A0A087X496_POEFO Loading...

V-type proton ATPase subunit E 1

Subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment.

AlphaFold DB , UniProt , Accession A0A087X496, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 80 aa.

						>A0A087X496_POEFO|A0A087X496
MADQFAIVMSVMTLFWGIVGGVVPWFIPKGPNRGVIVTMLVLTAVCCYLFWLIAILAQLNPLFGPSLSTDIIQYLKLAWD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.3	Low	87.4	Confident	197 Å²	197	90.2 Å²	90.2	97%	0.97	51%	0.51	S	S	*	.				0	-54.2	0	-155.2	-173.6	-65.7	0	0	112.1	D3 Q4 F5	M1-D3 WeakPolarHBondContact CA-OD1 3.38Å; M1-D3 PolarHBondContact N-OD1 3.2Å; M1-Q4 PolarHBondContact O-N 3.11Å; M1-F5 WeakPolarHBondContact O-CB 3.31Å; M1-F5 PolarHBondContact O-N 3.27Å
2	A	73.1	Confident	88.2	Confident	81 Å²	81	88.1 Å²	88.1	67%	0.669	50%	0.495	S	S	*	.	H	α-helix	trans	-65.1	-37	177.4	0	0	0	0	0	113.3	A6	A2-A6 VanDerWaalsContact O-CB 3.27Å; A2-A6 WeakPolarHBondContact O-CB 3.39Å; A2-A6 PolarHBondContact O-N 3.02Å
3	D	80.5	Confident	88.8	Confident	109 Å²	109	86.2 Å²	86.2	58%	0.583	49%	0.486	S	S	*	.	H	α-helix	trans	-59	-51.8	171	57	-27.6	0	0	0	112.2	M1 F5 A6 I7	M1-D3 WeakPolarHBondContact CA-OD1 3.38Å; M1-D3 PolarHBondContact N-OD1 3.2Å; D3-F5 VanDerWaalsContact C-N 3.35Å; D3-F5 PolarHBondContact O-N 2.98Å; D3-A6 PolarHBondContact O-N 3.11Å; D3-I7 VanDerWaalsContact O-CG1 3.27Å; D3-I7 WeakPolarHBondContact O-CG1 3.29Å; D3-I7 PolarHBondContact O-N 3.07Å
4	Q	87.2	Confident	89.5	Confident	142 Å²	142	88.1 Å²	88.1	66%	0.664	49%	0.494	S	S	*	.	H	α-helix	trans	-66.9	-37.8	-179.1	-159.8	164	-83.4	0	0	112	M1 I7 V8	M1-Q4 PolarHBondContact O-N 3.11Å; Q4-I7 PolarHBondContact O-N 3.28Å; Q4-V8 WeakPolarHBondContact O-CG2 3.41Å; Q4-V8 PolarHBondContact O-N 3.34Å
5	F	89.6	Confident	90	Very high	69 Å²	69	89.5 Å²	89.5	30%	0.303	49%	0.493	S	S	.	.	H	α-helix	trans	-62.9	-46.8	172.7	178.7	-107.3	0	0	0	111.8	M1 D3 I7 V8 M9 I55 L59	M1-F5 WeakPolarHBondContact O-CB 3.31Å; M1-F5 PolarHBondContact O-N 3.27Å; D3-F5 VanDerWaalsContact C-N 3.35Å; D3-F5 PolarHBondContact O-N 2.98Å; F5-I7 VanDerWaalsContact C-N 3.32Å; F5-I7 PolarHBondContact O-N 3Å; F5-V8 PolarHBondContact O-N 3.3Å; F5-M9 HydrophobicContact CD1-CG 4.15Å; F5-M9 HydrophobicContact CD2-CG 4.2Å; F5-M9 HydrophobicContact CE1-CG 3.72Å; F5-M9 HydrophobicContact CE1-SD 4.44Å; F5-M9 HydrophobicContact CE2-CG 3.75Å; F5-M9 HydrophobicContact CE2-SD 3.87Å; F5-M9 HydrophobicContact CG-CG 4.37Å; F5-M9 HydrophobicContact CZ-CE 4.45Å; F5-M9 HydrophobicContact CZ-CG 3.5Å; F5-M9 HydrophobicContact CZ-SD 3.69Å; F5-M9 WeakPolarHBondContact O-CB 3.5Å; F5-M9 VanDerWaalsContact O-CG 3.24Å; F5-M9 WeakPolarHBondContact O-CG 3.2Å; F5-M9 PolarHBondContact O-N 3.13Å; F5-I55 HydrophobicContact CE2-CG2 3.78Å; F5-L59 HydrophobicContact CD2-CD2 3.74Å; F5-L59 HydrophobicContact CE1-CD1 4.45Å; F5-L59 HydrophobicContact CE2-CD1 4.05Å; F5-L59 HydrophobicContact CE2-CD2 3.5Å; F5-L59 HydrophobicContact CE2-CG 4.13Å; F5-L59 HydrophobicContact CG-CD2 4.38Å; F5-L59 HydrophobicContact CZ-CD1 3.74Å; F5-L59 HydrophobicContact CZ-CD2 3.94Å; F5-L59 HydrophobicContact CZ-CG 4.33Å
6	A	92.9	Very high	90.4	Very high	55 Å²	55	87.1 Å²	87.1	46%	0.455	47%	0.474	S	S	.	.	H	α-helix	trans	-61.5	-39.9	178.8	0	0	0	0	0	112.3	A2 D3 M9 S10	A2-A6 VanDerWaalsContact O-CB 3.27Å; A2-A6 WeakPolarHBondContact O-CB 3.39Å; A2-A6 PolarHBondContact O-N 3.02Å; D3-A6 PolarHBondContact O-N 3.11Å; A6-M9 PolarHBondContact O-N 3.15Å; A6-S10 WeakPolarHBondContact O-CB 3.4Å; A6-S10 PolarHBondContact O-N 2.75Å; A6-S10 PolarHBondContact O-OG 2.88Å
7	I	94.3	Very high	90.8	Very high	103 Å²	103	84.5 Å²	84.5	53%	0.528	47%	0.473	S	S	.	.	H	α-helix	trans	-58.6	-53.4	175.2	-68.2	163.9	0	0	0	110	D3 Q4 F5 M9 S10 V11	D3-I7 VanDerWaalsContact O-CG1 3.27Å; D3-I7 WeakPolarHBondContact O-CG1 3.29Å; D3-I7 PolarHBondContact O-N 3.07Å; Q4-I7 PolarHBondContact O-N 3.28Å; F5-I7 VanDerWaalsContact C-N 3.32Å; F5-I7 PolarHBondContact O-N 3Å; I7-M9 VanDerWaalsContact C-N 3.34Å; I7-M9 PolarHBondContact O-N 2.91Å; I7-S10 PolarHBondContact O-N 3.05Å; I7-S10 PolarHBondContact O-OG 2.88Å; I7-V11 HydrophobicContact CG2-CG2 4.47Å; I7-V11 WeakPolarHBondContact O-CG2 3.37Å; I7-V11 PolarHBondContact O-N 2.83Å
8	V	94.6	Very high	91.1	Very high	63 Å²	63	84.6 Å²	84.6	38%	0.382	47%	0.471	S	S	.	.	H	α-helix	trans	-59.4	-44.6	-178.8	171.4	0	0	0	0	111.7	Q4 F5 V11 M12 W51 I55	Q4-V8 WeakPolarHBondContact O-CG2 3.41Å; Q4-V8 PolarHBondContact O-N 3.34Å; F5-V8 PolarHBondContact O-N 3.3Å; V8-V11 PolarHBondContact O-N 2.88Å; V8-M12 WeakPolarHBondContact O-CG 3.33Å; V8-M12 PolarHBondContact O-N 3.48Å; V8-M12 VanDerWaalsContact O-N 3.16Å; V8-W51 HydrophobicContact CG1-CH2 4.21Å; V8-W51 HydrophobicContact CG1-CZ2 3.71Å; V8-I55 HydrophobicContact CG1-CD1 4.29Å
9	M	94.9	Very high	91.4	Very high	35 Å²	35	81.8 Å²	81.8	17%	0.172	46%	0.456	C	S	.	.	H	α-helix	trans	-59.9	-49.4	176.1	-69.8	-63.5	-63.1	0	0	111.6	F5 A6 I7 V11 M12 T13 W51 L52	F5-M9 HydrophobicContact CD1-CG 4.15Å; F5-M9 HydrophobicContact CD2-CG 4.2Å; F5-M9 HydrophobicContact CE1-CG 3.72Å; F5-M9 HydrophobicContact CE1-SD 4.44Å; F5-M9 HydrophobicContact CE2-CG 3.75Å; F5-M9 HydrophobicContact CE2-SD 3.87Å; F5-M9 HydrophobicContact CG-CG 4.37Å; F5-M9 HydrophobicContact CZ-CE 4.45Å; F5-M9 HydrophobicContact CZ-CG 3.5Å; F5-M9 HydrophobicContact CZ-SD 3.69Å; F5-M9 WeakPolarHBondContact O-CB 3.5Å; F5-M9 VanDerWaalsContact O-CG 3.24Å; F5-M9 WeakPolarHBondContact O-CG 3.2Å; F5-M9 PolarHBondContact O-N 3.13Å; A6-M9 PolarHBondContact O-N 3.15Å; I7-M9 VanDerWaalsContact C-N 3.34Å; I7-M9 PolarHBondContact O-N 2.91Å; M9-V11 PolarHBondContact O-N 2.99Å; M9-M12 PolarHBondContact O-N 3.38Å; M9-T13 WeakPolarHBondContact O-CB 3.23Å; M9-T13 PolarHBondContact O-N 2.88Å; M9-T13 PolarHBondContact O-OG1 3.43Å; M9-W51 HydrophobicContact SD-CH2 3.73Å; M9-W51 HydrophobicContact SD-CZ3 4.01Å; M9-L52 HydrophobicContact CE-CD1 3.6Å; M9-L52 HydrophobicContact SD-CD1 4.26Å
10	S	95.5	Very high	91.5	Very high	56 Å²	56	78.6 Å²	78.6	39%	0.392	44%	0.442	S	S	.	.	H	α-helix	trans	-60.4	-43.8	-178.7	71.1	0	0	0	0	112.5	A6 I7 L14	A6-S10 WeakPolarHBondContact O-CB 3.4Å; A6-S10 PolarHBondContact O-N 2.75Å; A6-S10 PolarHBondContact O-OG 2.88Å; I7-S10 PolarHBondContact O-N 3.05Å; I7-S10 PolarHBondContact O-OG 2.88Å; S10-L14 WeakPolarHBondContact O-CB 3.34Å; S10-L14 WeakPolarHBondContact O-CD1 3.45Å; S10-L14 WeakPolarHBondContact O-CG 3.44Å; S10-L14 PolarHBondContact O-N 3.46Å
11	V	96.8	Very high	91.6	Very high	82 Å²	82	77.2 Å²	77.2	50%	0.497	45%	0.446	S	S	.	.	H	α-helix	trans	-65	-46.4	-178.1	171.1	0	0	0	0	110.7	I7 V8 M9 L14 F15	I7-V11 HydrophobicContact CG2-CG2 4.47Å; I7-V11 WeakPolarHBondContact O-CG2 3.37Å; I7-V11 PolarHBondContact O-N 2.83Å; V8-V11 PolarHBondContact O-N 2.88Å; M9-V11 PolarHBondContact O-N 2.99Å; V11-L14 PolarHBondContact O-N 3.48Å; V11-F15 WeakPolarHBondContact O-CB 3.33Å; V11-F15 PolarHBondContact O-N 3.06Å
12	M	96.4	Very high	93.2	Very high	65 Å²	65	71.2 Å²	71.2	32%	0.32	42%	0.42	S	S	.	.	H	α-helix	trans	-72.4	-37.3	-176.1	-71.4	-70	177.9	0	0	112.6	V8 M9 W16 W51	V8-M12 WeakPolarHBondContact O-CG 3.33Å; V8-M12 PolarHBondContact O-N 3.48Å; V8-M12 VanDerWaalsContact O-N 3.16Å; M9-M12 PolarHBondContact O-N 3.38Å; M12-W16 PolarHBondContact O-N 2.65Å; M12-W16 VanDerWaalsContact O-N 3.1Å; M12-W51 HydrophobicContact CB-CD2 4.31Å; M12-W51 HydrophobicContact CB-CE3 4.08Å; M12-W51 HydrophobicContact CB-CH2 3.44Å; M12-W51 VanDerWaalsContact CB-CH2 3.44Å; M12-W51 HydrophobicContact CB-CZ2 3.65Å; M12-W51 HydrophobicContact CB-CZ3 3.66Å; M12-W51 HydrophobicContact CG-CD2 4.35Å; M12-W51 HydrophobicContact CG-CH2 3.73Å; M12-W51 HydrophobicContact CG-CZ2 3.36Å; M12-W51 HydrophobicContact CG-CZ3 4.32Å
13	T	96.6	Very high	94.2	Very high	63 Å²	63	70 Å²	70	39%	0.387	41%	0.405	S	S	.	.	H	α-helix	trans	-65.1	-42.4	173.4	-54.4	0	0	0	0	111.3	M9 G17 Y48	M9-T13 WeakPolarHBondContact O-CB 3.23Å; M9-T13 PolarHBondContact O-N 2.88Å; M9-T13 PolarHBondContact O-OG1 3.43Å; T13-G17 WeakPolarHBondContact O-CA 3.32Å; T13-G17 PolarHBondContact O-N 3.39Å; T13-Y48 HydrophobicContact CG2-CE2 4.47Å; T13-Y48 PolarHBondContact OG1-OH 3.49Å
14	L	97.6	Very high	94.8	Very high	114 Å²	114	65.5 Å²	65.5	60%	0.597	38%	0.381	S	S	*	.	H	α-helix	trans	-65.4	-44.6	176.7	-73.9	170.8	0	0	0	111.7	S10 V11 G17 I18	S10-L14 WeakPolarHBondContact O-CB 3.34Å; S10-L14 WeakPolarHBondContact O-CD1 3.45Å; S10-L14 WeakPolarHBondContact O-CG 3.44Å; S10-L14 PolarHBondContact O-N 3.46Å; V11-L14 PolarHBondContact O-N 3.48Å; L14-G17 PolarHBondContact O-N 3.25Å; L14-I18 WeakPolarHBondContact O-CB 3.36Å; L14-I18 WeakPolarHBondContact O-CD1 3.34Å; L14-I18 VanDerWaalsContact O-CG1 3.23Å; L14-I18 WeakPolarHBondContact O-CG1 3.47Å; L14-I18 PolarHBondContact O-N 3.16Å
15	F	97.2	Very high	95.1	Very high	109 Å²	109	69 Å²	69	48%	0.478	39%	0.388	S	S	.	.	H	α-helix	trans	-57.3	-56.3	178.6	173.7	-99	0	0	0	111.7	V11 G17 I18 V19	V11-F15 WeakPolarHBondContact O-CB 3.33Å; V11-F15 PolarHBondContact O-N 3.06Å; F15-G17 PolarHBondContact O-N 3.13Å; F15-I18 PolarHBondContact O-N 3.4Å; F15-V19 HydrophobicContact CE1-CG2 4.36Å; F15-V19 HydrophobicContact CE2-CG2 4.39Å; F15-V19 HydrophobicContact CZ-CG2 4.2Å; F15-V19 WeakPolarHBondContact O-CG2 3.45Å; F15-V19 PolarHBondContact O-N 3.18Å
16	W	97.3	Very high	95.2	Very high	50 Å²	50	73.2 Å²	73.2	19%	0.189	41%	0.407	C	S	.	.	H	α-helix	trans	-71.2	-31.3	-178.8	-75	114.8	0	0	0	112.9	M12 V19 G20 T43 A44 C47 Y48	M12-W16 PolarHBondContact O-N 2.65Å; M12-W16 VanDerWaalsContact O-N 3.1Å; W16-V19 HydrophobicContact CE3-CB 4.13Å; W16-V19 HydrophobicContact CE3-CG1 4.12Å; W16-V19 HydrophobicContact CE3-CG2 4.48Å; W16-V19 HydrophobicContact CZ3-CG1 4.1Å; W16-V19 PolarHBondContact O-N 3.27Å; W16-G20 PolarHBondContact O-N 3.5Å; W16-T43 HydrophobicContact CZ3-CG2 4.35Å; W16-A44 VanDerWaalsContact CE3-CA 3.49Å; W16-A44 HydrophobicContact CE3-CB 3.88Å; W16-A44 HydrophobicContact CZ3-CB 4.47Å; W16-C47 HydrophobicContact CD2-CB 4.33Å; W16-C47 HydrophobicContact CE3-CB 4.45Å; W16-C47 HydrophobicContact CH2-CB 3.43Å; W16-C47 VanDerWaalsContact CH2-CB 3.43Å; W16-C47 HydrophobicContact CZ2-CB 3.29Å; W16-C47 HydrophobicContact CZ3-CB 4.03Å; W16-Y48 HydrophobicContact CB-CD2 4.18Å; W16-Y48 HydrophobicContact CB-CG 4.42Å; W16-Y48 AromaticContact CD1-CD2 3.99Å; W16-Y48 HydrophobicContact CG-CD2 4.38Å
17	G	96.3	Very high	95.2	Very high	44 Å²	44	71.7 Å²	71.7	45%	0.454	39%	0.391	S	S	.	.	H	α-helix	trans	-62.4	-39.5	171.9	0	0	0	0	0	112.7	T13 L14 F15 G21	T13-G17 WeakPolarHBondContact O-CA 3.32Å; T13-G17 PolarHBondContact O-N 3.39Å; L14-G17 PolarHBondContact O-N 3.25Å; F15-G17 PolarHBondContact O-N 3.13Å; G17-G21 WeakPolarHBondContact O-CA 3.46Å; G17-G21 PolarHBondContact O-N 3.45Å
18	I	97.1	Very high	95.1	Very high	86 Å²	86	71.7 Å²	71.7	44%	0.441	40%	0.398	S	S	.	.	I	π-helix	trans	-67.1	-46.5	173.7	-72.4	161.9	0	0	0	110.4	L14 F15 G20 V22 V23	L14-I18 WeakPolarHBondContact O-CB 3.36Å; L14-I18 WeakPolarHBondContact O-CD1 3.34Å; L14-I18 VanDerWaalsContact O-CG1 3.23Å; L14-I18 WeakPolarHBondContact O-CG1 3.47Å; L14-I18 PolarHBondContact O-N 3.16Å; F15-I18 PolarHBondContact O-N 3.4Å; I18-G20 PolarHBondContact O-N 3.26Å; I18-V22 HydrophobicContact CG1-CG2 4.34Å; I18-V22 HydrophobicContact CG2-CB 4.13Å; I18-V22 WeakPolarHBondContact O-CA 3.23Å; I18-V22 WeakPolarHBondContact O-CB 3.37Å; I18-V22 PolarHBondContact O-N 2.98Å; I18-V23 PolarHBondContact O-N 3.49Å
19	V	95.6	Very high	94.9	Very high	31 Å²	31	78.6 Å²	78.6	19%	0.188	42%	0.422	C	S	.	.	I	π-helix	trans	-61.8	-43.5	-179.6	173.8	0	0	0	0	111.9	F15 W16 P24 A44	F15-V19 HydrophobicContact CE1-CG2 4.36Å; F15-V19 HydrophobicContact CE2-CG2 4.39Å; F15-V19 HydrophobicContact CZ-CG2 4.2Å; F15-V19 WeakPolarHBondContact O-CG2 3.45Å; F15-V19 PolarHBondContact O-N 3.18Å; W16-V19 HydrophobicContact CE3-CB 4.13Å; W16-V19 HydrophobicContact CE3-CG1 4.12Å; W16-V19 HydrophobicContact CE3-CG2 4.48Å; W16-V19 HydrophobicContact CZ3-CG1 4.1Å; W16-V19 PolarHBondContact O-N 3.27Å; V19-P24 WeakPolarHBondContact O-CD 3.34Å; V19-A44 HydrophobicContact CG1-CB 4.33Å
20	G	94.6	Very high	94.8	Very high	17 Å²	17	78.9 Å²	78.9	18%	0.175	43%	0.434	C	S	.	.	I	π-helix	trans	-85.4	-24.6	-179	0	0	0	0	0	114.7	W16 I18 P24 V41	W16-G20 PolarHBondContact O-N 3.5Å; I18-G20 PolarHBondContact O-N 3.26Å; G20-P24 WeakPolarHBondContact O-CG 3.47Å; G20-V41 WeakPolarHBondContact O-CG2 3.27Å
21	G	93.9	Very high	94.8	Very high	50 Å²	50	82.8 Å²	82.8	52%	0.515	46%	0.458	S	S	.	.	I	π-helix	trans	-107.1	-48.5	-174.3	0	0	0	0	0	114.1	G17	G17-G21 WeakPolarHBondContact O-CA 3.46Å; G17-G21 PolarHBondContact O-N 3.45Å
22	V	95.1	Very high	94.7	Very high	71 Å²	71	84 Å²	84	43%	0.43	46%	0.462	S	S	.	.	I	π-helix	trans	-86.8	-46.6	-171.7	177.5	0	0	0	0	111.4	I18 W25 F26	I18-V22 HydrophobicContact CG1-CG2 4.34Å; I18-V22 HydrophobicContact CG2-CB 4.13Å; I18-V22 WeakPolarHBondContact O-CA 3.23Å; I18-V22 WeakPolarHBondContact O-CB 3.37Å; I18-V22 PolarHBondContact O-N 2.98Å; V22-W25 VanDerWaalsContact O-CB 3.29Å; V22-W25 WeakPolarHBondContact O-CB 3.48Å; V22-W25 PolarHBondContact O-N 3.4Å; V22-W25 VanDerWaalsContact O-N 3.11Å; V22-F26 HydrophobicContact CG1-CD2 4.24Å; V22-F26 HydrophobicContact CG1-CE2 3.66Å; V22-F26 VanDerWaalsContact O-CD2 3.31Å; V22-F26 WeakPolarHBondContact O-CD2 3.42Å
23	V	93.9	Very high	94.5	Very high	57 Å²	57	85.3 Å²	85.3	35%	0.345	46%	0.463	S	S	.	.	G	3₁₀ helix	trans	-58.9	-40.4	-177.8	179.6	0	0	0	0	113.1	I18 W25 F26 L40	I18-V23 PolarHBondContact O-N 3.49Å; V23-W25 PolarHBondContact O-N 3.02Å; V23-W25 VanDerWaalsContact O-N 3.11Å; V23-F26 PolarHBondContact O-N 3.16Å; V23-L40 HydrophobicContact CB-CD1 4.37Å; V23-L40 HydrophobicContact CG1-CD1 3.7Å
24	P	94	Very high	94.4	Very high	13 Å²	13	84.6 Å²	84.6	8%	0.084	47%	0.469	C	S	.	.	G	3₁₀ helix	trans	-59	-24.4	177.3	-30.5	40.3	0	0	0	115.1	V19 G20 F26 R33 V37 L40 V41	V19-P24 WeakPolarHBondContact O-CD 3.34Å; G20-P24 WeakPolarHBondContact O-CG 3.47Å; P24-F26 VanDerWaalsContact C-N 3.31Å; P24-R33 PolarHBondContact O-NH2 3.4Å; P24-V37 HydrophobicContact CB-CG1 3.99Å; P24-V37 HydrophobicContact CB-CG2 4.12Å; P24-L40 HydrophobicContact CG-CB 4.43Å; P24-L40 HydrophobicContact CG-CD1 4.4Å; P24-V41 HydrophobicContact CG-CG2 4.22Å
25	W	92.7	Very high	94.3	Very high	215 Å²	215	83.2 Å²	83.2	81%	0.814	47%	0.465	S	S	*	.	G	3₁₀ helix	trans	-68.9	-32.1	175.9	-163.2	-94	0	0	0	112.3	V22 V23 I27	V22-W25 VanDerWaalsContact O-CB 3.29Å; V22-W25 WeakPolarHBondContact O-CB 3.48Å; V22-W25 PolarHBondContact O-N 3.4Å; V22-W25 VanDerWaalsContact O-N 3.11Å; V23-W25 PolarHBondContact O-N 3.02Å; V23-W25 VanDerWaalsContact O-N 3.11Å; W25-I27 VanDerWaalsContact C-N 3.34Å
26	F	92.9	Very high	94.2	Very high	158 Å²	158	81.8 Å²	81.8	69%	0.693	46%	0.461	S	S	*	.	G	3₁₀ helix	trans	-86.7	1.2	-178.2	-65.9	-76.3	0	0	0	113.9	V22 V23 P24	V22-F26 HydrophobicContact CG1-CD2 4.24Å; V22-F26 HydrophobicContact CG1-CE2 3.66Å; V22-F26 VanDerWaalsContact O-CD2 3.31Å; V22-F26 WeakPolarHBondContact O-CD2 3.42Å; V23-F26 PolarHBondContact O-N 3.16Å; P24-F26 VanDerWaalsContact C-N 3.31Å
27	I	92.4	Very high	94.1	Very high	23 Å²	23	80.9 Å²	80.9	12%	0.118	46%	0.461	C	S	.	.			trans	-74.5	123.6	177.7	-62.6	176.3	0	0	0	110.3	W25 R33 I36 V37 L40	W25-I27 VanDerWaalsContact C-N 3.34Å; I27-R33 HydrophobicContact CB-CG 4.49Å; I27-R33 HydrophobicContact CG2-CB 4.48Å; I27-R33 HydrophobicContact CG2-CG 3.87Å; I27-R33 PolarHBondContact O-NE 3.21Å; I27-R33 VanDerWaalsContact O-NE 3.07Å; I27-I36 HydrophobicContact CD1-CB 4.09Å; I27-I36 HydrophobicContact CD1-CG2 3.47Å; I27-I36 VanDerWaalsContact CD1-CG2 3.47Å; I27-I36 HydrophobicContact CG1-CG2 4.41Å; I27-V37 HydrophobicContact CD1-CG2 3.69Å; I27-L40 HydrophobicContact CD1-CD1 3.65Å
28	P	92	Very high	94.1	Very high	104 Å²	104	82.9 Å²	82.9	68%	0.675	47%	0.465	S	S	*	.			trans	-63.3	154.1	-179.4	26.7	-34.7	0	0	0	112.1	G30	P28-G30 PolarHBondContact O-N 3.38Å
29	K	90.8	Very high	94.1	Very high	208 Å²	208	84.5 Å²	84.5	90%	0.904	47%	0.472	S	S	*	.	S	Bend	trans	-70	113.5	177.5	-64.4	176.7	-175.9	170.4	0	109.2
30	G	92.9	Very high	94.1	Very high	41 Å²	41	85.3 Å²	85.3	42%	0.423	48%	0.475	S	S	.	.	S	Bend	trans	-154.4	171.6	176.1	0	0	0	0	0	111.5	P28 N32 R33	P28-G30 PolarHBondContact O-N 3.38Å; G30-N32 PolarHBondContact O-N 3.4Å; G30-N32 VanDerWaalsContact O-N 3.15Å; G30-R33 WeakPolarHBondContact O-CB 3.27Å; G30-R33 PolarHBondContact O-N 3.43Å; G30-R33 VanDerWaalsContact O-N 3.13Å
31	P	95.3	Very high	94.2	Very high	137 Å²	137	87.3 Å²	87.3	89%	0.89	48%	0.484	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.7	-33.5	-175.9	-24.9	33.9	0	0	0	113.4
32	N	94.9	Very high	94.4	Very high	109 Å²	109	90.5 Å²	90.5	58%	0.583	49%	0.488	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.6	7.9	-175	-59.3	-23.9	0	0	0	113.6	G30 G34 V35 I36	G30-N32 PolarHBondContact O-N 3.4Å; G30-N32 VanDerWaalsContact O-N 3.15Å; N32-G34 VanDerWaalsContact C-N 3.29Å; N32-G34 PolarHBondContact O-N 2.96Å; N32-V35 PolarHBondContact O-N 3.1Å; N32-V35 VanDerWaalsContact O-N 3.16Å; N32-I36 HydrophobicContact CB-CD1 4.36Å; N32-I36 WeakPolarHBondContact O-CG1 3.33Å; N32-I36 PolarHBondContact O-N 2.92Å
33	R	92.1	Very high	94.5	Very high	91 Å²	91	90.3 Å²	90.3	34%	0.343	49%	0.488	S	S	.	.	H	α-helix	trans	-56.1	-43.2	-174.5	179.9	174.3	-172.3	-78.4	-3.8	112.3	P24 I27 G30 V35 I36 V37	P24-R33 PolarHBondContact O-NH2 3.4Å; I27-R33 HydrophobicContact CB-CG 4.49Å; I27-R33 HydrophobicContact CG2-CB 4.48Å; I27-R33 HydrophobicContact CG2-CG 3.87Å; I27-R33 PolarHBondContact O-NE 3.21Å; I27-R33 VanDerWaalsContact O-NE 3.07Å; G30-R33 WeakPolarHBondContact O-CB 3.27Å; G30-R33 PolarHBondContact O-N 3.43Å; G30-R33 VanDerWaalsContact O-N 3.13Å; R33-V35 PolarHBondContact O-N 2.87Å; R33-I36 PolarHBondContact O-N 3.46Å; R33-V37 HydrophobicContact CG-CG2 4.26Å; R33-V37 WeakPolarHBondContact O-CB 3.3Å; R33-V37 VanDerWaalsContact O-CG2 3.23Å; R33-V37 WeakPolarHBondContact O-CG2 3.37Å; R33-V37 PolarHBondContact O-N 2.94Å
34	G	92.9	Very high	94.7	Very high	49 Å²	49	87.9 Å²	87.9	51%	0.505	47%	0.473	S	S	.	.	H	α-helix	trans	-59.3	-46.8	179.3	0	0	0	0	0	112.2	N32 V37 T38	N32-G34 VanDerWaalsContact C-N 3.29Å; N32-G34 PolarHBondContact O-N 2.96Å; G34-V37 PolarHBondContact O-N 3.41Å; G34-T38 WeakPolarHBondContact O-CG2 3.24Å; G34-T38 PolarHBondContact O-N 2.94Å; G34-T38 PolarHBondContact O-OG1 2.91Å; G34-T38 VanDerWaalsContact O-OG1 3.13Å
35	V	96.1	Very high	94.8	Very high	84 Å²	84	91 Å²	91	51%	0.509	49%	0.492	S	S	.	.	H	α-helix	trans	-63.8	-43.8	179.4	-179.4	0	0	0	0	111.3	N32 R33 V37 T38 M39	N32-V35 PolarHBondContact O-N 3.1Å; N32-V35 VanDerWaalsContact O-N 3.16Å; R33-V35 PolarHBondContact O-N 2.87Å; V35-V37 PolarHBondContact O-N 3.35Å; V35-T38 WeakPolarHBondContact CA-OG1 3.48Å; V35-T38 PolarHBondContact O-N 3.45Å; V35-T38 PolarHBondContact O-OG1 2.99Å; V35-M39 HydrophobicContact CG1-CG 4.28Å; V35-M39 HydrophobicContact CG1-SD 3.83Å; V35-M39 WeakPolarHBondContact O-CB 3.47Å; V35-M39 WeakPolarHBondContact O-CG 3.41Å; V35-M39 PolarHBondContact O-N 3.29Å
36	I	95.3	Very high	95.1	Very high	80 Å²	80	84 Å²	84	41%	0.41	48%	0.475	S	S	.	.	H	α-helix	trans	-64.7	-43.4	179.6	-58.5	165.9	0	0	0	110.5	I27 N32 R33 M39 L40	I27-I36 HydrophobicContact CD1-CB 4.09Å; I27-I36 HydrophobicContact CD1-CG2 3.47Å; I27-I36 VanDerWaalsContact CD1-CG2 3.47Å; I27-I36 HydrophobicContact CG1-CG2 4.41Å; N32-I36 HydrophobicContact CB-CD1 4.36Å; N32-I36 WeakPolarHBondContact O-CG1 3.33Å; N32-I36 PolarHBondContact O-N 2.92Å; R33-I36 PolarHBondContact O-N 3.46Å; I36-M39 PolarHBondContact O-N 2.98Å; I36-L40 WeakPolarHBondContact O-CG 3.18Å; I36-L40 PolarHBondContact O-N 2.91Å
37	V	95.8	Very high	95.3	Very high	31 Å²	31	78.8 Å²	78.8	19%	0.188	46%	0.458	C	S	.	.	H	α-helix	trans	-61.4	-47.3	177	168.1	0	0	0	0	111	P24 I27 R33 G34 V35 M39 L40 V41	P24-V37 HydrophobicContact CB-CG1 3.99Å; P24-V37 HydrophobicContact CB-CG2 4.12Å; I27-V37 HydrophobicContact CD1-CG2 3.69Å; R33-V37 HydrophobicContact CG-CG2 4.26Å; R33-V37 WeakPolarHBondContact O-CB 3.3Å; R33-V37 VanDerWaalsContact O-CG2 3.23Å; R33-V37 WeakPolarHBondContact O-CG2 3.37Å; R33-V37 PolarHBondContact O-N 2.94Å; G34-V37 PolarHBondContact O-N 3.41Å; V35-V37 PolarHBondContact O-N 3.35Å; V37-M39 PolarHBondContact O-N 3.02Å; V37-L40 PolarHBondContact O-N 3.48Å; V37-V41 HydrophobicContact CG1-CG2 4.35Å; V37-V41 VanDerWaalsContact O-CG2 3.28Å; V37-V41 WeakPolarHBondContact O-CG2 3.28Å; V37-V41 PolarHBondContact O-N 3.49Å
38	T	95.6	Very high	95.5	Very high	86 Å²	86	80.2 Å²	80.2	53%	0.528	46%	0.462	S	S	.	.	H	α-helix	trans	-66.5	-38.3	-179.5	55.1	0	0	0	0	111.9	G34 V35 L42	G34-T38 WeakPolarHBondContact O-CG2 3.24Å; G34-T38 PolarHBondContact O-N 2.94Å; G34-T38 PolarHBondContact O-OG1 2.91Å; G34-T38 VanDerWaalsContact O-OG1 3.13Å; V35-T38 WeakPolarHBondContact CA-OG1 3.48Å; V35-T38 PolarHBondContact O-N 3.45Å; V35-T38 PolarHBondContact O-OG1 2.99Å; T38-L42 WeakPolarHBondContact O-CB 3.18Å; T38-L42 PolarHBondContact O-N 3.43Å
39	M	96.7	Very high	95.7	Very high	119 Å²	119	79.3 Å²	79.3	59%	0.586	45%	0.451	S	S	*	.	H	α-helix	trans	-60.8	-47.6	173.5	-71.4	177.4	91	0	0	111.2	V35 I36 V37 L42 T43	V35-M39 HydrophobicContact CG1-CG 4.28Å; V35-M39 HydrophobicContact CG1-SD 3.83Å; V35-M39 WeakPolarHBondContact O-CB 3.47Å; V35-M39 WeakPolarHBondContact O-CG 3.41Å; V35-M39 PolarHBondContact O-N 3.29Å; I36-M39 PolarHBondContact O-N 2.98Å; V37-M39 PolarHBondContact O-N 3.02Å; M39-L42 PolarHBondContact O-N 3.33Å; M39-T43 VanDerWaalsContact O-CB 3.3Å; M39-T43 WeakPolarHBondContact O-CB 3.37Å; M39-T43 PolarHBondContact O-N 2.97Å; M39-T43 PolarHBondContact O-OG1 2.95Å
40	L	96.3	Very high	96	Very high	48 Å²	48	77.2 Å²	77.2	25%	0.251	44%	0.442	S	S	.	.	H	α-helix	trans	-61.7	-45.9	178.2	-75	-177.4	0	0	0	112.9	V23 P24 I27 I36 V37 A44	V23-L40 HydrophobicContact CB-CD1 4.37Å; V23-L40 HydrophobicContact CG1-CD1 3.7Å; P24-L40 HydrophobicContact CG-CB 4.43Å; P24-L40 HydrophobicContact CG-CD1 4.4Å; I27-L40 HydrophobicContact CD1-CD1 3.65Å; I36-L40 WeakPolarHBondContact O-CG 3.18Å; I36-L40 PolarHBondContact O-N 2.91Å; V37-L40 PolarHBondContact O-N 3.48Å; L40-A44 WeakPolarHBondContact O-CB 3.4Å; L40-A44 PolarHBondContact O-N 3.38Å
41	V	97	Very high	96.2	Very high	60 Å²	60	77.7 Å²	77.7	36%	0.364	43%	0.431	S	S	.	.	H	α-helix	trans	-64.7	-47.4	179.9	174.2	0	0	0	0	110.6	G20 P24 V37 A44 V45	G20-V41 WeakPolarHBondContact O-CG2 3.27Å; P24-V41 HydrophobicContact CG-CG2 4.22Å; V37-V41 HydrophobicContact CG1-CG2 4.35Å; V37-V41 VanDerWaalsContact O-CG2 3.28Å; V37-V41 WeakPolarHBondContact O-CG2 3.28Å; V37-V41 PolarHBondContact O-N 3.49Å; V41-A44 PolarHBondContact O-N 2.94Å; V41-V45 WeakPolarHBondContact O-CG2 3.38Å; V41-V45 PolarHBondContact O-N 2.91Å
42	L	97.4	Very high	96.2	Very high	116 Å²	116	72.6 Å²	72.6	61%	0.607	40%	0.396	S	S	*	.	H	α-helix	trans	-62	-46.7	179.7	-172	108.1	0	0	0	111	T38 M39 A44 V45 C46	T38-L42 WeakPolarHBondContact O-CB 3.18Å; T38-L42 PolarHBondContact O-N 3.43Å; M39-L42 PolarHBondContact O-N 3.33Å; L42-A44 VanDerWaalsContact C-N 3.34Å; L42-A44 PolarHBondContact O-N 2.97Å; L42-V45 PolarHBondContact O-N 2.98Å; L42-C46 WeakPolarHBondContact O-CB 3.18Å; L42-C46 PolarHBondContact O-N 3.39Å; L42-C46 PolarHBondContact O-SG 3.46Å
43	T	97.3	Very high	96.3	Very high	68 Å²	68	72.7 Å²	72.7	42%	0.417	40%	0.396	S	S	.	.	H	α-helix	trans	-58.9	-46.1	176	-63.6	0	0	0	0	111.2	W16 M39 V45 C46 C47	W16-T43 HydrophobicContact CZ3-CG2 4.35Å; M39-T43 VanDerWaalsContact O-CB 3.3Å; M39-T43 WeakPolarHBondContact O-CB 3.37Å; M39-T43 PolarHBondContact O-N 2.97Å; M39-T43 PolarHBondContact O-OG1 2.95Å; T43-V45 VanDerWaalsContact C-N 3.35Å; T43-V45 PolarHBondContact O-N 2.82Å; T43-C46 PolarHBondContact O-N 2.91Å; T43-C47 VanDerWaalsContact O-CB 3.28Å; T43-C47 WeakPolarHBondContact O-CB 3.15Å; T43-C47 PolarHBondContact O-N 3.07Å; T43-C47 PolarHBondContact O-SG 2.91Å
44	A	97.4	Very high	96.5	Very high	6 Å²	6	70.8 Å²	70.8	5%	0.05	40%	0.399	C	S	.	.	H	α-helix	trans	-60.3	-44.1	-180	0	0	0	0	0	112.5	W16 V19 L40 V41 L42 Y48	W16-A44 VanDerWaalsContact CE3-CA 3.49Å; W16-A44 HydrophobicContact CE3-CB 3.88Å; W16-A44 HydrophobicContact CZ3-CB 4.47Å; V19-A44 HydrophobicContact CG1-CB 4.33Å; L40-A44 WeakPolarHBondContact O-CB 3.4Å; L40-A44 PolarHBondContact O-N 3.38Å; V41-A44 PolarHBondContact O-N 2.94Å; L42-A44 VanDerWaalsContact C-N 3.34Å; L42-A44 PolarHBondContact O-N 2.97Å; A44-Y48 WeakPolarHBondContact O-CB 3.28Å; A44-Y48 PolarHBondContact O-N 3.4Å
45	V	97.4	Very high	96.5	Very high	77 Å²	77	70.2 Å²	70.2	47%	0.467	38%	0.384	S	S	.	.	H	α-helix	trans	-66.4	-49.9	178	173.9	0	0	0	0	111.1	V41 L42 T43 Y48 L49	V41-V45 WeakPolarHBondContact O-CG2 3.38Å; V41-V45 PolarHBondContact O-N 2.91Å; L42-V45 PolarHBondContact O-N 2.98Å; T43-V45 VanDerWaalsContact C-N 3.35Å; T43-V45 PolarHBondContact O-N 2.82Å; V45-Y48 PolarHBondContact O-N 2.94Å; V45-L49 HydrophobicContact CG1-CD1 3.81Å; V45-L49 HydrophobicContact CG1-CG 4.36Å; V45-L49 WeakPolarHBondContact O-CB 3.28Å; V45-L49 VanDerWaalsContact O-CG 3.28Å; V45-L49 WeakPolarHBondContact O-CG 3.38Å; V45-L49 PolarHBondContact O-N 2.96Å
46	C	97.7	Very high	96.4	Very high	69 Å²	69	70.4 Å²	70.4	47%	0.466	38%	0.382	S	S	.	.	H	α-helix	trans	-63.2	-46.2	-177.3	-69.1	0	0	0	0	112.1	L42 T43 L49 F50	L42-C46 WeakPolarHBondContact O-CB 3.18Å; L42-C46 PolarHBondContact O-N 3.39Å; L42-C46 PolarHBondContact O-SG 3.46Å; T43-C46 PolarHBondContact O-N 2.91Å; C46-L49 PolarHBondContact O-N 3.06Å; C46-F50 VanDerWaalsContact O-CB 3.31Å; C46-F50 WeakPolarHBondContact O-CB 3.31Å; C46-F50 PolarHBondContact O-N 3.26Å
47	C	97.2	Very high	96.3	Very high	49 Å²	49	70.3 Å²	70.3	33%	0.331	39%	0.393	S	S	.	.	H	α-helix	trans	-68	-39.8	-179.7	-66.8	0	0	0	0	112	W16 T43 W51	W16-C47 HydrophobicContact CD2-CB 4.33Å; W16-C47 HydrophobicContact CE3-CB 4.45Å; W16-C47 HydrophobicContact CH2-CB 3.43Å; W16-C47 VanDerWaalsContact CH2-CB 3.43Å; W16-C47 HydrophobicContact CZ2-CB 3.29Å; W16-C47 HydrophobicContact CZ3-CB 4.03Å; T43-C47 VanDerWaalsContact O-CB 3.28Å; T43-C47 WeakPolarHBondContact O-CB 3.15Å; T43-C47 PolarHBondContact O-N 3.07Å; T43-C47 PolarHBondContact O-SG 2.91Å; C47-W51 WeakPolarHBondContact O-CB 3.37Å; C47-W51 PolarHBondContact O-N 3.31Å; C47-W51 VanDerWaalsContact O-N 3.07Å
48	Y	97.3	Very high	96.2	Very high	53 Å²	53	76 Å²	76	21%	0.208	42%	0.418	C	S	.	.	H	α-helix	trans	-63.1	-47	175	179.2	-104.9	0	0	0	111.7	T13 W16 A44 V45 W51 L52	T13-Y48 HydrophobicContact CG2-CE2 4.47Å; T13-Y48 PolarHBondContact OG1-OH 3.49Å; W16-Y48 HydrophobicContact CB-CD2 4.18Å; W16-Y48 HydrophobicContact CB-CG 4.42Å; W16-Y48 AromaticContact CD1-CD2 3.99Å; W16-Y48 HydrophobicContact CG-CD2 4.38Å; A44-Y48 WeakPolarHBondContact O-CB 3.28Å; A44-Y48 PolarHBondContact O-N 3.4Å; V45-Y48 PolarHBondContact O-N 2.94Å; Y48-W51 HydrophobicContact CD2-CE3 4.36Å; Y48-W51 HydrophobicContact CE2-CE3 4.28Å; Y48-W51 HydrophobicContact CE2-CZ3 4.15Å; Y48-W51 PolarHBondContact O-N 3.28Å; Y48-L52 HydrophobicContact CE1-CD2 3.84Å; Y48-L52 WeakPolarHBondContact O-CB 3.38Å; Y48-L52 PolarHBondContact O-N 2.91Å
49	L	96.7	Very high	95.9	Very high	84 Å²	84	75.3 Å²	75.3	44%	0.44	41%	0.41	S	S	.	.	H	α-helix	trans	-63.6	-43.9	178.9	-73.1	177	0	0	0	112.1	V45 C46 W51 L52 I53	V45-L49 HydrophobicContact CG1-CD1 3.81Å; V45-L49 HydrophobicContact CG1-CG 4.36Å; V45-L49 WeakPolarHBondContact O-CB 3.28Å; V45-L49 VanDerWaalsContact O-CG 3.28Å; V45-L49 WeakPolarHBondContact O-CG 3.38Å; V45-L49 PolarHBondContact O-N 2.96Å; C46-L49 PolarHBondContact O-N 3.06Å; L49-W51 VanDerWaalsContact C-N 3.34Å; L49-W51 PolarHBondContact O-N 3.39Å; L49-L52 PolarHBondContact O-N 3.31Å; L49-I53 WeakPolarHBondContact O-CB 3.25Å; L49-I53 WeakPolarHBondContact O-CD1 3.45Å; L49-I53 VanDerWaalsContact O-CG1 3.22Å; L49-I53 WeakPolarHBondContact O-CG1 3.38Å; L49-I53 PolarHBondContact O-N 3.14Å
50	F	97.3	Very high	95.7	Very high	164 Å²	164	76.4 Å²	76.4	72%	0.719	42%	0.419	S	S	*	.	H	α-helix	trans	-56.9	-49.1	176.8	177.4	-97	0	0	0	111.4	C46 A54	C46-F50 VanDerWaalsContact O-CB 3.31Å; C46-F50 WeakPolarHBondContact O-CB 3.31Å; C46-F50 PolarHBondContact O-N 3.26Å; F50-A54 PolarHBondContact O-N 3.25Å
51	W	96.6	Very high	95.5	Very high	51 Å²	51	78.7 Å²	78.7	19%	0.193	44%	0.436	C	S	.	.	H	α-helix	trans	-64.4	-45.5	177.7	172.7	85.3	0	0	0	112.5	V8 M9 M12 C47 Y48 L49 I53 A54 I55	V8-W51 HydrophobicContact CG1-CH2 4.21Å; V8-W51 HydrophobicContact CG1-CZ2 3.71Å; M9-W51 HydrophobicContact SD-CH2 3.73Å; M9-W51 HydrophobicContact SD-CZ3 4.01Å; M12-W51 HydrophobicContact CB-CD2 4.31Å; M12-W51 HydrophobicContact CB-CE3 4.08Å; M12-W51 HydrophobicContact CB-CH2 3.44Å; M12-W51 VanDerWaalsContact CB-CH2 3.44Å; M12-W51 HydrophobicContact CB-CZ2 3.65Å; M12-W51 HydrophobicContact CB-CZ3 3.66Å; M12-W51 HydrophobicContact CG-CD2 4.35Å; M12-W51 HydrophobicContact CG-CH2 3.73Å; M12-W51 HydrophobicContact CG-CZ2 3.36Å; M12-W51 HydrophobicContact CG-CZ3 4.32Å; C47-W51 WeakPolarHBondContact O-CB 3.37Å; C47-W51 PolarHBondContact O-N 3.31Å; C47-W51 VanDerWaalsContact O-N 3.07Å; Y48-W51 HydrophobicContact CD2-CE3 4.36Å; Y48-W51 HydrophobicContact CE2-CE3 4.28Å; Y48-W51 HydrophobicContact CE2-CZ3 4.15Å; Y48-W51 PolarHBondContact O-N 3.28Å; L49-W51 VanDerWaalsContact C-N 3.34Å; L49-W51 PolarHBondContact O-N 3.39Å; W51-I53 PolarHBondContact O-N 3.38Å; W51-A54 PolarHBondContact O-N 3.44Å; W51-I55 HydrophobicContact CD2-CD1 4.22Å; W51-I55 HydrophobicContact CH2-CD1 3.85Å; W51-I55 HydrophobicContact CZ2-CD1 3.11Å; W51-I55 HydrophobicContact CZ2-CG1 4.32Å; W51-I55 PolarHBondContact O-N 3.45Å; W51-I55 VanDerWaalsContact O-N 3.14Å
52	L	96	Very high	95.4	Very high	30 Å²	30	83.1 Å²	83.1	16%	0.157	46%	0.457	C	S	.	.	H	α-helix	trans	-60.4	-47.8	-177.7	177.1	62	0	0	0	111	M9 Y48 L49 A54 I55 L56	M9-L52 HydrophobicContact CE-CD1 3.6Å; M9-L52 HydrophobicContact SD-CD1 4.26Å; Y48-L52 HydrophobicContact CE1-CD2 3.84Å; Y48-L52 WeakPolarHBondContact O-CB 3.38Å; Y48-L52 PolarHBondContact O-N 2.91Å; L49-L52 PolarHBondContact O-N 3.31Å; L52-A54 VanDerWaalsContact C-N 3.32Å; L52-A54 PolarHBondContact O-N 3.33Å; L52-I55 PolarHBondContact O-N 3.45Å; L52-L56 HydrophobicContact CD1-CD1 3.88Å; L52-L56 HydrophobicContact CD1-CD2 4.44Å; L52-L56 HydrophobicContact CD1-CG 3.95Å; L52-L56 HydrophobicContact CD2-CD1 4.45Å; L52-L56 HydrophobicContact CG-CD1 3.81Å; L52-L56 HydrophobicContact CG-CG 4.25Å; L52-L56 WeakPolarHBondContact O-CB 3.22Å; L52-L56 VanDerWaalsContact O-CG 3.25Å; L52-L56 WeakPolarHBondContact O-CG 3.45Å; L52-L56 PolarHBondContact O-N 2.97Å
53	I	96.8	Very high	95.2	Very high	112 Å²	112	86.3 Å²	86.3	57%	0.574	47%	0.466	S	S	*	.	H	α-helix	trans	-61.7	-43.3	179.8	-67	166	0	0	0	110.5	L49 W51 I55 L56 A57	L49-I53 WeakPolarHBondContact O-CB 3.25Å; L49-I53 WeakPolarHBondContact O-CD1 3.45Å; L49-I53 VanDerWaalsContact O-CG1 3.22Å; L49-I53 WeakPolarHBondContact O-CG1 3.38Å; L49-I53 PolarHBondContact O-N 3.14Å; W51-I53 PolarHBondContact O-N 3.38Å; I53-I55 VanDerWaalsContact C-N 3.32Å; I53-I55 PolarHBondContact O-N 2.93Å; I53-L56 PolarHBondContact O-N 2.97Å; I53-A57 WeakPolarHBondContact O-CB 3.43Å; I53-A57 PolarHBondContact O-N 3.26Å
54	A	95.4	Very high	94.9	Very high	50 Å²	50	86.1 Å²	86.1	41%	0.413	48%	0.478	S	S	.	.	H	α-helix	trans	-59.9	-41	179.5	0	0	0	0	0	112.5	F50 W51 L52	F50-A54 PolarHBondContact O-N 3.25Å; W51-A54 PolarHBondContact O-N 3.44Å; L52-A54 VanDerWaalsContact C-N 3.32Å; L52-A54 PolarHBondContact O-N 3.33Å
55	I	94	Very high	94.8	Very high	38 Å²	38	91.5 Å²	91.5	20%	0.195	51%	0.513	C	S	.	.	H	α-helix	trans	-73.6	-43.7	177	-71.9	-169.6	0	0	0	111.9	F5 V8 W51 L52 I53 A57 Q58 L59	F5-I55 HydrophobicContact CE2-CG2 3.78Å; V8-I55 HydrophobicContact CG1-CD1 4.29Å; W51-I55 HydrophobicContact CD2-CD1 4.22Å; W51-I55 HydrophobicContact CH2-CD1 3.85Å; W51-I55 HydrophobicContact CZ2-CD1 3.11Å; W51-I55 HydrophobicContact CZ2-CG1 4.32Å; W51-I55 PolarHBondContact O-N 3.45Å; W51-I55 VanDerWaalsContact O-N 3.14Å; L52-I55 PolarHBondContact O-N 3.45Å; I53-I55 VanDerWaalsContact C-N 3.32Å; I53-I55 PolarHBondContact O-N 2.93Å; I55-A57 PolarHBondContact O-N 3.47Å; I55-Q58 PolarHBondContact O-N 3.34Å; I55-L59 PolarHBondContact O-N 2.91Å
56	L	92.6	Very high	94.6	Very high	87 Å²	87	94 Å²	94	46%	0.455	53%	0.533	S	S	.	.	H	α-helix	trans	-60.6	-33.9	179.4	-70.9	179.6	0	0	0	111.6	L52 I53 Q58 L59	L52-L56 HydrophobicContact CD1-CD1 3.88Å; L52-L56 HydrophobicContact CD1-CD2 4.44Å; L52-L56 HydrophobicContact CD1-CG 3.95Å; L52-L56 HydrophobicContact CD2-CD1 4.45Å; L52-L56 HydrophobicContact CG-CD1 3.81Å; L52-L56 HydrophobicContact CG-CG 4.25Å; L52-L56 WeakPolarHBondContact O-CB 3.22Å; L52-L56 VanDerWaalsContact O-CG 3.25Å; L52-L56 WeakPolarHBondContact O-CG 3.45Å; L52-L56 PolarHBondContact O-N 2.97Å; I53-L56 PolarHBondContact O-N 2.97Å; L56-Q58 PolarHBondContact O-N 3.36Å; L56-L59 HydrophobicContact CD2-CD1 3.53Å; L56-L59 PolarHBondContact O-N 3.25Å
57	A	94	Very high	94.5	Very high	78 Å²	78	94 Å²	94	65%	0.645	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.1	-22.6	175	0	0	0	0	0	113.7	I53 I55	I53-A57 WeakPolarHBondContact O-CB 3.43Å; I53-A57 PolarHBondContact O-N 3.26Å; I55-A57 PolarHBondContact O-N 3.47Å
58	Q	92.6	Very high	94.4	Very high	150 Å²	150	94.9 Å²	94.9	70%	0.701	54%	0.535	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100.3	-4.3	-177.9	-64.6	-178.7	-4.7	0	0	113.9	I55 L56 N60 P61	I55-Q58 PolarHBondContact O-N 3.34Å; L56-Q58 PolarHBondContact O-N 3.36Å; Q58-N60 PolarHBondContact O-N 3.45Å; Q58-P61 WeakPolarHBondContact O-CD 3.44Å
59	L	90.1	Very high	94.3	Very high	72 Å²	72	96.7 Å²	96.7	38%	0.377	55%	0.552	S	S	.	*	S	Bend	trans	-66.6	-35.9	-174	-83.8	-179.5	0	0	0	114.4	F5 I55 L56	F5-L59 HydrophobicContact CD2-CD2 3.74Å; F5-L59 HydrophobicContact CE1-CD1 4.45Å; F5-L59 HydrophobicContact CE2-CD1 4.05Å; F5-L59 HydrophobicContact CE2-CD2 3.5Å; F5-L59 HydrophobicContact CE2-CG 4.13Å; F5-L59 HydrophobicContact CG-CD2 4.38Å; F5-L59 HydrophobicContact CZ-CD1 3.74Å; F5-L59 HydrophobicContact CZ-CD2 3.94Å; F5-L59 HydrophobicContact CZ-CG 4.33Å; I55-L59 PolarHBondContact O-N 2.91Å; L56-L59 HydrophobicContact CD2-CD1 3.53Å; L56-L59 PolarHBondContact O-N 3.25Å
60	N	92.4	Very high	94.3	Very high	143 Å²	143	98.3 Å²	98.3	77%	0.765	56%	0.561	S	S	*	*	S	Bend	trans	-133	74	178.9	-65.9	-73.5	0	0	0	109	Q58 L62	Q58-N60 PolarHBondContact O-N 3.45Å; N60-L62 PolarHBondContact O-N 3.49Å
61	P	93.1	Very high	94.2	Very high	95 Å²	95	94.6 Å²	94.6	62%	0.617	55%	0.548	S	S	*	.			trans	-69.1	133.5	-176.1	29.4	-32.3	0	0	0	110	Q58	Q58-P61 WeakPolarHBondContact O-CD 3.44Å
62	L	93.5	Very high	94.2	Very high	153 Å²	153	95.6 Å²	95.6	80%	0.801	56%	0.556	S	S	*	*	S	Bend	trans	-81.6	-27.7	177.6	-61.7	177.7	0	0	0	112.4	N60	N60-L62 PolarHBondContact O-N 3.49Å
63	F	92.9	Very high	94.1	Very high	183 Å²	183	99.6 Å²	99.6	80%	0.803	57%	0.574	S	S	*	*	S	Bend	trans	-138.1	144.1	-176.9	-53.7	-72.4	0	0	0	110
64	G	92.8	Very high	94.1	Very high	65 Å²	65	102.1 Å²	102.1	67%	0.67	58%	0.577	S	S	*	*	P	Polyproline II helix	trans	-90.6	171.1	170.7	0	0	0	0	0	112.2
65	P	94.2	Very high	94.1	Very high	118 Å²	118	102.7 Å²	102.7	77%	0.766	57%	0.573	S	S	*	*	P	Polyproline II helix	trans	-68.1	140.8	174.3	31.4	-35.6	0	0	0	110.8	L67	P65-L67 HydrophobicContact CB-CD1 3.72Å; P65-L67 HydrophobicContact CG-CD1 3.91Å
66	S	94.2	Very high	94.2	Very high	129 Å²	129	107 Å²	107	90%	0.902	59%	0.591	S	S	*	*	P	Polyproline II helix	trans	-100.9	118.7	175.2	-175.2	0	0	0	0	109.6
67	L	94.4	Very high	94.4	Very high	70 Å²	70	109.8 Å²	109.8	37%	0.366	61%	0.605	S	S	.	*			trans	-127.7	152	-176.7	-65.5	98.5	0	0	0	111.5	P65 I71 I72 L75	P65-L67 HydrophobicContact CB-CD1 3.72Å; P65-L67 HydrophobicContact CG-CD1 3.91Å; L67-I71 HydrophobicContact CD2-CB 4.26Å; L67-I71 HydrophobicContact CD2-CG2 3.58Å; L67-I72 HydrophobicContact CB-CD1 4.33Å; L67-I72 HydrophobicContact CB-CG1 3.9Å; L67-L75 HydrophobicContact CD2-CD1 3.75Å
68	S	95.8	Very high	94.5	Very high	67 Å²	67	108.6 Å²	108.6	47%	0.469	60%	0.595	S	S	.	*			trans	-69	149.3	170.2	-174.3	0	0	0	0	111	D70 I71 I72	S68-D70 PolarHBondContact O-N 2.86Å; S68-I71 PolarHBondContact O-N 3.46Å; S68-I72 WeakPolarHBondContact O-CG1 3.09Å; S68-I72 PolarHBondContact O-N 2.99Å
69	T	95.4	Very high	94.5	Very high	92 Å²	92	112 Å²	112	56%	0.564	60%	0.602	S	S	*	*	H	α-helix	trans	-53.8	-38.9	-179.2	-47.8	0	0	0	0	112.7	I71 I72 Q73	T69-I71 VanDerWaalsContact C-N 3.33Å; T69-I71 PolarHBondContact O-N 3.25Å; T69-I72 PolarHBondContact O-N 3.33Å; T69-Q73 WeakPolarHBondContact O-CG 3.41Å; T69-Q73 PolarHBondContact O-N 3.27Å
70	D	96.4	Very high	93.7	Very high	117 Å²	117	117.5 Å²	117.5	63%	0.626	63%	0.631	S	S	*	*	H	α-helix	trans	-63.2	-40	179.2	-54.5	-38	0	0	0	111.7	S68 Q73 Y74	S68-D70 PolarHBondContact O-N 2.86Å; D70-Q73 PolarHBondContact O-N 3.16Å; D70-Y74 WeakPolarHBondContact O-CB 3.47Å; D70-Y74 PolarHBondContact O-N 3.41Å
71	I	95.3	Very high	93.7	Very high	87 Å²	87	116.2 Å²	116.2	45%	0.446	63%	0.625	S	S	.	*	H	α-helix	trans	-70.9	-38	178.3	-54.5	174	0	0	0	110.1	L67 S68 T69 Q73 Y74 L75	L67-I71 HydrophobicContact CD2-CB 4.26Å; L67-I71 HydrophobicContact CD2-CG2 3.58Å; S68-I71 PolarHBondContact O-N 3.46Å; T69-I71 VanDerWaalsContact C-N 3.33Å; T69-I71 PolarHBondContact O-N 3.25Å; I71-Q73 VanDerWaalsContact C-N 3.32Å; I71-Q73 PolarHBondContact O-N 3Å; I71-Y74 PolarHBondContact O-N 3.12Å; I71-L75 HydrophobicContact CG2-CD1 4.06Å; I71-L75 HydrophobicContact CG2-CG 4.29Å; I71-L75 WeakPolarHBondContact O-CB 3.34Å; I71-L75 WeakPolarHBondContact O-CG 3.41Å; I71-L75 PolarHBondContact O-N 2.86Å
72	I	95.4	Very high	93.8	Very high	72 Å²	72	117.3 Å²	117.3	37%	0.369	63%	0.625	S	S	.	*	H	α-helix	trans	-61.7	-43.1	176	-64.9	169.5	0	0	0	110.4	L67 S68 T69 L75 K76	L67-I72 HydrophobicContact CB-CD1 4.33Å; L67-I72 HydrophobicContact CB-CG1 3.9Å; S68-I72 WeakPolarHBondContact O-CG1 3.09Å; S68-I72 PolarHBondContact O-N 2.99Å; T69-I72 PolarHBondContact O-N 3.33Å; I72-L75 PolarHBondContact O-N 3.32Å; I72-K76 WeakPolarHBondContact O-CG 3.49Å; I72-K76 PolarHBondContact O-N 2.98Å; I72-K76 VanDerWaalsContact O-N 3.12Å
73	Q	94.9	Very high	93.8	Very high	113 Å²	113	115.3 Å²	115.3	53%	0.528	62%	0.615	S	S	.	*	H	α-helix	trans	-65.5	-43	176.8	-72.7	178.7	-18.8	0	0	111.8	T69 D70 I71 K76 L77	T69-Q73 WeakPolarHBondContact O-CG 3.41Å; T69-Q73 PolarHBondContact O-N 3.27Å; D70-Q73 PolarHBondContact O-N 3.16Å; I71-Q73 VanDerWaalsContact C-N 3.32Å; I71-Q73 PolarHBondContact O-N 3Å; Q73-K76 PolarHBondContact O-N 3.45Å; Q73-L77 PolarHBondContact O-N 3.24Å; Q73-L77 VanDerWaalsContact O-N 3.16Å
74	Y	96.3	Very high	93.9	Very high	165 Å²	165	111.4 Å²	111.4	65%	0.647	60%	0.604	S	S	*	*	H	α-helix	trans	-61.5	-44.9	175.7	-177	-90.6	0	0	0	112.3	D70 I71 K76 L77 A78	D70-Y74 WeakPolarHBondContact O-CB 3.47Å; D70-Y74 PolarHBondContact O-N 3.41Å; I71-Y74 PolarHBondContact O-N 3.12Å; Y74-K76 VanDerWaalsContact C-N 3.34Å; Y74-K76 PolarHBondContact O-N 3.49Å; Y74-L77 PolarHBondContact O-N 3.06Å; Y74-A78 HydrophobicContact CE1-CB 4.26Å; Y74-A78 WeakPolarHBondContact O-CB 3.41Å; Y74-A78 PolarHBondContact O-N 3.43Å
75	L	95.8	Very high	93.9	Very high	62 Å²	62	114.3 Å²	114.3	33%	0.325	60%	0.6	S	S	.	*	H	α-helix	trans	-62.1	-40.5	178.9	-78.2	170.4	0	0	0	112.2	L67 I71 I72 A78 W79	L67-L75 HydrophobicContact CD2-CD1 3.75Å; I71-L75 HydrophobicContact CG2-CD1 4.06Å; I71-L75 HydrophobicContact CG2-CG 4.29Å; I71-L75 WeakPolarHBondContact O-CB 3.34Å; I71-L75 WeakPolarHBondContact O-CG 3.41Å; I71-L75 PolarHBondContact O-N 2.86Å; I72-L75 PolarHBondContact O-N 3.32Å; L75-A78 PolarHBondContact O-N 3.02Å; L75-W79 HydrophobicContact CD2-CE3 4.33Å; L75-W79 HydrophobicContact CD2-CZ3 4.43Å; L75-W79 PolarHBondContact O-N 3.2Å
76	K	95.4	Very high	93.9	Very high	130 Å²	130	114 Å²	114	57%	0.565	59%	0.589	S	S	*	*	H	α-helix	trans	-59.1	-50.8	174.1	-76.3	-177.9	175.5	-171.1	0	111.1	I72 Q73 Y74 A78 W79 D80	I72-K76 WeakPolarHBondContact O-CG 3.49Å; I72-K76 PolarHBondContact O-N 2.98Å; I72-K76 VanDerWaalsContact O-N 3.12Å; Q73-K76 PolarHBondContact O-N 3.45Å; Y74-K76 VanDerWaalsContact C-N 3.34Å; Y74-K76 PolarHBondContact O-N 3.49Å; K76-A78 VanDerWaalsContact C-N 3.26Å; K76-A78 PolarHBondContact O-N 3.48Å; K76-W79 PolarHBondContact O-N 3.42Å; K76-D80 WeakPolarHBondContact O-CB 3.47Å; K76-D80 PolarHBondContact O-N 2.96Å
77	L	96.7	Very high	93.9	Very high	144 Å²	144	112.9 Å²	112.9	75%	0.754	57%	0.567	S	S	*	*	H	α-helix	trans	-61.2	-32.2	178.5	-76.1	157.2	0	0	0	114	Q73 Y74	Q73-L77 PolarHBondContact O-N 3.24Å; Q73-L77 VanDerWaalsContact O-N 3.16Å; Y74-L77 PolarHBondContact O-N 3.06Å
78	A	96.8	Very high	93.8	Very high	53 Å²	53	116.2 Å²	116.2	44%	0.438	58%	0.582	S	S	.	*	H	α-helix	trans	-86.8	-26.8	-175.4	0	0	0	0	0	114.2	Y74 L75 K76	Y74-A78 HydrophobicContact CE1-CB 4.26Å; Y74-A78 WeakPolarHBondContact O-CB 3.41Å; Y74-A78 PolarHBondContact O-N 3.43Å; L75-A78 PolarHBondContact O-N 3.02Å; K76-A78 VanDerWaalsContact C-N 3.26Å; K76-A78 PolarHBondContact O-N 3.48Å
79	W	93.7	Very high	93.7	Very high	223 Å²	223	120.3 Å²	120.3	85%	0.845	59%	0.592	S	S	*	*	H	α-helix	trans	-121	1.7	-175	-80.9	-10	0	0	0	114.5	L75 K76	L75-W79 HydrophobicContact CD2-CE3 4.33Å; L75-W79 HydrophobicContact CD2-CZ3 4.43Å; L75-W79 PolarHBondContact O-N 3.2Å; K76-W79 PolarHBondContact O-N 3.42Å
80	D	72	Confident	93.5	Very high	186 Å²	186	122.9 Å²	122.9	100%	0.995	59%	0.594	S	S	*	*			trans	-75.4	0	158.1	-74.8	-29.4	0	0	0	110.9	K76	K76-D80 WeakPolarHBondContact O-CB 3.47Å; K76-D80 PolarHBondContact O-N 2.96Å

Retrieved 80 of 80 residues in 40.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).