Å; R25-C28 PolarHBondContact O-N 3.44Å; R25-C28 VanDerWaalsContact O-N 3.13Å; R25-Q29 PolarHBondContact O-N 2.82Å
26	E	88.8	Confident	86.1	Confident	137 Å²	137	112.7 Å²	112.7	64%	0.64	53%	0.531	S	S	*	.	H	α-helix	trans	-61.9	-45.5	179	-167	173.9	-152.2	0	0	110.6	E22 C28 Q29 D30	E22-E26 WeakPolarHBondContact O-CB 3.42Å; E22-E26 PolarHBondContact O-N 3.34Å; E26-C28 VanDerWaalsContact C-N 3.29Å; E26-C28 PolarHBondContact O-N 2.81Å; E26-Q29 PolarHBondContact O-N 3.04Å; E26-Q29 VanDerWaalsContact O-N 3.16Å; E26-D30 PolarHBondContact O-N 3.46Å
27	R	88.2	Confident	85.9	Confident	148 Å²	148	117.1 Å²	117.1	56%	0.558	55%	0.545	S	S	*	.	H	α-helix	trans	-62.7	-35.1	173.9	-162.7	-176.5	-59.2	-147.2	2.5	112.7	E23 N31	E23-R27 VanDerWaalsContact O-CB 3.24Å; E23-R27 WeakPolarHBondContact O-CB 3.25Å; E23-R27 PolarHBondContact O-N 3.26Å; E23-R27 IonicContact OE1-CZ 3.95Å; E23-R27 IonicContact OE1-NH2 2.76Å; E23-R27 PolarHBondContact OE1-NH2 3.34Å; R27-N31 WeakPolarHBondContact O-CB 3.39Å; R27-N31 PolarHBondContact O-N 3.04Å; R27-N31 PolarHBondContact O-ND2 3.13Å
28	C	87.1	Confident	85.5	Confident	85 Å²	85	117.4 Å²	117.4	57%	0.574	54%	0.544	S	S	*	.	H	α-helix	trans	-70.2	-39.5	175.5	-156	0	0	0	0	111.3	R24 R25 E26 N31 L32	R24-C28 VanDerWaalsContact O-CB 3.25Å; R24-C28 WeakPolarHBondContact O-CB 3.34Å; R24-C28 PolarHBondContact O-N 3.08Å; R25-C28 CarbonylContact O-C 3.53Å; R25-C28 WeakPolarHBondContact O-CB 3.41Å; R25-C28 PolarHBondContact O-N 3.44Å; R25-C28 VanDerWaalsContact O-N 3.13Å; E26-C28 VanDerWaalsContact C-N 3.29Å; E26-C28 PolarHBondContact O-N 2.81Å; C28-N31 PolarHBondContact O-N 2.83Å; C28-L32 WeakPolarHBondContact O-CB 3.37Å; C28-L32 PolarHBondContact O-N 3.16Å
29	Q	89.1	Confident	84.6	Confident	97 Å²	97	116.5 Å²	116.5	45%	0.453	55%	0.545	S	S	.	.	H	α-helix	trans	-65.2	-45.3	174.2	-78.2	-174.5	-67.3	0	0	111.8	R25 E26 N31 L32 E33	R25-Q29 PolarHBondContact O-N 2.82Å; E26-Q29 PolarHBondContact O-N 3.04Å; E26-Q29 VanDerWaalsContact O-N 3.16Å; Q29-N31 VanDerWaalsContact C-N 3.32Å; Q29-N31 PolarHBondContact O-N 2.87Å; Q29-L32 WeakPolarHBondContact O-CB 3.44Å; Q29-L32 PolarHBondContact O-N 2.89Å; Q29-L32 VanDerWaalsContact O-N 3.13Å; Q29-E33 WeakPolarHBondContact O-CB 3.39Å; Q29-E33 PolarHBondContact O-N 3.13Å
30	D	90.9	Very high	83.8	Confident	92 Å²	92	120 Å²	120	49%	0.492	55%	0.551	S	S	.	*	H	α-helix	trans	-60.5	-43.7	175.7	-177.2	57.2	0	0	0	110.9	E26 L32 E33 R34	E26-D30 PolarHBondContact O-N 3.46Å; D30-L32 VanDerWaalsContact C-N 3.34Å; D30-L32 PolarHBondContact O-N 3.38Å; D30-E33 PolarHBondContact O-N 2.9Å; D30-R34 WeakPolarHBondContact O-CB 3.19Å; D30-R34 PolarHBondContact O-N 2.82Å
31	N	87.1	Confident	82.9	Confident	94 Å²	94	116.9 Å²	116.9	50%	0.503	54%	0.542	S	S	.	.	H	α-helix	trans	-62.7	-38.8	174.3	-76.8	-33.6	0	0	0	112.9	R27 C28 Q29 A35	R27-N31 WeakPolarHBondContact O-CB 3.39Å; R27-N31 PolarHBondContact O-N 3.04Å; R27-N31 PolarHBondContact O-ND2 3.13Å; C28-N31 PolarHBondContact O-N 2.83Å; Q29-N31 VanDerWaalsContact C-N 3.32Å; Q29-N31 PolarHBondContact O-N 2.87Å; N31-A35 VanDerWaalsContact O-CB 3.24Å; N31-A35 WeakPolarHBondContact O-CB 3.43Å; N31-A35 PolarHBondContact O-N 3.42Å
32	L	86.8	Confident	81.7	Confident	102 Å²	102	115.9 Å²	115.9	53%	0.534	55%	0.548	S	S	.	.	H	α-helix	trans	-65.8	-48.2	176.2	-174.9	76.7	0	0	0	110.7	C28 Q29 D30 R34 A35 E36	C28-L32 WeakPolarHBondContact O-CB 3.37Å; C28-L32 PolarHBondContact O-N 3.16Å; Q29-L32 WeakPolarHBondContact O-CB 3.44Å; Q29-L32 PolarHBondContact O-N 2.89Å; Q29-L32 VanDerWaalsContact O-N 3.13Å; D30-L32 VanDerWaalsContact C-N 3.34Å; D30-L32 PolarHBondContact O-N 3.38Å; L32-R34 VanDerWaalsContact C-N 3.3Å; L32-R34 PolarHBondContact O-N 3.48Å; L32-A35 CarbonylContact O-C 3.55Å; L32-A35 WeakPolarHBondContact O-CB 3.49Å; L32-A35 PolarHBondContact O-N 3.05Å; L32-A35 VanDerWaalsContact O-N 3.12Å; L32-E36 WeakPolarHBondContact O-CB 3.24Å; L32-E36 WeakPolarHBondContact O-CG 3.32Å; L32-E36 PolarHBondContact O-N 2.75Å
33	E	86.9	Confident	80.5	Confident	135 Å²	135	120.3 Å²	120.3	63%	0.631	56%	0.56	S	S	*	*	H	α-helix	trans	-61.4	-41.2	178.3	-174.6	171.5	-166.8	0	0	111	Q29 D30 A35 E36 F37	Q29-E33 WeakPolarHBondContact O-CB 3.39Å; Q29-E33 PolarHBondContact O-N 3.13Å; D30-E33 PolarHBondContact O-N 2.9Å; E33-A35 VanDerWaalsContact C-N 3.35Å; E33-A35 PolarHBondContact O-N 3.4Å; E33-E36 PolarHBondContact O-N 2.8Å; E33-F37 WeakPolarHBondContact O-CB 3.47Å; E33-F37 PolarHBondContact O-N 3.31Å
34	R	84.9	Confident	79.3	Confident	151 Å²	151	118.3 Å²	118.3	57%	0.57	55%	0.552	S	S	*	*	H	α-helix	trans	-67.1	-35.8	175.5	-153.2	171.7	-165.3	-113.5	0.4	112.1	D30 L32 K38	D30-R34 WeakPolarHBondContact O-CB 3.19Å; D30-R34 PolarHBondContact O-N 2.82Å; L32-R34 VanDerWaalsContact C-N 3.3Å; L32-R34 PolarHBondContact O-N 3.48Å; R34-K38 WeakPolarHBondContact O-CB 3.26Å; R34-K38 VanDerWaalsContact O-CG 3.26Å; R34-K38 WeakPolarHBondContact O-CG 3.15Å; R34-K38 PolarHBondContact O-N 3.12Å
35	A	75.3	Confident	78.3	Confident	53 Å²	53	112.4 Å²	112.4	44%	0.438	54%	0.539	S	S	.	.	H	α-helix	trans	-71.4	-38.5	173.7	0	0	0	0	0	111.8	N31 L32 E33 K38 S39	N31-A35 VanDerWaalsContact O-CB 3.24Å; N31-A35 WeakPolarHBondContact O-CB 3.43Å; N31-A35 PolarHBondContact O-N 3.42Å; L32-A35 CarbonylContact O-C 3.55Å; L32-A35 WeakPolarHBondContact O-CB 3.49Å; L32-A35 PolarHBondContact O-N 3.05Å; L32-A35 VanDerWaalsContact O-N 3.12Å; E33-A35 VanDerWaalsContact C-N 3.35Å; E33-A35 PolarHBondContact O-N 3.4Å; A35-K38 PolarHBondContact O-N 3.32Å; A35-S39 WeakPolarHBondContact O-CB 3.43Å; A35-S39 PolarHBondContact O-N 2.75Å
36	E	79.4	Confident	77.5	Confident	92 Å²	92	110.3 Å²	110.3	43%	0.43	54%	0.536	S	S	.	.	H	α-helix	trans	-66.1	-43.4	174.1	-77.9	-170.3	-169.7	0	0	111.5	L32 E33 K38 S39 R40	L32-E36 WeakPolarHBondContact O-CB 3.24Å; L32-E36 WeakPolarHBondContact O-CG 3.32Å; L32-E36 PolarHBondContact O-N 2.75Å; E33-E36 PolarHBondContact O-N 2.8Å; E36-K38 PolarHBondContact O-N 2.9Å; E36-S39 PolarHBondContact O-N 3.29Å; E36-R40 WeakPolarHBondContact O-CB 3.26Å; E36-R40 VanDerWaalsContact O-CG 3.26Å; E36-R40 WeakPolarHBondContact O-CG 3.38Å; E36-R40 PolarHBondContact O-N 3.44Å
37	F	74.1	Confident	76.7	Confident	137 Å²	137	111 Å²	111	60%	0.601	54%	0.539	S	S	*	.	H	α-helix	trans	-61.5	-45	175.1	-176.1	-97	0	0	0	111.1	E33 R40 K41	E33-F37 WeakPolarHBondContact O-CB 3.47Å; E33-F37 PolarHBondContact O-N 3.31Å; F37-R40 PolarHBondContact O-N 2.75Å; F37-K41 VanDerWaalsContact O-CB 3.25Å; F37-K41 WeakPolarHBondContact O-CB 3.13Å; F37-K41 PolarHBondContact O-N 3.5Å
38	K	73.4	Confident	75.9	Confident	121 Å²	121	108.3 Å²	108.3	53%	0.526	53%	0.533	S	S	.	.	H	α-helix	trans	-64	-39.8	173.4	-76.7	176.9	-179.2	-176.5	0	112.3	R34 A35 E36 K41 A42	R34-K38 WeakPolarHBondContact O-CB 3.26Å; R34-K38 VanDerWaalsContact O-CG 3.26Å; R34-K38 WeakPolarHBondContact O-CG 3.15Å; R34-K38 PolarHBondContact O-N 3.12Å; A35-K38 PolarHBondContact O-N 3.32Å; E36-K38 PolarHBondContact O-N 2.9Å; K38-K41 CarbonylContact O-C 3.58Å; K38-K41 PolarHBondContact O-N 3.48Å; K38-A42 WeakPolarHBondContact O-CB 3.25Å; K38-A42 PolarHBondContact O-N 3.22Å
39	S	65.3	Low	75.6	Confident	63 Å²	63	107.9 Å²	107.9	44%	0.441	52%	0.52	S	S	.	.	H	α-helix	trans	-66.1	-43.1	177.7	179.7	0	0	0	0	111.3	A35 E36 K41 A42 R43	A35-S39 WeakPolarHBondContact O-CB 3.43Å; A35-S39 PolarHBondContact O-N 2.75Å; E36-S39 PolarHBondContact O-N 3.29Å; S39-K41 VanDerWaalsContact C-N 3.34Å; S39-K41 PolarHBondContact O-N 2.76Å; S39-A42 PolarHBondContact O-N 3.42Å; S39-R43 VanDerWaalsContact O-CB 3.25Å; S39-R43 WeakPolarHBondContact O-CB 3.45Å; S39-R43 WeakPolarHBondContact O-CG 3.47Å; S39-R43 PolarHBondContact O-N 3.49Å
40	R	68.8	Low	75.1	Confident	175 Å²	175	107.7 Å²	107.7	66%	0.66	52%	0.518	S	S	*	.	H	α-helix	trans	-61.3	-42.8	171.7	-71.6	176.8	-169.7	-133.7	6.8	111.1	E36 F37 L44	E36-R40 WeakPolarHBondContact O-CB 3.26Å; E36-R40 VanDerWaalsContact O-CG 3.26Å; E36-R40 WeakPolarHBondContact O-CG 3.38Å; E36-R40 PolarHBondContact O-N 3.44Å; F37-R40 PolarHBondContact O-N 2.75Å; R40-L44 WeakPolarHBondContact O-CG 3.25Å; R40-L44 PolarHBondContact O-N 2.76Å
41	K	66.6	Low	74.6	Confident	102 Å²	102	109.1 Å²	109.1	44%	0.443	52%	0.522	S	S	.	.	H	α-helix	trans	-68.3	-32.5	176.5	-168.9	176.8	-177.8	176.8	0	113.5	F37 K38 S39	F37-K41 VanDerWaalsContact O-CB 3.25Å; F37-K41 WeakPolarHBondContact O-CB 3.13Å; F37-K41 PolarHBondContact O-N 3.5Å; K38-K41 CarbonylContact O-C 3.58Å; K38-K41 PolarHBondContact O-N 3.48Å; S39-K41 VanDerWaalsContact C-N 3.34Å; S39-K41 PolarHBondContact O-N 2.76Å
42	A	64.7	Low	74.4	Confident	83 Å²	83	108.1 Å²	108.1	69%	0.686	52%	0.516	S	S	*	.	H	α-helix	trans	-88	-23.9	-179.6	0	0	0	0	0	113.3	K38 S39 L44	K38-A42 WeakPolarHBondContact O-CB 3.25Å; K38-A42 PolarHBondContact O-N 3.22Å; S39-A42 PolarHBondContact O-N 3.42Å; A42-L44 VanDerWaalsContact C-N 3.29Å
43	R	62.3	Low	74.3	Confident	212 Å²	212	109.1 Å²	109.1	80%	0.8	52%	0.518	S	S	*	.	H	α-helix	trans	-72.1	-24.4	170.8	-90.8	179.7	66.1	-174.9	0.2	112.6	S39 S45	S39-R43 VanDerWaalsContact O-CB 3.25Å; S39-R43 WeakPolarHBondContact O-CB 3.45Å; S39-R43 WeakPolarHBondContact O-CG 3.47Å; S39-R43 PolarHBondContact O-N 3.49Å; R43-S45 PolarHBondContact O-N 3.26Å
44	L	63.6	Low	74.2	Confident	61 Å²	61	109.2 Å²	109.2	32%	0.319	52%	0.517	S	S	.	.	S	Bend	trans	-73	120.3	171.5	-70.2	161.6	0	0	0	108.5	R40 A42 E48 R49 L52	R40-L44 WeakPolarHBondContact O-CG 3.25Å; R40-L44 PolarHBondContact O-N 2.76Å; A42-L44 VanDerWaalsContact C-N 3.29Å; L44-E48 WeakPolarHBondContact CA-OE2 3.47Å; L44-E48 HydrophobicContact CB-CB 4.35Å; L44-E48 HydrophobicContact CD2-CB 3.74Å; L44-R49 HydrophobicContact CB-CG 3.51Å; L44-R49 HydrophobicContact CD1-CG 4.28Å; L44-R49 HydrophobicContact CG-CG 4.49Å; L44-L52 HydrophobicContact CD1-CD2 4.43Å
45	S	69.9	Low	74.3	Confident	58 Å²	58	107 Å²	107	41%	0.406	51%	0.513	S	S	.	.			trans	-56.9	152.4	166.1	176.9	0	0	0	0	109.7	R43 Q47 E48 R49	R43-S45 PolarHBondContact O-N 3.26Å; S45-Q47 PolarHBondContact O-N 3.12Å; S45-E48 PolarHBondContact N-OE2 3.43Å; S45-E48 PolarHBondContact O-N 3.44Å; S45-R49 PolarHBondContact O-N 2.94Å
46	E	73.7	Confident	75	Confident	118 Å²	118	110.1 Å²	110.1	55%	0.551	52%	0.52	S	S	*	.	H	α-helix	trans	-53.6	-31.2	175.9	-170.1	62.1	-161	0	0	111.7	Q50	E46-Q50 WeakPolarHBondContact O-CG 3.47Å; E46-Q50 PolarHBondContact O-N 3.42Å; E46-Q50 VanDerWaalsContact O-N 3.12Å
47	Q	72.6	Confident	75.5	Confident	151 Å²	151	108.5 Å²	108.5	71%	0.706	52%	0.522	S	S	*	.	H	α-helix	trans	-67.4	-46.6	173	-71.7	177.4	-27.3	0	0	112.9	S45 R49 Q50 E51	S45-Q47 PolarHBondContact O-N 3.12Å; Q47-R49 VanDerWaalsContact C-N 3.29Å; Q47-R49 PolarHBondContact O-N 2.86Å; Q47-Q50 PolarHBondContact O-N 2.9Å; Q47-E51 WeakPolarHBondContact O-CB 3.48Å; Q47-E51 PolarHBondContact O-N 2.91Å
48	E	72.4	Confident	76.4	Confident	93 Å²	93	106 Å²	106	44%	0.435	51%	0.514	S	S	.	.	H	α-helix	trans	-67.3	-32.1	178.9	-64.6	174.1	135.2	0	0	111.4	L44 S45 L52	L44-E48 WeakPolarHBondContact CA-OE2 3.47Å; L44-E48 HydrophobicContact CB-CB 4.35Å; L44-E48 HydrophobicContact CD2-CB 3.74Å; S45-E48 PolarHBondContact N-OE2 3.43Å; S45-E48 PolarHBondContact O-N 3.44Å; E48-L52 VanDerWaalsContact O-CB 3.26Å; E48-L52 WeakPolarHBondContact O-CB 3.18Å; E48-L52 PolarHBondContact O-N 2.87Å
49	R	79.7	Confident	77.3	Confident	76 Å²	76	105 Å²	105	29%	0.287	51%	0.514	S	S	.	.	H	α-helix	trans	-65.7	-44.9	172.7	-68.1	-172.1	63.3	-160.8	-13.8	111.9	L44 S45 Q47 E51 L52 E53	L44-R49 HydrophobicContact CB-CG 3.51Å; L44-R49 HydrophobicContact CD1-CG 4.28Å; L44-R49 HydrophobicContact CG-CG 4.49Å; S45-R49 PolarHBondContact O-N 2.94Å; Q47-R49 VanDerWaalsContact C-N 3.29Å; Q47-R49 PolarHBondContact O-N 2.86Å; R49-E51 VanDerWaalsContact C-N 3.35Å; R49-L52 PolarHBondContact O-N 2.94Å; R49-E53 WeakPolarHBondContact O-CB 3.32Å; R49-E53 WeakPolarHBondContact O-CG 3.39Å; R49-E53 PolarHBondContact O-N 3.06Å
50	Q	78.4	Confident	78.7	Confident	92 Å²	92	106.4 Å²	106.4	43%	0.43	52%	0.516	S	S	.	.	H	α-helix	trans	-66.6	-37	176.8	-74.5	178.3	14.8	0	0	112.2	E46 Q47 K54	E46-Q50 WeakPolarHBondContact O-CG 3.47Å; E46-Q50 PolarHBondContact O-N 3.42Å; E46-Q50 VanDerWaalsContact O-N 3.12Å; Q47-Q50 PolarHBondContact O-N 2.9Å; Q50-K54 WeakPolarHBondContact O-CB 3.37Å; Q50-K54 VanDerWaalsContact O-CG 3.25Å; Q50-K54 WeakPolarHBondContact O-CG 3.25Å; Q50-K54 PolarHBondContact O-N 2.93Å
51	E	81	Confident	79.8	Confident	123 Å²	123	104.7 Å²	104.7	58%	0.575	52%	0.516	S	S	*	.	H	α-helix	trans	-66.1	-44.9	175.2	-168.6	164.1	-155.2	0	0	111.1	Q47 R49 E53 K54 E55	Q47-E51 WeakPolarHBondContact O-CB 3.48Å; Q47-E51 PolarHBondContact O-N 2.91Å; R49-E51 VanDerWaalsContact C-N 3.35Å; E51-E53 PolarHBondContact O-N 3.45Å; E51-K54 WeakPolarHBondContact O-CB 3.33Å; E51-K54 PolarHBondContact O-N 3.42Å; E51-E55 WeakPolarHBondContact O-CG 3.46Å; E51-E55 PolarHBondContact O-N 2.91Å
52	L	81.9	Confident	81.2	Confident	72 Å²	72	108 Å²	108	38%	0.377	53%	0.525	S	S	.	.	H	α-helix	trans	-63	-40.8	175.2	-168.5	73.2	0	0	0	112.3	L44 E48 R49 K54 E55 M56	L44-L52 HydrophobicContact CD1-CD2 4.43Å; E48-L52 VanDerWaalsContact O-CB 3.26Å; E48-L52 WeakPolarHBondContact O-CB 3.18Å; E48-L52 PolarHBondContact O-N 2.87Å; R49-L52 PolarHBondContact O-N 2.94Å; L52-K54 VanDerWaalsContact C-N 3.34Å; L52-E55 PolarHBondContact O-N 3.49Å; L52-M56 HydrophobicContact CD2-CE 4.18Å; L52-M56 HydrophobicContact CG-CE 4.18Å; L52-M56 WeakPolarHBondContact O-CB 3.38Å; L52-M56 VanDerWaalsContact O-CG 3.32Å; L52-M56 WeakPolarHBondContact O-CG 3.26Å; L52-M56 PolarHBondContact O-N 2.84Å
53	E	84.4	Confident	82.6	Confident	123 Å²	123	107.3 Å²	107.3	58%	0.575	51%	0.512	S	S	*	.	H	α-helix	trans	-63.5	-39.4	174.5	-82.3	179.5	-175	0	0	111.9	R49 E51 M56 A57	R49-E53 WeakPolarHBondContact O-CB 3.32Å; R49-E53 WeakPolarHBondContact O-CG 3.39Å; R49-E53 PolarHBondContact O-N 3.06Å; E51-E53 PolarHBondContact O-N 3.45Å; E53-M56 PolarHBondContact O-N 3.36Å; E53-A57 WeakPolarHBondContact O-CB 3.26Å; E53-A57 PolarHBondContact O-N 2.99Å
54	K	86.3	Confident	84.1	Confident	137 Å²	137	102 Å²	102	60%	0.596	50%	0.497	S	S	*	.	H	α-helix	trans	-64.7	-45.2	173.6	-74.8	170.9	-175	173.4	0	111.5	Q50 E51 L52 A57 I58	Q50-K54 WeakPolarHBondContact O-CB 3.37Å; Q50-K54 VanDerWaalsContact O-CG 3.25Å; Q50-K54 WeakPolarHBondContact O-CG 3.25Å; Q50-K54 PolarHBondContact O-N 2.93Å; E51-K54 WeakPolarHBondContact O-CB 3.33Å; E51-K54 PolarHBondContact O-N 3.42Å; L52-K54 VanDerWaalsContact C-N 3.34Å; K54-A57 PolarHBondContact O-N 3.2Å; K54-I58 VanDerWaalsContact O-CG1 3.26Å; K54-I58 WeakPolarHBondContact O-CG1 3.49Å; K54-I58 PolarHBondContact O-N 3.25Å
55	E	87.4	Confident	85.5	Confident	106 Å²	106	105.4 Å²	105.4	50%	0.495	51%	0.509	S	S	.	.	H	α-helix	trans	-61.3	-45.1	176	-75.4	-168.1	155.9	0	0	111.6	E51 L52 A57 I58 I59	E51-E55 WeakPolarHBondContact O-CG 3.46Å; E51-E55 PolarHBondContact O-N 2.91Å; L52-E55 PolarHBondContact O-N 3.49Å; E55-A57 VanDerWaalsContact C-N 3.31Å; E55-A57 PolarHBondContact O-N 3.46Å; E55-I58 PolarHBondContact O-N 3.31Å; E55-I59 WeakPolarHBondContact O-CB 3.38Å; E55-I59 VanDerWaalsContact O-CG1 3.28Å; E55-I59 WeakPolarHBondContact O-CG1 3.38Å; E55-I59 PolarHBondContact O-N 3.27Å
56	M	88.4	Confident	86.7	Confident	118 Å²	118	107.4 Å²	107.4	58%	0.581	52%	0.515	S	S	*	.	H	α-helix	trans	-59.7	-42.1	174.8	-76.6	-170.2	-179.8	0	0	111.6	L52 E53 I59 N60	L52-M56 HydrophobicContact CD2-CE 4.18Å; L52-M56 HydrophobicContact CG-CE 4.18Å; L52-M56 WeakPolarHBondContact O-CB 3.38Å; L52-M56 VanDerWaalsContact O-CG 3.32Å; L52-M56 WeakPolarHBondContact O-CG 3.26Å; L52-M56 PolarHBondContact O-N 2.84Å; E53-M56 PolarHBondContact O-N 3.36Å; M56-I59 PolarHBondContact O-N 2.85Å; M56-N60 WeakPolarHBondContact O-CB 3.48Å; M56-N60 PolarHBondContact O-N 2.94Å
57	A	90.3	Very high	87.5	Confident	58 Å²	58	106.3 Å²	106.3	48%	0.479	51%	0.512	S	S	.	.	H	α-helix	trans	-62.2	-45.1	176.3	0	0	0	0	0	111.9	E53 K54 E55 N60 E61	E53-A57 WeakPolarHBondContact O-CB 3.26Å; E53-A57 PolarHBondContact O-N 2.99Å; K54-A57 PolarHBondContact O-N 3.2Å; E55-A57 VanDerWaalsContact C-N 3.31Å; E55-A57 PolarHBondContact O-N 3.46Å; A57-N60 PolarHBondContact O-N 2.95Å; A57-E61 WeakPolarHBondContact O-CB 3.49Å; A57-E61 PolarHBondContact O-N 2.92Å
58	I	92.8	Very high	88.4	Confident	83 Å²	83	106.3 Å²	106.3	43%	0.426	51%	0.51	S	S	.	.	H	α-helix	trans	-62.8	-45.6	177.8	-67.2	162.9	0	0	0	111	K54 E55 N60 E61 R62	K54-I58 VanDerWaalsContact O-CG1 3.26Å; K54-I58 WeakPolarHBondContact O-CG1 3.49Å; K54-I58 PolarHBondContact O-N 3.25Å; E55-I58 PolarHBondContact O-N 3.31Å; I58-N60 VanDerWaalsContact C-N 3.35Å; I58-E61 PolarHBondContact O-N 3.3Å; I58-R62 WeakPolarHBondContact O-CG 3.45Å; I58-R62 PolarHBondContact O-N 2.94Å; I58-R62 VanDerWaalsContact O-N 3.08Å
59	I	93.9	Very high	89.2	Confident	102 Å²	102	106.4 Å²	106.4	52%	0.523	51%	0.511	S	S	.	.	H	α-helix	trans	-63.6	-44.5	178.6	-68.6	168.5	0	0	0	109.9	E55 M56 E61 R62 V63	E55-I59 WeakPolarHBondContact O-CB 3.38Å; E55-I59 VanDerWaalsContact O-CG1 3.28Å; E55-I59 WeakPolarHBondContact O-CG1 3.38Å; E55-I59 PolarHBondContact O-N 3.27Å; M56-I59 PolarHBondContact O-N 2.85Å; I59-E61 PolarHBondContact O-N 2.97Å; I59-R62 WeakPolarHBondContact O-CB 3.39Å; I59-R62 PolarHBondContact O-N 3.14Å; I59-V63 HydrophobicContact CG2-CG2 4.45Å; I59-V63 WeakPolarHBondContact O-CG2 3.47Å; I59-V63 PolarHBondContact O-N 3.46Å
60	N	92.6	Very high	89.7	Confident	91 Å²	91	106.6 Å²	106.6	49%	0.487	52%	0.517	S	S	.	.	H	α-helix	trans	-63.5	-41	180	-164.6	25.1	0	0	0	111.8	M56 A57 I58 R62 V63 Q64	M56-N60 WeakPolarHBondContact O-CB 3.48Å; M56-N60 PolarHBondContact O-N 2.94Å; A57-N60 PolarHBondContact O-N 2.95Å; I58-N60 VanDerWaalsContact C-N 3.35Å; N60-R62 VanDerWaalsContact C-N 3.34Å; N60-R62 PolarHBondContact O-N 3.36Å; N60-V63 PolarHBondContact O-N 3.35Å; N60-Q64 WeakPolarHBondContact O-CG 3.28Å; N60-Q64 PolarHBondContact O-N 3.21Å
61	E	93.5	Very high	90.2	Very high	139 Å²	139	105.2 Å²	105.2	65%	0.65	52%	0.521	S	S	*	.	H	α-helix	trans	-61.4	-42.3	174.5	-170.3	-176.1	175.6	0	0	111.7	A57 I58 I59 Q64 K65	A57-E61 WeakPolarHBondContact O-CB 3.49Å; A57-E61 PolarHBondContact O-N 2.92Å; I58-E61 PolarHBondContact O-N 3.3Å; I59-E61 PolarHBondContact O-N 2.97Å; E61-Q64 PolarHBondContact O-N 3.46Å; E61-K65 PolarHBondContact O-N 3.45Å
62	R	94.5	Very high	90.5	Very high	172 Å²	172	105.1 Å²	105.1	65%	0.649	52%	0.522	S	S	*	.	H	α-helix	trans	-62.4	-43.9	175.7	-73.3	176.6	-179.3	-175.3	1.7	112	I58 I59 N60 K65 L66	I58-R62 WeakPolarHBondContact O-CG 3.45Å; I58-R62 PolarHBondContact O-N 2.94Å; I58-R62 VanDerWaalsContact O-N 3.08Å; I59-R62 WeakPolarHBondContact O-CB 3.39Å; I59-R62 PolarHBondContact O-N 3.14Å; N60-R62 VanDerWaalsContact C-N 3.34Å; N60-R62 PolarHBondContact O-N 3.36Å; R62-K65 PolarHBondContact O-N 2.87Å; R62-L66 WeakPolarHBondContact O-CG 3.34Å; R62-L66 PolarHBondContact O-N 2.97Å
63	V	94.8	Very high	90.6	Very high	68 Å²	68	106.6 Å²	106.6	41%	0.412	53%	0.53	S	S	.	.	H	α-helix	trans	-60	-47.9	176.4	171.2	0	0	0	0	110.4	I59 N60 K65 L66 D67	I59-V63 HydrophobicContact CG2-CG2 4.45Å; I59-V63 WeakPolarHBondContact O-CG2 3.47Å; I59-V63 PolarHBondContact O-N 3.46Å; N60-V63 PolarHBondContact O-N 3.35Å; V63-K65 VanDerWaalsContact C-N 3.29Å; V63-K65 PolarHBondContact O-N 3.25Å; V63-L66 PolarHBondContact O-N 3.49Å; V63-D67 PolarHBondContact O-N 2.94Å
64	Q	93.9	Very high	90.9	Very high	101 Å²	101	109.3 Å²	109.3	47%	0.472	54%	0.535	S	S	.	.	H	α-helix	trans	-61	-36.3	177.8	-72.5	-176.7	0.3	0	0	113.1	N60 E61 K68	N60-Q64 WeakPolarHBondContact O-CG 3.28Å; N60-Q64 PolarHBondContact O-N 3.21Å; E61-Q64 PolarHBondContact O-N 3.46Å; Q64-K68 WeakPolarHBondContact O-CG 3.47Å; Q64-K68 PolarHBondContact O-N 3.08Å; Q64-K68 VanDerWaalsContact O-N 3.14Å
65	K	93.4	Very high	90.8	Very high	133 Å²	133	104.4 Å²	104.4	58%	0.578	52%	0.523	S	S	*	.	H	α-helix	trans	-65.6	-46.2	175.7	-172.8	179.8	176.1	-173.9	0	111.3	E61 R62 V63 D67 K68 E69	E61-K65 PolarHBondContact O-N 3.45Å; R62-K65 PolarHBondContact O-N 2.87Å; V63-K65 VanDerWaalsContact C-N 3.29Å; V63-K65 PolarHBondContact O-N 3.25Å; K65-D67 VanDerWaalsContact C-N 3.33Å; K65-D67 PolarHBondContact O-N 3.47Å; K65-K68 PolarHBondContact O-N 2.89Å; K65-E69 VanDerWaalsContact CE-OE1 3.25Å; K65-E69 WeakPolarHBondContact CE-OE1 3.39Å; K65-E69 PolarHBondContact O-N 3.31Å
66	L	93.7	Very high	90.7	Very high	100 Å²	100	103.3 Å²	103.3	52%	0.524	52%	0.517	S	S	.	.	H	α-helix	trans	-62	-40.3	177.3	-70.5	170.8	0	0	0	111.9	R62 V63 K68 E69 L70	R62-L66 WeakPolarHBondContact O-CG 3.34Å; R62-L66 PolarHBondContact O-N 2.97Å; V63-L66 PolarHBondContact O-N 3.49Å; L66-K68 VanDerWaalsContact C-N 3.33Å; L66-K68 PolarHBondContact O-N 3.46Å; L66-E69 PolarHBondContact O-N 3.03Å; L66-L70 WeakPolarHBondContact O-CB 3.38Å; L66-L70 PolarHBondContact O-N 3.31Å
67	D	91.1	Very high	90.6	Very high	94 Å²	94	103.1 Å²	103.1	50%	0.503	52%	0.519	S	S	.	.	H	α-helix	trans	-62.6	-39.6	176	-79.3	-24.4	0	0	0	112.2	V63 K65 L70 A71	V63-D67 PolarHBondContact O-N 2.94Å; K65-D67 VanDerWaalsContact C-N 3.33Å; K65-D67 PolarHBondContact O-N 3.47Å; D67-L70 PolarHBondContact O-N 3.31Å; D67-A71 WeakPolarHBondContact O-CB 3.25Å; D67-A71 PolarHBondContact O-N 3.45Å
68	K	91.6	Very high	90.3	Very high	152 Å²	152	109.6 Å²	109.6	66%	0.661	53%	0.531	S	S	*	.	H	α-helix	trans	-64.8	-44.7	174.9	-74.7	173.7	-177.8	173.4	0	112	Q64 K65 L66 A71 M72	Q64-K68 WeakPolarHBondContact O-CG 3.47Å; Q64-K68 PolarHBondContact O-N 3.08Å; Q64-K68 VanDerWaalsContact O-N 3.14Å; K65-K68 PolarHBondContact O-N 2.89Å; L66-K68 VanDerWaalsContact C-N 3.33Å; L66-K68 PolarHBondContact O-N 3.46Å; K68-A71 PolarHBondContact O-N 3.23Å; K68-M72 WeakPolarHBondContact O-CB 3.4Å; K68-M72 PolarHBondContact O-N 3.18Å
69	E	90.5	Very high	89.9	Confident	95 Å²	95	114.3 Å²	114.3	44%	0.444	54%	0.543	S	S	.	.	H	α-helix	trans	-62.5	-43.3	176.5	-72.5	175.9	-168.9	0	0	111	K65 L66 A71 M72 L73	K65-E69 VanDerWaalsContact CE-OE1 3.25Å; K65-E69 WeakPolarHBondContact CE-OE1 3.39Å; K65-E69 PolarHBondContact O-N 3.31Å; L66-E69 PolarHBondContact O-N 3.03Å; E69-A71 PolarHBondContact O-N 3.46Å; E69-M72 PolarHBondContact O-N 3.02Å; E69-L73 WeakPolarHBondContact O-CB 3.31Å; E69-L73 WeakPolarHBondContact O-CG 3.48Å; E69-L73 PolarHBondContact O-N 3.04Å
70	L	89.1	Confident	89.6	Confident	80 Å²	80	114.4 Å²	114.4	42%	0.419	55%	0.545	S	S	.	.	H	α-helix	trans	-61.4	-42.5	174.1	-84.5	169.4	0	0	0	112.8	L66 D67 R74	L66-L70 WeakPolarHBondContact O-CB 3.38Å; L66-L70 PolarHBondContact O-N 3.31Å; D67-L70 PolarHBondContact O-N 3.31Å; L70-R74 WeakPolarHBondContact O-CB 3.34Å; L70-R74 WeakPolarHBondContact O-CG 3.38Å; L70-R74 PolarHBondContact O-N 3.46Å
71	A	88.8	Confident	89.5	Confident	62 Å²	62	116.1 Å²	116.1	51%	0.512	55%	0.552	S	S	.	*	H	α-helix	trans	-64.1	-42	177.3	0	0	0	0	0	111.5	D67 K68 E69 R74 G75	D67-A71 WeakPolarHBondContact O-CB 3.25Å; D67-A71 PolarHBondContact O-N 3.45Å; K68-A71 PolarHBondContact O-N 3.23Å; E69-A71 PolarHBondContact O-N 3.46Å; A71-R74 PolarHBondContact O-N 2.91Å; A71-G75 PolarHBondContact O-N 2.87Å
72	M	88.4	Confident	89.3	Confident	121 Å²	121	113.9 Å²	113.9	60%	0.596	55%	0.547	S	S	*	.	H	α-helix	trans	-62.3	-50.6	175.9	-176.5	173.9	173.6	0	0	111.3	K68 E69 R74 G75 E76	K68-M72 WeakPolarHBondContact O-CB 3.4Å; K68-M72 PolarHBondContact O-N 3.18Å; E69-M72 PolarHBondContact O-N 3.02Å; M72-R74 VanDerWaalsContact C-N 3.34Å; M72-R74 PolarHBondContact O-N 3.06Å; M72-G75 WeakPolarHBondContact O-CA 3.41Å; M72-G75 PolarHBondContact O-N 3.1Å; M72-E76 WeakPolarHBondContact CE-OE1 3.46Å; M72-E76 PolarHBondContact O-N 3.07Å
73	L	84.3	Confident	89.2	Confident	104 Å²	104	110.7 Å²	110.7	55%	0.545	54%	0.543	S	S	.	.	H	α-helix	trans	-61.4	-39.2	178.7	-71.9	172.3	0	0	0	112.4	E69 G75 E76 N77	E69-L73 WeakPolarHBondContact O-CB 3.31Å; E69-L73 WeakPolarHBondContact O-CG 3.48Å; E69-L73 PolarHBondContact O-N 3.04Å; L73-G75 VanDerWaalsContact C-N 3.33Å; L73-E76 PolarHBondContact O-N 3.38Å; L73-N77 WeakPolarHBondContact O-CB 3.41Å; L73-N77 PolarHBondContact O-N 3.37Å
74	R	88.9	Confident	89	Confident	180 Å²	180	111.1 Å²	111.1	68%	0.679	55%	0.549	S	S	*	.	H	α-helix	trans	-64.8	-37.9	173.1	-78.4	-179.9	172.8	141.1	-1.2	112.1	L70 A71 M72 R78	L70-R74 WeakPolarHBondContact O-CB 3.34Å; L70-R74 WeakPolarHBondContact O-CG 3.38Å; L70-R74 PolarHBondContact O-N 3.46Å; A71-R74 PolarHBondContact O-N 2.91Å; M72-R74 VanDerWaalsContact C-N 3.34Å; M72-R74 PolarHBondContact O-N 3.06Å; R74-R78 WeakPolarHBondContact O-CB 3.46Å; R74-R78 PolarHBondContact O-N 2.86Å
75	G	84.8	Confident	89	Confident	33 Å²	33	110 Å²	110	34%	0.34	55%	0.549	S	S	.	.	H	α-helix	trans	-61.7	-45.8	173.9	0	0	0	0	0	112.2	A71 M72 L73 R78 R79	A71-G75 PolarHBondContact O-N 2.87Å; M72-G75 WeakPolarHBondContact O-CA 3.41Å; M72-G75 PolarHBondContact O-N 3.1Å; L73-G75 VanDerWaalsContact C-N 3.33Å; G75-R78 PolarHBondContact O-N 3.39Å; G75-R79 WeakPolarHBondContact O-CG 3.33Å; G75-R79 PolarHBondContact O-N 2.93Å; G75-R79 VanDerWaalsContact O-N 3.1Å
76	E	85.5	Confident	89.1	Confident	83 Å²	83	105.9 Å²	105.9	39%	0.388	54%	0.539	S	S	.	.	H	α-helix	trans	-66.4	-43.3	176.7	-70.8	-177.9	167.8	0	0	112.3	M72 L73 R78 R79 N80	M72-E76 WeakPolarHBondContact CE-OE1 3.46Å; M72-E76 PolarHBondContact O-N 3.07Å; L73-E76 PolarHBondContact O-N 3.38Å; E76-R78 VanDerWaalsContact C-N 3.3Å; E76-R78 PolarHBondContact O-N 2.94Å; E76-R79 WeakPolarHBondContact O-CB 3.4Å; E76-R79 PolarHBondContact O-N 3.42Å; E76-R79 VanDerWaalsContact O-N 3.07Å; E76-N80 PolarHBondContact O-N 3.37Å
77	N	85.7	Confident	89.1	Confident	114 Å²	114	106.6 Å²	106.6	61%	0.61	54%	0.543	S	S	*	.	H	α-helix	trans	-61.1	-40.5	177.4	-163.8	-3.1	0	0	0	111.4	L73 R79 N80 M81	L73-N77 WeakPolarHBondContact O-CB 3.41Å; L73-N77 PolarHBondContact O-N 3.37Å; N77-R79 PolarHBondContact O-N 2.9Å; N77-N80 PolarHBondContact O-N 3.04Å; N77-M81 WeakPolarHBondContact O-CB 3.38Å; N77-M81 PolarHBondContact O-N 3.4Å
78	R	84.5	Confident	89.3	Confident	194 Å²	194	108.1 Å²	108.1	73%	0.732	55%	0.55	S	S	*	*	H	α-helix	trans	-62.3	-41.6	173.3	-171.4	178.3	-179	-174.6	0.7	111.9	R74 G75 E76 V82	R74-R78 WeakPolarHBondContact O-CB 3.46Å; R74-R78 PolarHBondContact O-N 2.86Å; G75-R78 PolarHBondContact O-N 3.39Å; E76-R78 VanDerWaalsContact C-N 3.3Å; E76-R78 PolarHBondContact O-N 2.94Å; R78-V82 VanDerWaalsContact O-CG2 3.31Å; R78-V82 WeakPolarHBondContact O-CG2 3.36Å; R78-V82 PolarHBondContact O-N 2.91Å
79	R	85.4	Confident	89.4	Confident	182 Å²	182	104.1 Å²	104.1	69%	0.687	54%	0.539	S	S	*	.	H	α-helix	trans	-64.5	-45.4	176.2	-72.4	175.1	179.5	179.2	0.1	111.5	G75 E76 N77 M81 V82 L83	G75-R79 WeakPolarHBondContact O-CG 3.33Å; G75-R79 PolarHBondContact O-N 2.93Å; G75-R79 VanDerWaalsContact O-N 3.1Å; E76-R79 WeakPolarHBondContact O-CB 3.4Å; E76-R79 PolarHBondContact O-N 3.42Å; E76-R79 VanDerWaalsContact O-N 3.07Å; N77-R79 PolarHBondContact O-N 2.9Å; R79-M81 VanDerWaalsContact C-N 3.34Å; R79-M81 PolarHBondContact O-N 3.26Å; R79-V82 PolarHBondContact O-N 3.46Å; R79-L83 WeakPolarHBondContact O-CG 3.49Å; R79-L83 PolarHBondContact O-N 3.37Å
80	N	87.6	Confident	89.6	Confident	104 Å²	104	103.8 Å²	103.8	56%	0.556	54%	0.539	S	S	*	.	H	α-helix	trans	-62.9	-41.3	178.2	-74	-3.1	0	0	0	111.8	E76 N77 L83 S84	E76-N80 PolarHBondContact O-N 3.37Å; N77-N80 PolarHBondContact O-N 3.04Å; N80-L83 PolarHBondContact O-N 3.47Å; N80-S84 WeakPolarHBondContact O-CB 3.39Å; N80-S84 PolarHBondContact O-N 2.91Å
81	M	89.3	Confident	89.8	Confident	128 Å²	128	103.6 Å²	103.6	63%	0.631	54%	0.544	S	S	*	.	H	α-helix	trans	-60	-48.8	174.2	-175.3	-171.2	176.4	0	0	111.3	N77 R79 L83 S84 V85	N77-M81 WeakPolarHBondContact O-CB 3.38Å; N77-M81 PolarHBondContact O-N 3.4Å; R79-M81 VanDerWaalsContact C-N 3.34Å; R79-M81 PolarHBondContact O-N 3.26Å; M81-L83 VanDerWaalsContact C-N 3.32Å; M81-L83 PolarHBondContact O-N 2.82Å; M81-S84 PolarHBondContact O-N 2.97Å; M81-V85 WeakPolarHBondContact O-CG2 3.32Å; M81-V85 PolarHBondContact O-N 3.24Å
82	V	89.8	Confident	89.9	Confident	91 Å²	91	103.2 Å²	103.2	55%	0.552	54%	0.541	S	S	*	.	H	α-helix	trans	-61.1	-41.3	178.7	170.6	0	0	0	0	111.4	R78 R79 V85 A86	R78-V82 VanDerWaalsContact O-CG2 3.31Å; R78-V82 WeakPolarHBondContact O-CG2 3.36Å; R78-V82 PolarHBondContact O-N 2.91Å; R79-V82 PolarHBondContact O-N 3.46Å; V82-V85 PolarHBondContact O-N 2.88Å; V82-A86 WeakPolarHBondContact O-CB 3.34Å; V82-A86 PolarHBondContact O-N 2.94Å
83	L	91.5	Very high	90.1	Very high	106 Å²	106	102.4 Å²	102.4	56%	0.555	54%	0.539	S	S	*	.	H	α-helix	trans	-62.7	-44.1	175.9	-72.1	172.1	0	0	0	112	R79 N80 M81 V85 A86 L87	R79-L83 WeakPolarHBondContact O-CG 3.49Å; R79-L83 PolarHBondContact O-N 3.37Å; N80-L83 PolarHBondContact O-N 3.47Å; M81-L83 VanDerWaalsContact C-N 3.32Å; M81-L83 PolarHBondContact O-N 2.82Å; L83-V85 PolarHBondContact O-N 3.35Å; L83-A86 PolarHBondContact O-N 2.93Å; L83-L87 WeakPolarHBondContact O-CG 3.33Å; L83-L87 PolarHBondContact O-N 2.72Å
84	S	91.9	Very high	90.6	Very high	77 Å²	77	103.1 Å²	103.1	54%	0.538	54%	0.538	S	S	.	.	H	α-helix	trans	-61.3	-44.1	176.6	179.5	0	0	0	0	112	N80 M81 L87 L88	N80-S84 WeakPolarHBondContact O-CB 3.39Å; N80-S84 PolarHBondContact O-N 2.91Å; M81-S84 PolarHBondContact O-N 2.97Å; S84-L87 PolarHBondContact O-N 3.29Å; S84-L88 WeakPolarHBondContact O-CB 3.39Å; S84-L88 PolarHBondContact O-N 2.91Å
85	V	93.7	Very high	90.7	Very high	78 Å²	78	101.3 Å²	101.3	47%	0.473	53%	0.532	S	S	.	.	H	α-helix	trans	-64.5	-41.3	176.4	173	0	0	0	0	111.5	M81 V82 L83 L88 T89	M81-V85 WeakPolarHBondContact O-CG2 3.32Å; M81-V85 PolarHBondContact O-N 3.24Å; V82-V85 PolarHBondContact O-N 2.88Å; L83-V85 PolarHBondContact O-N 3.35Å; V85-L88 PolarHBondContact O-N 3.42Å; V85-T89 WeakPolarHBondContact O-CB 3.44Å; V85-T89 PolarHBondContact O-N 2.89Å; V85-T89 PolarHBondContact O-OG1 2.98Å
86	A	94.3	Very high	90.9	Very high	45 Å²	45	106.1 Å²	106.1	37%	0.372	54%	0.541	S	S	.	.	H	α-helix	trans	-61.9	-46.5	177.7	0	0	0	0	0	111.5	V82 L83 L88 T89 I90	V82-A86 WeakPolarHBondContact O-CB 3.34Å; V82-A86 PolarHBondContact O-N 2.94Å; L83-A86 PolarHBondContact O-N 2.93Å; A86-L88 PolarHBondContact O-N 3.28Å; A86-T89 PolarHBondContact O-N 3.36Å; A86-I90 VanDerWaalsContact O-CG1 3.28Å; A86-I90 WeakPolarHBondContact O-CG1 3.4Å; A86-I90 PolarHBondContact O-N 3.31Å
87	L	95.3	Very high	91	Very high	116 Å²	116	106.1 Å²	106.1	61%	0.607	55%	0.546	S	S	*	.	H	α-helix	trans	-61.1	-45	176	-71.5	173.1	0	0	0	111.7	L83 S84 T89 I90 S91	L83-L87 WeakPolarHBondContact O-CG 3.33Å; L83-L87 PolarHBondContact O-N 2.72Å; S84-L87 PolarHBondContact O-N 3.29Å; L87-T89 VanDerWaalsContact C-N 3.3Å; L87-T89 PolarHBondContact O-N 2.98Å; L87-I90 PolarHBondContact O-N 3.5Å; L87-S91 WeakPolarHBondContact O-CB 3.24Å; L87-S91 PolarHBondContact O-N 3.5Å; L87-S91 PolarHBondContact O-OG 2.83Å; L87-S91 VanDerWaalsContact O-OG 3.06Å
88	L	93.6	Very high	90.8	Very high	125 Å²	125	106 Å²	106	65%	0.654	54%	0.541	S	S	*	.	H	α-helix	trans	-60.9	-41.9	177.5	-169.5	106.4	0	0	0	111.5	S84 V85 A86 S91 A92	S84-L88 WeakPolarHBondContact O-CB 3.39Å; S84-L88 PolarHBondContact O-N 2.91Å; V85-L88 PolarHBondContact O-N 3.42Å; A86-L88 PolarHBondContact O-N 3.28Å; L88-S91 PolarHBondContact O-N 3.46Å; L88-A92 WeakPolarHBondContact O-CB 3.3Å; L88-A92 PolarHBondContact O-N 3.36Å
89	T	94.4	Very high	90.3	Very high	69 Å²	69	102.7 Å²	102.7	42%	0.423	53%	0.532	S	S	.	.	H	α-helix	trans	-65.8	-44.6	179.4	-54.2	0	0	0	0	111	V85 A86 L87 A92 L93	V85-T89 WeakPolarHBondContact O-CB 3.44Å; V85-T89 PolarHBondContact O-N 2.89Å; V85-T89 PolarHBondContact O-OG1 2.98Å; A86-T89 PolarHBondContact O-N 3.36Å; L87-T89 VanDerWaalsContact C-N 3.3Å; L87-T89 PolarHBondContact O-N 2.98Å; T89-A92 PolarHBondContact O-N 3.5Å; T89-L93 HydrophobicContact CG2-CD1 4.43Å; T89-L93 WeakPolarHBondContact O-CG 3.39Å; T89-L93 PolarHBondContact O-N 3.43Å
90	I	95.3	Very high	89.6	Confident	87 Å²	87	98.9 Å²	98.9	45%	0.446	52%	0.518	S	S	.	.	H	α-helix	trans	-60.2	-47.9	175.7	-69.9	166.8	0	0	0	110.1	A86 L87 A92 L93 F94	A86-I90 VanDerWaalsContact O-CG1 3.28Å; A86-I90 WeakPolarHBondContact O-CG1 3.4Å; A86-I90 PolarHBondContact O-N 3.31Å; L87-I90 PolarHBondContact O-N 3.5Å; I90-A92 VanDerWaalsContact C-N 3.33Å; I90-A92 PolarHBondContact O-N 2.73Å; I90-L93 PolarHBondContact O-N 3.47Å; I90-F94 HydrophobicContact CG2-CD2 3.55Å; I90-F94 HydrophobicContact CG2-CE2 3.38Å; I90-F94 WeakPolarHBondContact O-CD2 3.28Å; I90-F94 PolarHBondContact O-N 3.36Å
91	S	92.4	Very high	88.5	Confident	76 Å²	76	97.7 Å²	97.7	53%	0.531	51%	0.512	S	S	.	.	H	α-helix	trans	-60.1	-41	176.8	-63.1	0	0	0	0	112.6	L87 L88 F94 Y95	L87-S91 WeakPolarHBondContact O-CB 3.24Å; L87-S91 PolarHBondContact O-N 3.5Å; L87-S91 PolarHBondContact O-OG 2.83Å; L87-S91 VanDerWaalsContact O-OG 3.06Å; L88-S91 PolarHBondContact O-N 3.46Å; S91-F94 PolarHBondContact O-N 2.86Å; S91-Y95 WeakPolarHBondContact O-CB 3.35Å; S91-Y95 PolarHBondContact O-N 2.91Å
92	A	91.9	Very high	87.2	Confident	55 Å²	55	98.2 Å²	98.2	46%	0.455	51%	0.513	S	S	.	.	H	α-helix	trans	-66	-39.3	176.6	0	0	0	0	0	112.2	L88 T89 I90 Y95 Y96	L88-A92 WeakPolarHBondContact O-CB 3.3Å; L88-A92 PolarHBondContact O-N 3.36Å; T89-A92 PolarHBondContact O-N 3.5Å; I90-A92 VanDerWaalsContact C-N 3.33Å; I90-A92 PolarHBondContact O-N 2.73Å; A92-Y95 PolarHBondContact O-N 2.87Å; A92-Y96 WeakPolarHBondContact O-CB 3.18Å; A92-Y96 PolarHBondContact O-N 3.38Å
93	L	92.7	Very high	85.7	Confident	103 Å²	103	100.3 Å²	100.3	54%	0.539	52%	0.52	S	S	.	.	H	α-helix	trans	-64.1	-43.9	173.8	-72.1	173.3	0	0	0	111.4	T89 I90 Y96 V97	T89-L93 HydrophobicContact CG2-CD1 4.43Å; T89-L93 WeakPolarHBondContact O-CG 3.39Å; T89-L93 PolarHBondContact O-N 3.43Å; I90-L93 PolarHBondContact O-N 3.47Å; L93-Y96 PolarHBondContact O-N 3.23Å; L93-V97 VanDerWaalsContact O-CB 3.3Å; L93-V97 WeakPolarHBondContact O-CB 3.47Å; L93-V97 VanDerWaalsContact O-CG2 3.24Å; L93-V97 WeakPolarHBondContact O-CG2 3.48Å; L93-V97 PolarHBondContact O-N 2.87Å
94	F	93.3	Very high	84	Confident	120 Å²	120	100.8 Å²	100.8	53%	0.526	52%	0.524	S	S	.	.	H	α-helix	trans	-61.1	-44.5	173.7	-82.3	-67	0	0	0	111.6	I90 S91 Y96 V97 F98	I90-F94 HydrophobicContact CG2-CD2 3.55Å; I90-F94 HydrophobicContact CG2-CE2 3.38Å; I90-F94 WeakPolarHBondContact O-CD2 3.28Å; I90-F94 PolarHBondContact O-N 3.36Å; S91-F94 PolarHBondContact O-N 2.86Å; F94-Y96 PolarHBondContact O-N 3.41Å; F94-V97 PolarHBondContact O-N 3.4Å; F94-F98 AromaticContact CD1-CD2 3.71Å; F94-F98 HydrophobicContact CD1-CD2 3.71Å; F94-F98 AromaticContact CD1-CE2 3.48Å; F94-F98 HydrophobicContact CD1-CE2 3.48Å; F94-F98 VanDerWaalsContact CD1-CE2 3.48Å; F94-F98 HydrophobicContact CE1-CD2 4.5Å; F94-F98 AromaticContact CE1-CE2 3.83Å; F94-F98 HydrophobicContact CE1-CE2 3.83Å; F94-F98 WeakPolarHBondContact O-CB 3.38Å; F94-F98 WeakPolarHBondContact O-CD2 3.42Å; F94-F98 PolarHBondContact O-N 2.92Å
95	Y	91.8	Very high	82	Confident	141 Å²	141	105.9 Å²	105.9	55%	0.553	55%	0.552	S	S	*	*	I	π-helix	trans	-59.7	-46.1	176.2	179.9	-100.4	0	0	0	111.9	S91 A92 F99 Y100	S91-Y95 WeakPolarHBondContact O-CB 3.35Å; S91-Y95 PolarHBondContact O-N 2.91Å; A92-Y95 PolarHBondContact O-N 2.87Å; Y95-F99 HydrophobicContact CD2-CB 3.93Å; Y95-F99 HydrophobicContact CD2-CD2 4.16Å; Y95-F99 HydrophobicContact CD2-CG 4.23Å; Y95-F99 HydrophobicContact CE2-CB 3.93Å; Y95-F99 HydrophobicContact CE2-CG 4.43Å; Y95-F99 WeakPolarHBondContact O-CA 3.39Å; Y95-F99 WeakPolarHBondContact O-CB 3.43Å; Y95-F99 PolarHBondContact O-N 3.06Å; Y95-Y100 PolarHBondContact O-N 3.11Å
96	Y	89.8	Confident	81.4	Confident	135 Å²	135	107.3 Å²	107.3	53%	0.529	56%	0.556	S	S	.	*	I	π-helix	trans	-66.2	-47.1	179	-171.4	-95.4	0	0	0	112	A92 L93 F94 Y100 N101	A92-Y96 WeakPolarHBondContact O-CB 3.18Å; A92-Y96 PolarHBondContact O-N 3.38Å; L93-Y96 PolarHBondContact O-N 3.23Å; F94-Y96 PolarHBondContact O-N 3.41Å; Y96-Y100 AromaticContact CD2-CD1 3.76Å; Y96-Y100 HydrophobicContact CD2-CD1 3.76Å; Y96-Y100 HydrophobicContact CD2-CE1 4.49Å; Y96-Y100 HydrophobicContact CD2-CG 4.01Å; Y96-Y100 AromaticContact CE2-CD1 3.44Å; Y96-Y100 HydrophobicContact CE2-CD1 3.44Å; Y96-Y100 VanDerWaalsContact CE2-CD1 3.44Å; Y96-Y100 AromaticContact CE2-CE1 3.77Å; Y96-Y100 HydrophobicContact CE2-CE1 3.77Å; Y96-Y100 HydrophobicContact CE2-CG 4.09Å; Y96-Y100 AromaticContact CZ-CD1 3.95Å; Y96-Y100 WeakPolarHBondContact O-CB 3.44Å; Y96-N101 PolarHBondContact O-N 3.14Å; Y96-N101 PolarHBondContact O-ND2 3.44Å
97	V	87.5	Confident	80.7	Confident	82 Å²	82	110.5 Å²	110.5	50%	0.497	57%	0.565	S	S	.	*	I	π-helix	trans	-70.4	-40.3	-176	171.4	0	0	0	0	112.4	L93 F94 N101	L93-V97 VanDerWaalsContact O-CB 3.3Å; L93-V97 WeakPolarHBondContact O-CB 3.47Å; L93-V97 VanDerWaalsContact O-CG2 3.24Å; L93-V97 WeakPolarHBondContact O-CG2 3.48Å; L93-V97 PolarHBondContact O-N 2.87Å; F94-V97 PolarHBondContact O-N 3.4Å; V97-N101 PolarHBondContact O-ND2 3.3Å
98	F	81.8	Confident	79.9	Confident	113 Å²	113	110.2 Å²	110.2	50%	0.496	56%	0.563	S	S	.	*	I	π-helix	trans	-94	-52.4	-174.9	-72.4	-89.9	0	0	0	112.4	F94 E102	F94-F98 AromaticContact CD1-CD2 3.71Å; F94-F98 HydrophobicContact CD1-CD2 3.71Å; F94-F98 AromaticContact CD1-CE2 3.48Å; F94-F98 HydrophobicContact CD1-CE2 3.48Å; F94-F98 VanDerWaalsContact CD1-CE2 3.48Å; F94-F98 HydrophobicContact CE1-CD2 4.5Å; F94-F98 AromaticContact CE1-CE2 3.83Å; F94-F98 HydrophobicContact CE1-CE2 3.83Å; F94-F98 WeakPolarHBondContact O-CB 3.38Å; F94-F98 WeakPolarHBondContact O-CD2 3.42Å; F94-F98 PolarHBondContact O-N 2.92Å; F98-E102 WeakPolarHBondContact O-CB 3.47Å; F98-E102 WeakPolarHBondContact O-CG 3.4Å; F98-E102 PolarHBondContact O-N 3Å
99	F	73.4	Confident	79.1	Confident	124 Å²	124	109.4 Å²	109.4	54%	0.544	56%	0.557	S	S	.	*	I	π-helix	trans	-86.9	-45.6	-172	-68.3	-86.5	0	0	0	112.7	Y95 N101 E102 D103	Y95-F99 HydrophobicContact CD2-CB 3.93Å; Y95-F99 HydrophobicContact CD2-CD2 4.16Å; Y95-F99 HydrophobicContact CD2-CG 4.23Å; Y95-F99 HydrophobicContact CE2-CB 3.93Å; Y95-F99 HydrophobicContact CE2-CG 4.43Å; Y95-F99 WeakPolarHBondContact O-CA 3.39Å; Y95-F99 WeakPolarHBondContact O-CB 3.43Å; Y95-F99 PolarHBondContact O-N 3.06Å; F99-N101 PolarHBondContact O-N 3.46Å; F99-E102 PolarHBondContact O-N 2.96Å; F99-D103 PolarHBondContact O-N 2.9Å
100	Y	71.4	Confident	78.1	Confident	102 Å²	102	111.9 Å²	111.9	40%	0.4	57%	0.566	S	S	.	*	I	π-helix	trans	-68.7	-33.8	-178.6	-176.8	-92.4	0	0	0	112.7	Y95 Y96 D104	Y95-Y100 PolarHBondContact O-N 3.11Å; Y96-Y100 AromaticContact CD2-CD1 3.76Å; Y96-Y100 HydrophobicContact CD2-CD1 3.76Å; Y96-Y100 HydrophobicContact CD2-CE1 4.49Å; Y96-Y100 HydrophobicContact CD2-CG 4.01Å; Y96-Y100 AromaticContact CE2-CD1 3.44Å; Y96-Y100 HydrophobicContact CE2-CD1 3.44Å; Y96-Y100 VanDerWaalsContact CE2-CD1 3.44Å; Y96-Y100 AromaticContact CE2-CE1 3.77Å; Y96-Y100 HydrophobicContact CE2-CE1 3.77Å; Y96-Y100 HydrophobicContact CE2-CG 4.09Å; Y96-Y100 AromaticContact CZ-CD1 3.95Å; Y96-Y100 WeakPolarHBondContact O-CB 3.44Å; Y100-D104 WeakPolarHBondContact CE1-OD2 3.35Å; Y100-D104 PolarHBondContact OH-OD2 3.21Å; Y100-D104 VanDerWaalsContact OH-OD2 3.11Å
101	N	64.4	Low	77	Confident	79 Å²	79	113.5 Å²	113.5	42%	0.422	57%	0.574	S	S	.	*	H	α-helix	trans	-77.2	-24.6	174.9	-74.1	-85.7	0	0	0	113.3	Y96 V97 F99 T105	Y96-N101 PolarHBondContact O-N 3.14Å; Y96-N101 PolarHBondContact O-ND2 3.44Å; V97-N101 PolarHBondContact O-ND2 3.3Å; F99-N101 PolarHBondContact O-N 3.46Å; N101-T105 PolarHBondContact O-OG1 3.31Å; N101-T105 VanDerWaalsContact O-OG1 3.14Å
102	E	60.4	Low	75.9	Confident	139 Å²	139	116.2 Å²	116.2	65%	0.65	58%	0.577	S	S	*	*	H	α-helix	trans	-72.8	-30.8	172.5	-90.7	178.1	143.3	0	0	112.4	F98 F99	F98-E102 WeakPolarHBondContact O-CB 3.47Å; F98-E102 WeakPolarHBondContact O-CG 3.4Å; F98-E102 PolarHBondContact O-N 3Å; F99-E102 PolarHBondContact O-N 2.96Å
103	D	58.2	Low	74.6	Confident	134 Å²	134	120.9 Å²	120.9	72%	0.717	59%	0.586	S	S	*	*	H	α-helix	trans	-78.6	-17	179.3	-72.8	-35.7	0	0	0	113.8	F99	F99-D103 PolarHBondContact O-N 2.9Å
104	D	56.8	Low	73.1	Confident	117 Å²	117	122.4 Å²	122.4	63%	0.626	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.3	11.5	-176.7	-107.3	-23	0	0	0	114.2	Y100	Y100-D104 WeakPolarHBondContact CE1-OD2 3.35Å; Y100-D104 PolarHBondContact OH-OD2 3.21Å; Y100-D104 VanDerWaalsContact OH-OD2 3.11Å
105	T	48.8	Very low	71.3	Confident	183 Å²	183	122.6 Å²	122.6	100%	1.123	60%	0.596	S	S	*	*			trans	-115.6	0	173.6	-8.3	0	0	0	0	112.6	N101	N101-T105 PolarHBondContact O-OG1 3.31Å; N101-T105 VanDerWaalsContact O-OG1 3.14Å

Retrieved 105 of 105 residues in 102.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).