A0A087X4K0_POEFO Loading...

Ig-like domain-containing protein

AlphaFold DB , UniProt , Accession A0A087X4K0, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 119 aa.

						>A0A087X4K0_POEFO|A0A087X4K0
TMMSLTLLLTILGLLVQGSSGDIIMTQTPGSLSVDPGQRVSIQCKASEHVDNEVDWYLQKPGEAPKLLIYWTSNRQPGVSDRFSGTQSGTDFTLTISRVQAEDAGVYHCQQDWSFPFTQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	T	53	Low	67.5	Low	194 Å²	194	112.5 Å²	112.5	100%	1.19	62%	0.62	S	S	*	*				0	121.7	0	38	0	0	0	0	107.8	M3	T1-M3 PolarHBondContact O-N 3.38Å
2	M	57.6	Low	67.2	Low	196 Å²	196	112.4 Å²	112.4	97%	0.966	62%	0.616	S	S	*	*			trans	-77.3	114.4	-177.6	-66.7	176.6	70.6	0	0	109.1	S4	M2-S4 PolarHBondContact O-N 3.08Å
3	M	59.7	Low	67.1	Low	126 Å²	126	107.7 Å²	107.7	62%	0.621	61%	0.609	S	S	*	*			trans	-72.9	118.7	177.8	-140	148.9	66.8	0	0	108.1	T1 L7 L8	T1-M3 PolarHBondContact O-N 3.38Å; M3-L7 HydrophobicContact CG-CD2 4.02Å; M3-L8 HydrophobicContact CB-CD1 4.48Å; M3-L8 HydrophobicContact CE-CD1 4.14Å
4	S	80.4	Confident	66.6	Low	62 Å²	62	109.4 Å²	109.4	43%	0.434	62%	0.615	S	S	.	*			trans	-58.4	136.7	-177.4	-177.3	0	0	0	0	111.3	M2 T6 L7 L8	M2-S4 PolarHBondContact O-N 3.08Å; S4-T6 PolarHBondContact O-N 2.79Å; S4-T6 PolarHBondContact OG-OG1 3.43Å; S4-L7 WeakPolarHBondContact O-CA 3.17Å; S4-L7 VanDerWaalsContact O-CB 3.3Å; S4-L7 WeakPolarHBondContact O-CB 3.41Å; S4-L7 PolarHBondContact O-N 3.24Å; S4-L8 PolarHBondContact O-N 3.4Å
5	L	68.7	Low	66.2	Low	132 Å²	132	110.8 Å²	110.8	69%	0.691	62%	0.62	S	S	*	*	H	α-helix	trans	-57.2	-33.4	177.5	-172.8	68.4	0	0	0	111.8	L8 L9	L5-L8 WeakPolarHBondContact O-CB 3.09Å; L5-L8 PolarHBondContact O-N 2.9Å; L5-L9 HydrophobicContact CG-CD1 4.26Å; L5-L9 VanDerWaalsContact O-CG 3.31Å; L5-L9 WeakPolarHBondContact O-CG 3.31Å; L5-L9 PolarHBondContact O-N 2.88Å
6	T	72.3	Confident	65.8	Low	96 Å²	96	111.1 Å²	111.1	59%	0.589	63%	0.625	S	S	*	*	H	α-helix	trans	-63.8	-42.4	173.6	53.8	0	0	0	0	111.9	S4 L8 L9 T10	S4-T6 PolarHBondContact O-N 2.79Å; S4-T6 PolarHBondContact OG-OG1 3.43Å; T6-L8 VanDerWaalsContact C-N 3.32Å; T6-L8 PolarHBondContact O-N 3.5Å; T6-L9 PolarHBondContact O-N 2.84Å; T6-T10 WeakPolarHBondContact O-CG2 3.35Å; T6-T10 PolarHBondContact O-N 2.78Å; T6-T10 PolarHBondContact O-OG1 3.05Å; T6-T10 VanDerWaalsContact O-OG1 3.12Å
7	L	68.6	Low	65.6	Low	85 Å²	85	114.8 Å²	114.8	45%	0.445	64%	0.636	S	S	.	*	H	α-helix	trans	-64.5	-40.2	176.7	-169.2	69.5	0	0	0	110.6	M3 S4 T10 I11	M3-L7 HydrophobicContact CG-CD2 4.02Å; S4-L7 WeakPolarHBondContact O-CA 3.17Å; S4-L7 VanDerWaalsContact O-CB 3.3Å; S4-L7 WeakPolarHBondContact O-CB 3.41Å; S4-L7 PolarHBondContact O-N 3.24Å; L7-T10 VanDerWaalsContact CA-OG1 3.3Å; L7-T10 WeakPolarHBondContact CA-OG1 3.42Å; L7-T10 PolarHBondContact O-N 2.67Å; L7-T10 PolarHBondContact O-OG1 2.97Å; L7-I11 HydrophobicContact CG-CD1 3.93Å; L7-I11 WeakPolarHBondContact O-CB 3.28Å; L7-I11 WeakPolarHBondContact O-CD1 3.46Å; L7-I11 WeakPolarHBondContact O-CG1 3.39Å; L7-I11 PolarHBondContact O-N 3.48Å
8	L	70.9	Confident	65.1	Low	84 Å²	84	112.3 Å²	112.3	44%	0.44	64%	0.641	S	S	.	*	H	α-helix	trans	-63.4	-44.2	177	-127.3	136.4	0	0	0	112.1	M3 S4 L5 T6 I11 L12	M3-L8 HydrophobicContact CB-CD1 4.48Å; M3-L8 HydrophobicContact CE-CD1 4.14Å; S4-L8 PolarHBondContact O-N 3.4Å; L5-L8 WeakPolarHBondContact O-CB 3.09Å; L5-L8 PolarHBondContact O-N 2.9Å; T6-L8 VanDerWaalsContact C-N 3.32Å; T6-L8 PolarHBondContact O-N 3.5Å; L8-I11 PolarHBondContact O-N 3.29Å; L8-L12 WeakPolarHBondContact O-CB 3.46Å; L8-L12 PolarHBondContact O-N 2.88Å
9	L	71.8	Confident	64.8	Low	111 Å²	111	112.6 Å²	112.6	58%	0.581	65%	0.651	S	S	*	*	H	α-helix	trans	-67.4	-38.6	176.3	-70.8	165.4	0	0	0	112.3	L5 T6 L12 G13	L5-L9 HydrophobicContact CG-CD1 4.26Å; L5-L9 VanDerWaalsContact O-CG 3.31Å; L5-L9 WeakPolarHBondContact O-CG 3.31Å; L5-L9 PolarHBondContact O-N 2.88Å; T6-L9 PolarHBondContact O-N 2.84Å; L9-L12 PolarHBondContact O-N 2.97Å; L9-G13 PolarHBondContact O-N 3.35Å
10	T	71.2	Confident	64.8	Low	79 Å²	79	112 Å²	112	49%	0.485	65%	0.653	S	S	.	*	H	α-helix	trans	-67	-39.3	174.5	51.7	0	0	0	0	112.5	T6 L7 G13 L14	T6-T10 WeakPolarHBondContact O-CG2 3.35Å; T6-T10 PolarHBondContact O-N 2.78Å; T6-T10 PolarHBondContact O-OG1 3.05Å; T6-T10 VanDerWaalsContact O-OG1 3.12Å; L7-T10 VanDerWaalsContact CA-OG1 3.3Å; L7-T10 WeakPolarHBondContact CA-OG1 3.42Å; L7-T10 PolarHBondContact O-N 2.67Å; L7-T10 PolarHBondContact O-OG1 2.97Å; T10-G13 PolarHBondContact O-N 3.31Å; T10-L14 WeakPolarHBondContact O-CD1 3.21Å; T10-L14 VanDerWaalsContact O-CG 3.28Å; T10-L14 WeakPolarHBondContact O-CG 3.45Å; T10-L14 PolarHBondContact O-N 2.63Å
11	I	68.7	Low	65.1	Low	73 Å²	73	108.4 Å²	108.4	37%	0.374	64%	0.64	S	S	.	*	H	α-helix	trans	-65.8	-43.2	175.4	-69.5	163	0	0	0	110	L7 L8 G13 L14 L15	L7-I11 HydrophobicContact CG-CD1 3.93Å; L7-I11 WeakPolarHBondContact O-CB 3.28Å; L7-I11 WeakPolarHBondContact O-CD1 3.46Å; L7-I11 WeakPolarHBondContact O-CG1 3.39Å; L7-I11 PolarHBondContact O-N 3.48Å; L8-I11 PolarHBondContact O-N 3.29Å; I11-G13 VanDerWaalsContact C-N 3.32Å; I11-G13 PolarHBondContact O-N 3.37Å; I11-L14 PolarHBondContact O-N 3.47Å; I11-L15 HydrophobicContact CG2-CD1 4Å; I11-L15 HydrophobicContact CG2-CG 4.43Å; I11-L15 VanDerWaalsContact O-CG 3.31Å; I11-L15 WeakPolarHBondContact O-CG 3.28Å; I11-L15 PolarHBondContact O-N 3.04Å
12	L	64	Low	66.6	Low	111 Å²	111	103.6 Å²	103.6	58%	0.581	61%	0.607	S	S	*	*	H	α-helix	trans	-62	-40.8	177.5	-154.7	76.4	0	0	0	111.5	L8 L9 L15 V16	L8-L12 WeakPolarHBondContact O-CB 3.46Å; L8-L12 PolarHBondContact O-N 2.88Å; L9-L12 PolarHBondContact O-N 2.97Å; L12-L15 PolarHBondContact O-N 2.78Å; L12-V16 WeakPolarHBondContact O-CG2 3.32Å; L12-V16 PolarHBondContact O-N 2.87Å
13	G	65.3	Low	68.2	Low	51 Å²	51	94.8 Å²	94.8	53%	0.526	56%	0.564	S	S	.	*	H	α-helix	trans	-65.5	-33.9	174.6	0	0	0	0	0	114.1	L9 T10 I11 V16	L9-G13 PolarHBondContact O-N 3.35Å; T10-G13 PolarHBondContact O-N 3.31Å; I11-G13 VanDerWaalsContact C-N 3.32Å; I11-G13 PolarHBondContact O-N 3.37Å; G13-V16 PolarHBondContact O-N 3.06Å
14	L	61	Low	69.8	Low	132 Å²	132	93.5 Å²	93.5	69%	0.691	56%	0.558	S	S	*	*	H	α-helix	trans	-74.8	-23	175.2	-72.2	164.7	0	0	0	113.2	T10 I11 V16 Q17	T10-L14 WeakPolarHBondContact O-CD1 3.21Å; T10-L14 VanDerWaalsContact O-CG 3.28Å; T10-L14 WeakPolarHBondContact O-CG 3.45Å; T10-L14 PolarHBondContact O-N 2.63Å; I11-L14 PolarHBondContact O-N 3.47Å; L14-V16 VanDerWaalsContact C-N 3.35Å; L14-Q17 WeakPolarHBondContact O-CG 3.44Å
15	L	59.9	Low	70.5	Confident	130 Å²	130	91.8 Å²	91.8	68%	0.681	54%	0.544	S	S	*	.	H	α-helix	trans	-81.2	-13	175.4	-69.1	170.5	0	0	0	113	I11 L12 Q17	I11-L15 HydrophobicContact CG2-CD1 4Å; I11-L15 HydrophobicContact CG2-CG 4.43Å; I11-L15 VanDerWaalsContact O-CG 3.31Å; I11-L15 WeakPolarHBondContact O-CG 3.28Å; I11-L15 PolarHBondContact O-N 3.04Å; L12-L15 PolarHBondContact O-N 2.78Å; L15-Q17 PolarHBondContact O-N 3.35Å; L15-Q17 VanDerWaalsContact O-N 3.08Å
16	V	60.6	Low	71.9	Confident	116 Å²	116	89.3 Å²	89.3	70%	0.703	53%	0.534	S	S	*	.			trans	-83.8	50.8	169.2	-161.9	0	0	0	0	109.8	L12 G13 L14 G18	L12-V16 WeakPolarHBondContact O-CG2 3.32Å; L12-V16 PolarHBondContact O-N 2.87Å; G13-V16 PolarHBondContact O-N 3.06Å; L14-V16 VanDerWaalsContact C-N 3.35Å; V16-G18 PolarHBondContact O-N 3.21Å
17	Q	60.9	Low	73.1	Confident	173 Å²	173	87.6 Å²	87.6	81%	0.808	52%	0.519	S	S	*	.			trans	-76.3	110.7	156.5	-61.5	-137.9	-72.6	0	0	105.4	L14 L15 S19	L14-Q17 WeakPolarHBondContact O-CG 3.44Å; L15-Q17 PolarHBondContact O-N 3.35Å; L15-Q17 VanDerWaalsContact O-N 3.08Å; Q17-S19 PolarHBondContact O-N 3.37Å; Q17-S19 VanDerWaalsContact O-N 3.16Å
18	G	56.7	Low	74.5	Confident	71 Å²	71	87 Å²	87	73%	0.732	52%	0.52	S	S	*	.			trans	-48.6	122.9	-177.4	0	0	0	0	0	110.7	V16 S20	V16-G18 PolarHBondContact O-N 3.21Å; G18-S20 PolarHBondContact O-N 2.58Å; G18-S20 VanDerWaalsContact O-N 3.14Å
19	S	59.5	Low	75.8	Confident	118 Å²	118	85.5 Å²	85.5	83%	0.825	52%	0.515	S	S	*	.			trans	-67.4	107.7	168.2	-180	0	0	0	0	107.1	Q17 G21	Q17-S19 PolarHBondContact O-N 3.37Å; Q17-S19 VanDerWaalsContact O-N 3.16Å; S19-G21 PolarHBondContact O-N 2.93Å; S19-G21 VanDerWaalsContact O-N 3.11Å
20	S	66.2	Low	76.9	Confident	100 Å²	100	84.3 Å²	84.3	70%	0.699	53%	0.529	S	S	*	.			trans	-69.7	105.8	171.8	-165	0	0	0	0	107.6	G18	G18-S20 PolarHBondContact O-N 2.58Å; G18-S20 VanDerWaalsContact O-N 3.14Å
21	G	71.3	Confident	78.1	Confident	36 Å²	36	85.7 Å²	85.7	37%	0.371	54%	0.542	S	S	.	.	P	Polyproline II helix	trans	-80.5	169	169.1	0	0	0	0	0	111	S19	S19-G21 PolarHBondContact O-N 2.93Å; S19-G21 VanDerWaalsContact O-N 3.11Å
22	D	83.6	Confident	79.4	Confident	94 Å²	94	87.4 Å²	87.4	50%	0.503	55%	0.551	S	S	.	*	P	Polyproline II helix	trans	-66.1	135	172.7	-65.6	-14.2	0	0	0	110.2	I24 P116	D22-I24 HydrophobicContact CB-CD1 4.3Å; D22-I24 PolarHBondContact O-N 3.09Å; D22-P116 HydrophobicContact CB-CG 4.46Å; D22-P116 WeakPolarHBondContact OD1-CD 3.31Å; D22-P116 WeakPolarHBondContact OD1-CG 3.5Å
23	I	91	Very high	81	Confident	11 Å²	11	87.8 Å²	87.8	6%	0.056	56%	0.563	C	S	.	*	P	Polyproline II helix	trans	-76.1	116.8	173.2	-58.3	-173.4	0	0	0	109.1	A46 E48 V50 Q111 S114	I23-A46 HydrophobicContact CG2-CB 4.25Å; I23-E48 HydrophobicContact CD1-CB 4.32Å; I23-E48 HydrophobicContact CG1-CB 4.37Å; I23-V50 HydrophobicContact CD1-CG1 3.43Å; I23-V50 VanDerWaalsContact CD1-CG1 3.43Å; I23-V50 HydrophobicContact CG2-CG1 3.82Å; I23-Q111 HydrophobicContact CB-CG 4.27Å; I23-Q111 HydrophobicContact CG2-CG 4.12Å; I23-S114 WeakPolarHBondContact CD1-OG 3.41Å
24	I	93.4	Very high	82.4	Confident	98 Å²	98	87.2 Å²	87.2	50%	0.503	55%	0.549	S	S	.	.	P	Polyproline II helix	trans	-91.4	128.3	-178.2	-53.5	-56.7	0	0	0	109.9	D22 A46 S47	D22-I24 HydrophobicContact CB-CD1 4.3Å; D22-I24 PolarHBondContact O-N 3.09Å; I24-A46 WeakPolarHBondContact O-CA 3.43Å; I24-S47 PolarHBondContact N-OG 3.41Å; I24-S47 PolarHBondContact O-N 2.87Å
25	M	95.8	Very high	84.1	Confident	27 Å²	27	86.1 Å²	86.1	13%	0.133	54%	0.544	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.9	119.6	174.4	-60.1	-66.4	-92	0	0	109.8	C44 K45 A46 V54 C109 Q111 T118	M25-C44 WeakPolarHBondContact CE-SG 3.31Å; M25-K45 WeakPolarHBondContact CA-O 3.14Å; M25-A46 HydrophobicContact SD-CB 3.64Å; M25-V54 HydrophobicContact CE-CG1 3.95Å; M25-V54 HydrophobicContact CE-CG2 3.75Å; M25-C109 HydrophobicContact CE-CB 4.34Å; M25-Q111 HydrophobicContact CE-CB 4.02Å; M25-Q111 HydrophobicContact CG-CG 4.26Å; M25-Q111 HydrophobicContact SD-CB 4.12Å; M25-Q111 HydrophobicContact SD-CG 4.19Å; M25-T118 HydrophobicContact CB-CG2 3.63Å; M25-T118 HydrophobicContact CG-CG2 3.23Å
26	T	97.4	Very high	85.9	Confident	80 Å²	80	84.6 Å²	84.6	49%	0.491	54%	0.542	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.2	119.2	-179.8	-56.1	0	0	0	0	110.5	C44 K45	T26-C44 CarbonylContact O-C 3.5Å; T26-C44 WeakPolarHBondContact O-CA 3.28Å; T26-K45 PolarHBondContact N-O 2.95Å; T26-K45 PolarHBondContact O-N 3.43Å
27	Q	98.1	Very high	87.7	Confident	59 Å²	59	81.4 Å²	81.4	28%	0.276	53%	0.533	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.3	146.1	-179.1	-73.3	-176.9	-118.2	0	0	113.5	Q43 C44 Y107 C109	Q27-Q43 CarbonylContact C-O 3.36Å; Q27-Q43 VanDerWaalsContact CA-O 3.23Å; Q27-Q43 WeakPolarHBondContact CA-O 3.47Å; Q27-C44 HydrophobicContact CG-CB 4.15Å; Q27-Y107 PolarHBondContact NE2-O 2.92Å; Q27-C109 VanDerWaalsContact CD-SG 3.54Å; Q27-C109 WeakPolarHBondContact CG-SG 3.3Å; Q27-C109 PolarHBondContact OE1-SG 3.46Å
28	T	98	Very high	89.5	Confident	74 Å²	74	77.9 Å²	77.9	45%	0.454	52%	0.516	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.2	140.1	175.9	-64.6	0	0	0	0	110.6	Q43	T28-Q43 PolarHBondContact N-O 2.9Å; T28-Q43 PolarHBondContact O-N 2.99Å
29	P	97.4	Very high	91.5	Very high	52 Å²	52	83.4 Å²	83.4	34%	0.338	52%	0.515	S	S	.	.			cis	-72.7	157.3	-5.9	32.8	-35.7	0	0	0	112.1	S31 L32	P29-S31 VanDerWaalsContact C-N 3.31Å; P29-S31 PolarHBondContact O-N 3.17Å; P29-L32 HydrophobicContact CG-CB 4Å; P29-L32 HydrophobicContact CG-CD2 4.37Å
30	G	95.5	Very high	93.3	Very high	85 Å²	85	78.6 Å²	78.6	88%	0.876	48%	0.48	S	S	*	.	S	Bend	trans	-70	-26.7	176.8	0	0	0	0	0	113.7
31	S	96.1	Very high	94.8	Very high	108 Å²	108	76.3 Å²	76.3	76%	0.755	46%	0.464	S	S	*	.			trans	-154.5	152.7	169.7	65.4	0	0	0	0	109.7	P29	P29-S31 VanDerWaalsContact C-N 3.31Å; P29-S31 PolarHBondContact O-N 3.17Å
32	L	95.8	Very high	96.1	Very high	110 Å²	110	75.6 Å²	75.6	58%	0.576	45%	0.452	S	S	*	.			trans	-152.7	140.2	179	-172.5	68.3	0	0	0	110	P29 V34 V40	P29-L32 HydrophobicContact CG-CB 4Å; P29-L32 HydrophobicContact CG-CD2 4.37Å; L32-V34 HydrophobicContact CB-CG2 4.45Å; L32-V34 HydrophobicContact CD2-CG2 3.33Å; L32-V34 HydrophobicContact CG-CG2 3.5Å; L32-V40 HydrophobicContact CD2-CB 4.46Å; L32-V40 HydrophobicContact CD2-CG2 3.36Å
33	S	96.6	Very high	96.8	Very high	118 Å²	118	76.3 Å²	76.3	83%	0.825	45%	0.452	S	S	*	.			trans	-106.6	129.4	167.8	-172.6	0	0	0	0	108.4
34	V	95.6	Very high	97.2	Very high	40 Å²	40	75.8 Å²	75.8	24%	0.242	45%	0.45	C	S	.	.			trans	-137.4	137.9	-173.3	-175.2	0	0	0	0	109.1	L32 Q38 V40 V99	L32-V34 HydrophobicContact CB-CG2 4.45Å; L32-V34 HydrophobicContact CD2-CG2 3.33Å; L32-V34 HydrophobicContact CG-CG2 3.5Å; V34-Q38 HydrophobicContact CG1-CB 3.64Å; V34-Q38 HydrophobicContact CG1-CG 4.49Å; V34-V40 HydrophobicContact CG2-CB 4.35Å; V34-V40 HydrophobicContact CG2-CG2 4.27Å; V34-V99 HydrophobicContact CG1-CB 4.41Å; V34-V99 HydrophobicContact CG1-CG2 4.12Å
35	D	97.1	Very high	97.4	Very high	108 Å²	108	75.8 Å²	75.8	58%	0.578	45%	0.446	S	S	*	.			trans	-78.1	145.1	175.2	-67.7	-39.2	0	0	0	111.2	G37 Q38	D35-G37 PolarHBondContact O-N 3.23Å; D35-Q38 HydrophobicContact CB-CG 4.27Å; D35-Q38 WeakPolarHBondContact O-CB 3.16Å; D35-Q38 PolarHBondContact O-N 3.23Å; D35-Q38 VanDerWaalsContact O-N 3.17Å
36	P	97.8	Very high	97.4	Very high	98 Å²	98	74.5 Å²	74.5	64%	0.636	44%	0.44	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.1	139.6	173.5	-27	35.1	0	0	0	112.7	Q38 V99	P36-Q38 VanDerWaalsContact C-N 3.31Å; P36-Q38 PolarHBondContact O-N 2.8Å; P36-V99 CarbonylContact C-O 3.02Å; P36-V99 WeakPolarHBondContact CA-O 3.49Å
37	G	98	Very high	97.4	Very high	49 Å²	49	74 Å²	74	51%	0.505	44%	0.439	S	S	.	.	T	Hydrogen-bonded Turn	trans	87.9	-15.1	-177.9	0	0	0	0	0	114.7	D35 V99	D35-G37 PolarHBondContact O-N 3.23Å; G37-V99 PolarHBondContact N-O 3.19Å
38	Q	98.4	Very high	97.2	Very high	100 Å²	100	75.7 Å²	75.7	47%	0.467	45%	0.448	S	S	.	.			trans	-74	159.1	174.4	-65.4	-170	-21.8	0	0	112.1	V34 D35 P36 V99	V34-Q38 HydrophobicContact CG1-CB 3.64Å; V34-Q38 HydrophobicContact CG1-CG 4.49Å; D35-Q38 HydrophobicContact CB-CG 4.27Å; D35-Q38 WeakPolarHBondContact O-CB 3.16Å; D35-Q38 PolarHBondContact O-N 3.23Å; D35-Q38 VanDerWaalsContact O-N 3.17Å; P36-Q38 VanDerWaalsContact C-N 3.31Å; P36-Q38 PolarHBondContact O-N 2.8Å; Q38-V99 WeakPolarHBondContact O-CG2 3.42Å; Q38-V99 PolarHBondContact O-N 3.43Å
39	R	98.4	Very high	97	Very high	186 Å²	186	77.5 Å²	77.5	70%	0.702	45%	0.451	S	S	*	.			trans	-91.4	134.7	172.5	-177.7	179.7	-148.4	158	5.9	109.5	T95 I96	R39-T95 HydrophobicContact CG-CG2 4.15Å; R39-I96 WeakPolarHBondContact CA-O 3.46Å
40	V	97.8	Very high	96.8	Very high	17 Å²	17	75 Å²	75	10%	0.103	44%	0.435	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.4	149.4	173.2	62.5	0	0	0	0	110.6	L32 V34 T95 I96 V99	L32-V40 HydrophobicContact CD2-CB 4.46Å; L32-V40 HydrophobicContact CD2-CG2 3.36Å; V34-V40 HydrophobicContact CG2-CB 4.35Å; V34-V40 HydrophobicContact CG2-CG2 4.27Å; V40-T95 WeakPolarHBondContact O-CA 3.4Å; V40-I96 HydrophobicContact CG1-CB 3.75Å; V40-I96 HydrophobicContact CG1-CD1 3.92Å; V40-I96 HydrophobicContact CG1-CG1 3.94Å; V40-I96 PolarHBondContact N-O 3.02Å; V40-I96 PolarHBondContact O-N 3.35Å; V40-V99 HydrophobicContact CB-CG2 4.26Å; V40-V99 HydrophobicContact CG1-CG2 3.45Å; V40-V99 VanDerWaalsContact CG1-CG2 3.45Å
41	S	98.1	Very high	96.8	Very high	52 Å²	52	74.4 Å²	74.4	36%	0.364	41%	0.411	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.5	135.5	170.5	-63.6	0	0	0	0	110.1	L94 T95	S41-L94 CarbonylContact C-O 3.57Å; S41-L94 VanDerWaalsContact CA-O 3.24Å; S41-L94 WeakPolarHBondContact CA-O 3.35Å; S41-T95 PolarHBondContact OG-OG1 3.14Å; S41-T95 VanDerWaalsContact OG-OG1 3.13Å
42	I	98.6	Very high	96.8	Very high	21 Å²	21	71.8 Å²	71.8	11%	0.108	39%	0.388	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.9	125.8	174.5	-51.4	177.7	0	0	0	106.6	W56 T93 L94 Y107	I42-W56 HydrophobicContact CB-CH2 4.23Å; I42-W56 HydrophobicContact CB-CZ3 4.19Å; I42-W56 HydrophobicContact CG2-CH2 3.97Å; I42-W56 HydrophobicContact CG2-CZ3 3.82Å; I42-W56 WeakPolarHBondContact O-CH2 3.32Å; I42-T93 CarbonylContact O-C 3.57Å; I42-T93 WeakPolarHBondContact O-CA 3.36Å; I42-L94 HydrophobicContact CB-CB 4.47Å; I42-L94 HydrophobicContact CD1-CD2 4.47Å; I42-L94 PolarHBondContact N-O 2.83Å; I42-L94 PolarHBondContact O-N 3.05Å; I42-Y107 HydrophobicContact CD1-CD1 3.99Å; I42-Y107 HydrophobicContact CD1-CD2 3.68Å; I42-Y107 HydrophobicContact CD1-CE2 4.35Å; I42-Y107 HydrophobicContact CD1-CG 3.48Å; I42-Y107 VanDerWaalsContact CD1-CG 3.48Å
43	Q	98.6	Very high	96.8	Very high	109 Å²	109	68.7 Å²	68.7	51%	0.509	37%	0.371	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.6	146.4	-179.6	-64.6	170.6	20.3	0	0	109.8	Q27 T28 F92	Q27-Q43 CarbonylContact C-O 3.36Å; Q27-Q43 VanDerWaalsContact CA-O 3.23Å; Q27-Q43 WeakPolarHBondContact CA-O 3.47Å; T28-Q43 PolarHBondContact N-O 2.9Å; T28-Q43 PolarHBondContact O-N 2.99Å; Q43-F92 CarbonylContact C-O 3.55Å; Q43-F92 WeakPolarHBondContact CA-O 2.97Å
44	C	98.3	Very high	96.9	Very high	1 Å²	1	63 Å²	63	1%	0.007	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.8	121.9	172.1	177.6	0	0	0	0	108.8	M25 T26 Q27 W56 F92 C109	M25-C44 WeakPolarHBondContact CE-SG 3.31Å; T26-C44 CarbonylContact O-C 3.5Å; T26-C44 WeakPolarHBondContact O-CA 3.28Å; Q27-C44 HydrophobicContact CG-CB 4.15Å; C44-W56 HydrophobicContact CB-CH2 3.54Å; C44-W56 HydrophobicContact CB-CZ2 3.66Å; C44-W56 HydrophobicContact CB-CZ3 4.49Å; C44-F92 HydrophobicContact CB-CB 4.33Å; C44-F92 PolarHBondContact N-O 2.85Å; C44-F92 PolarHBondContact O-N 2.9Å; C44-C109 HydrophobicContact CB-CB 3.51Å; C44-C109 WeakPolarHBondContact CB-SG 3.37Å; C44-C109 WeakPolarHBondContact SG-CB 3.42Å; C44-C109 CovalentContact SG-SG 2.02Å; C44-C109 PolarHBondContact SG-SG 3.39Å
45	K	98.1	Very high	97	Very high	97 Å²	97	61.8 Å²	61.8	42%	0.422	32%	0.324	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.8	121.5	-179.7	-174.5	-179.5	-162.8	81.2	0	110	M25 T26 T90 D91	M25-K45 WeakPolarHBondContact CA-O 3.14Å; T26-K45 PolarHBondContact N-O 2.95Å; T26-K45 PolarHBondContact O-N 3.43Å; K45-T90 WeakPolarHBondContact CA-O 3.29Å; K45-D91 WeakPolarHBondContact CG-OD1 3.06Å; K45-D91 VanDerWaalsContact NZ-CG 3.35Å; K45-D91 IonicContact NZ-OD1 3.04Å; K45-D91 PolarHBondContact NZ-OD1 3.14Å; K45-D91 IonicContact NZ-OD2 2.67Å; K45-D91 PolarHBondContact NZ-OD2 2.77Å
46	A	96.7	Very high	97.1	Very high	1 Å²	1	56.7 Å²	56.7	1%	0.008	30%	0.296	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.7	141.1	168.2	0	0	0	0	0	110.1	I23 I24 M25 E48 V50 T90 F92	I23-A46 HydrophobicContact CG2-CB 4.25Å; I24-A46 WeakPolarHBondContact O-CA 3.43Å; M25-A46 HydrophobicContact SD-CB 3.64Å; A46-E48 VanDerWaalsContact CB-O 3.22Å; A46-E48 WeakPolarHBondContact CB-O 3.35Å; A46-E48 PolarHBondContact O-N 2.87Å; A46-V50 HydrophobicContact CB-CG1 4.35Å; A46-V50 HydrophobicContact CB-CG2 4.06Å; A46-T90 PolarHBondContact N-O 2.95Å; A46-T90 WeakPolarHBondContact O-CB 3.42Å; A46-T90 PolarHBondContact O-OG1 2.8Å; A46-F92 HydrophobicContact CB-CE2 4.13Å
47	S	95.8	Very high	97.1	Very high	68 Å²	68	54.5 Å²	54.5	48%	0.476	28%	0.276	S	S	.	.	S	Bend	trans	-67.8	-23.3	174.2	57.9	0	0	0	0	112.9	I24	I24-S47 PolarHBondContact N-OG 3.41Å; I24-S47 PolarHBondContact O-N 2.87Å
48	E	93.8	Very high	97.1	Very high	96 Å²	96	52.9 Å²	52.9	45%	0.449	26%	0.256	S	S	.	.	S	Bend	trans	-137.6	172.1	-178.1	-62.1	-172.6	-160.3	0	0	110.5	I23 A46 T90	I23-E48 HydrophobicContact CD1-CB 4.32Å; I23-E48 HydrophobicContact CG1-CB 4.37Å; A46-E48 VanDerWaalsContact CB-O 3.22Å; A46-E48 WeakPolarHBondContact CB-O 3.35Å; A46-E48 PolarHBondContact O-N 2.87Å; E48-T90 WeakPolarHBondContact O-CG2 3.42Å
49	H	93.8	Very high	97.1	Very high	112 Å²	112	51.3 Å²	51.3	52%	0.519	25%	0.248	S	C	.	.			trans	-73.5	128.9	176.4	-178.3	72.2	0	0	0	110.9	D51	H49-D51 PolarHBondContact NE2-N 2.66Å
50	V	95	Very high	97.1	Very high	0 Å²	0	45.4 Å²	45.4	0%	0	23%	0.227	C	C	.	.			trans	-125.3	25.6	-178.6	-64.7	0	0	0	0	112.6	I23 A46 N52 E53 V54 F92 Q111 W113	I23-V50 HydrophobicContact CD1-CG1 3.43Å; I23-V50 VanDerWaalsContact CD1-CG1 3.43Å; I23-V50 HydrophobicContact CG2-CG1 3.82Å; A46-V50 HydrophobicContact CB-CG1 4.35Å; A46-V50 HydrophobicContact CB-CG2 4.06Å; V50-N52 PolarHBondContact O-N 2.78Å; V50-E53 WeakPolarHBondContact O-CB 3.42Å; V50-E53 PolarHBondContact O-N 3.08Å; V50-V54 HydrophobicContact CG2-CG2 3.63Å; V50-F92 HydrophobicContact CG2-CE2 3.74Å; V50-F92 HydrophobicContact CG2-CZ 3.48Å; V50-F92 VanDerWaalsContact CG2-CZ 3.48Å; V50-Q111 HydrophobicContact CB-CB 4.26Å; V50-Q111 HydrophobicContact CG1-CB 4.02Å; V50-Q111 HydrophobicContact CG1-CG 4.26Å; V50-Q111 HydrophobicContact CG2-CB 4.38Å; V50-W113 HydrophobicContact CB-CB 3.73Å; V50-W113 HydrophobicContact CB-CG 4.18Å; V50-W113 HydrophobicContact CG1-CB 4.07Å; V50-W113 HydrophobicContact CG1-CG 4.48Å
51	D	95	Very high	97	Very high	71 Å²	71	50.4 Å²	50.4	38%	0.38	26%	0.261	S	S	.	.	T	Hydrogen-bonded Turn	trans	47.2	-133.7	-171.6	-156.8	-16.6	0	0	0	111.3	H49 Q87 W113	H49-D51 PolarHBondContact NE2-N 2.66Å; D51-Q87 PolarHBondContact O-NE2 3.35Å; D51-Q87 PolarHBondContact O-OE1 3.11Å; D51-W113 HydrophobicContact CB-CD2 4.45Å; D51-W113 HydrophobicContact CB-CE3 3.78Å; D51-W113 HydrophobicContact CB-CH2 4.32Å; D51-W113 HydrophobicContact CB-CZ3 3.7Å
52	N	95.9	Very high	97	Very high	53 Å²	53	52.4 Å²	52.4	28%	0.283	29%	0.289	S	S	.	.	T	Hydrogen-bonded Turn	trans	-98.8	12.3	172.9	69.9	-44.2	0	0	0	113.3	V50 V54 W71 T72	V50-N52 PolarHBondContact O-N 2.78Å; N52-V54 PolarHBondContact O-N 2.78Å; N52-W71 CarbonylContact O-C 3.5Å; N52-W71 WeakPolarHBondContact O-CA 3.45Å; N52-T72 WeakPolarHBondContact CA-OG1 3.35Å; N52-T72 PolarHBondContact O-N 2.84Å; N52-T72 VanDerWaalsContact O-N 3.08Å; N52-T72 PolarHBondContact O-OG1 3.24Å
53	E	96	Very high	96.9	Very high	45 Å²	45	55.1 Å²	55.1	21%	0.21	30%	0.302	C	S	.	.			trans	-81.7	58.6	-175.7	-61.9	-63.6	-174.7	0	0	110.7	V50 W71 Q111 D112 W113	V50-E53 WeakPolarHBondContact O-CB 3.42Å; V50-E53 PolarHBondContact O-N 3.08Å; E53-W71 PolarHBondContact OE2-NE1 2.88Å; E53-Q111 VanDerWaalsContact O-CA 3.23Å; E53-Q111 WeakPolarHBondContact O-CA 3.3Å; E53-D112 VanDerWaalsContact CB-OD1 3.28Å; E53-D112 WeakPolarHBondContact CB-OD1 3.38Å; E53-D112 PolarHBondContact O-N 3Å; E53-W113 HydrophobicContact CB-CB 3.96Å; E53-W113 HydrophobicContact CG-CB 4.35Å; E53-W113 HydrophobicContact CG-CE3 3.78Å
54	V	97.9	Very high	96.8	Very high	0 Å²	0	53.5 Å²	53.5	0%	0	31%	0.307	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.5	127.4	172.5	175.9	0	0	0	0	111	M25 V50 N52 T72 F92 C109 Q110 Q111	M25-V54 HydrophobicContact CE-CG1 3.95Å; M25-V54 HydrophobicContact CE-CG2 3.75Å; V50-V54 HydrophobicContact CG2-CG2 3.63Å; N52-V54 PolarHBondContact O-N 2.78Å; V54-T72 PolarHBondContact O-N 2.89Å; V54-F92 HydrophobicContact CB-CD1 3.7Å; V54-F92 HydrophobicContact CB-CE1 3.78Å; V54-F92 HydrophobicContact CB-CG 4.13Å; V54-F92 HydrophobicContact CB-CZ 4.31Å; V54-F92 HydrophobicContact CG1-CB 4.33Å; V54-F92 HydrophobicContact CG1-CD1 4.09Å; V54-F92 HydrophobicContact CG1-CG 4.08Å; V54-F92 HydrophobicContact CG2-CD1 3.75Å; V54-F92 HydrophobicContact CG2-CD2 3.96Å; V54-F92 HydrophobicContact CG2-CE1 3.46Å; V54-F92 VanDerWaalsContact CG2-CE1 3.46Å; V54-F92 HydrophobicContact CG2-CE2 3.72Å; V54-F92 HydrophobicContact CG2-CG 3.99Å; V54-F92 HydrophobicContact CG2-CZ 3.48Å; V54-F92 VanDerWaalsContact CG2-CZ 3.48Å; V54-C109 HydrophobicContact CG1-CB 4.28Å; V54-Q110 VanDerWaalsContact CA-O 3.31Å; V54-Q110 WeakPolarHBondContact CA-O 3.42Å; V54-Q111 HydrophobicContact CG2-CB 4.39Å
55	D	98.3	Very high	96.8	Very high	14 Å²	14	56.7 Å²	56.7	8%	0.075	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.8	151.4	179.2	-69.7	-7.3	0	0	0	111.2	Y57 L67 I69 Y70 W71 C109 Q110	D55-Y57 HydrophobicContact CB-CD2 4.4Å; D55-Y57 HydrophobicContact CB-CE2 3.5Å; D55-Y57 VanDerWaalsContact CB-CE2 3.5Å; D55-Y57 PolarHBondContact OD2-OH 3Å; D55-L67 HydrophobicContact CB-CD1 3.99Å; D55-I69 CarbonylContact C-O 3.55Å; D55-I69 WeakPolarHBondContact CA-O 3.09Å; D55-Y70 WeakPolarHBondContact OD1-CA 3.38Å; D55-Y70 VanDerWaalsContact OD1-CB 3.28Å; D55-Y70 WeakPolarHBondContact OD1-CB 3.23Å; D55-W71 PolarHBondContact OD1-N 3.16Å; D55-W71 VanDerWaalsContact OD1-N 3.14Å; D55-C109 VanDerWaalsContact O-CA 3.28Å; D55-C109 WeakPolarHBondContact O-CA 3.31Å; D55-Q110 PolarHBondContact N-O 2.98Å; D55-Q110 PolarHBondContact O-N 2.96Å
56	W	98.7	Very high	96.8	Very high	1 Å²	1	57.8 Å²	57.8	0%	0.004	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	133.2	175.6	-71.6	92.1	0	0	0	111.3	I42 C44 L68 I69 F92 L94 H108 C109	I42-W56 HydrophobicContact CB-CH2 4.23Å; I42-W56 HydrophobicContact CB-CZ3 4.19Å; I42-W56 HydrophobicContact CG2-CH2 3.97Å; I42-W56 HydrophobicContact CG2-CZ3 3.82Å; I42-W56 WeakPolarHBondContact O-CH2 3.32Å; C44-W56 HydrophobicContact CB-CH2 3.54Å; C44-W56 HydrophobicContact CB-CZ2 3.66Å; C44-W56 HydrophobicContact CB-CZ3 4.49Å; W56-L68 HydrophobicContact CB-CB 4.49Å; W56-L68 WeakPolarHBondContact O-CB 3.42Å; W56-L68 PolarHBondContact O-N 2.91Å; W56-I69 HydrophobicContact CB-CB 4.16Å; W56-I69 PolarHBondContact N-O 3.28Å; W56-I69 PolarHBondContact O-N 2.91Å; W56-F92 HydrophobicContact CZ2-CB 4.45Å; W56-L94 HydrophobicContact CB-CD1 4.33Å; W56-L94 HydrophobicContact CB-CD2 4.3Å; W56-L94 HydrophobicContact CD2-CB 3.56Å; W56-L94 HydrophobicContact CD2-CD2 4.07Å; W56-L94 HydrophobicContact CD2-CG 4.26Å; W56-L94 HydrophobicContact CE3-CB 3.79Å; W56-L94 HydrophobicContact CE3-CD2 3.84Å; W56-L94 HydrophobicContact CE3-CG 4.41Å; W56-L94 HydrophobicContact CG-CB 4.07Å; W56-L94 HydrophobicContact CG-CD1 4.16Å; W56-L94 HydrophobicContact CG-CD2 4.28Å; W56-L94 HydrophobicContact CG-CG 4.41Å; W56-L94 HydrophobicContact CH2-CB 4.01Å; W56-L94 HydrophobicContact CZ2-CB 3.82Å; W56-L94 HydrophobicContact CZ3-CB 4Å; W56-L94 HydrophobicContact CZ3-CD2 4.47Å; W56-H108 WeakPolarHBondContact CA-O 3.12Å; W56-C109 HydrophobicContact CD2-CB 4.19Å; W56-C109 HydrophobicContact CE3-CB 4Å; W56-C109 HydrophobicContact CH2-CB 4Å; W56-C109 HydrophobicContact CZ2-CB 4.15Å; W56-C109 HydrophobicContact CZ3-CB 3.9Å
57	Y	98.5	Very high	96.9	Very high	51 Å²	51	59.8 Å²	59.8	20%	0.2	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	146.3	-179.6	-58.9	-95.7	0	0	0	111.2	D55 P65 K66 L67 Y107 H108 Q110	D55-Y57 HydrophobicContact CB-CD2 4.4Å; D55-Y57 HydrophobicContact CB-CE2 3.5Å; D55-Y57 VanDerWaalsContact CB-CE2 3.5Å; D55-Y57 PolarHBondContact OD2-OH 3Å; Y57-P65 HydrophobicContact CD1-CB 4.23Å; Y57-P65 HydrophobicContact CG-CB 4.41Å; Y57-K66 CarbonylContact C-O 3.57Å; Y57-K66 VanDerWaalsContact CA-O 3.28Å; Y57-K66 WeakPolarHBondContact CA-O 3.33Å; Y57-L67 HydrophobicContact CD1-CB 4.18Å; Y57-L67 HydrophobicContact CD1-CD1 4.25Å; Y57-L67 HydrophobicContact CE1-CB 3.97Å; Y57-L67 HydrophobicContact CE1-CD1 3.74Å; Y57-L67 HydrophobicContact CE1-CG 4.45Å; Y57-L67 HydrophobicContact CE2-CD1 4.36Å; Y57-Y107 VanDerWaalsContact O-CA 3.29Å; Y57-Y107 WeakPolarHBondContact O-CA 3.43Å; Y57-H108 PolarHBondContact N-O 2.87Å; Y57-H108 PolarHBondContact O-N 2.87Å; Y57-Q110 HydrophobicContact CE2-CB 4.14Å; Y57-Q110 PolarHBondContact OH-OE1 3.38Å
58	L	98.5	Very high	97	Very high	16 Å²	16	57.2 Å²	57.2	8%	0.084	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.8	125.7	165.7	171.8	60.4	0	0	0	109.5	K66 L68 Y107	L58-K66 PolarHBondContact N-O 3.06Å; L58-K66 PolarHBondContact O-N 2.84Å; L58-L68 HydrophobicContact CB-CD1 3.78Å; L58-L68 HydrophobicContact CB-CD2 4.19Å; L58-L68 HydrophobicContact CB-CG 4.04Å; L58-Y107 HydrophobicContact CB-CD1 4.48Å; L58-Y107 HydrophobicContact CB-CE1 4.23Å; L58-Y107 HydrophobicContact CD1-CD1 4.42Å; L58-Y107 HydrophobicContact CD1-CD2 4.18Å; L58-Y107 HydrophobicContact CD1-CE1 4.05Å; L58-Y107 HydrophobicContact CD1-CE2 3.76Å; L58-Y107 HydrophobicContact CD1-CG 4.49Å
59	Q	98.3	Very high	97.2	Very high	66 Å²	66	52.6 Å²	52.6	31%	0.308	30%	0.302	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.3	117.2	173.4	-171.4	177.7	22	0	0	110.1	E63 P65 V106 H108	Q59-E63 WeakPolarHBondContact CG-O 3.28Å; Q59-E63 PolarHBondContact NE2-O 3.5Å; Q59-P65 HydrophobicContact CB-CG 4.37Å; Q59-P65 HydrophobicContact CG-CG 4.27Å; Q59-V106 PolarHBondContact N-O 2.79Å; Q59-V106 PolarHBondContact O-N 2.92Å; Q59-H108 PolarHBondContact OE1-NE2 2.96Å
60	K	97.4	Very high	97.5	Very high	62 Å²	62	50.8 Å²	50.8	27%	0.27	29%	0.291	S	S	.	.			trans	-87.6	153.9	171.5	-67.7	-172.9	175.2	-170.8	0	110.5	G62 E63 E102	K60-G62 PolarHBondContact O-N 3.44Å; K60-G62 VanDerWaalsContact O-N 3.17Å; K60-E63 HydrophobicContact CB-CB 4.14Å; K60-E63 HydrophobicContact CB-CG 4.1Å; K60-E63 PolarHBondContact O-N 3.05Å; K60-E102 WeakPolarHBondContact CE-O 3.3Å; K60-E102 PolarHBondContact NZ-O 3.17Å
61	P	96.8	Very high	97.6	Very high	123 Å²	123	56.7 Å²	56.7	80%	0.799	31%	0.313	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.2	122.6	176.9	-26.3	35	0	0	0	111.8	E63	P61-E63 VanDerWaalsContact C-N 3.27Å; P61-E63 PolarHBondContact O-N 3.31Å
62	G	96.9	Very high	97.7	Very high	94 Å²	94	53.7 Å²	53.7	97%	0.969	30%	0.298	S	S	*	.	T	Hydrogen-bonded Turn	trans	77.3	3.3	-179.8	0	0	0	0	0	115.7	K60	K60-G62 PolarHBondContact O-N 3.44Å; K60-G62 VanDerWaalsContact O-N 3.17Å
63	E	96.8	Very high	97.8	Very high	78 Å²	78	54.6 Å²	54.6	36%	0.364	31%	0.308	S	S	.	.	S	Bend	trans	-107.6	156.1	176.7	-63.2	-173.8	-159.5	0	0	111.8	Q59 K60 P61 K66	Q59-E63 WeakPolarHBondContact CG-O 3.28Å; Q59-E63 PolarHBondContact NE2-O 3.5Å; K60-E63 HydrophobicContact CB-CB 4.14Å; K60-E63 HydrophobicContact CB-CG 4.1Å; K60-E63 PolarHBondContact O-N 3.05Å; P61-E63 VanDerWaalsContact C-N 3.27Å; P61-E63 PolarHBondContact O-N 3.31Å; E63-K66 WeakPolarHBondContact OE2-CE 3.47Å; E63-K66 IonicContact OE2-NZ 3.35Å; E63-K66 PolarHBondContact OE2-NZ 3.18Å
64	A	96.6	Very high	98	Very high	74 Å²	74	55.3 Å²	55.3	61%	0.612	31%	0.313	S	S	*	.			trans	-68.5	150	167	0	0	0	0	0	110.6	K66	A64-K66 PolarHBondContact O-N 3.02Å
65	P	97.6	Very high	98	Very high	68 Å²	68	59.5 Å²	59.5	44%	0.442	33%	0.329	S	S	.	.			trans	-55.5	134.2	172.3	-24.2	34	0	0	0	112	Y57 Q59	Y57-P65 HydrophobicContact CD1-CB 4.23Å; Y57-P65 HydrophobicContact CG-CB 4.41Å; Q59-P65 HydrophobicContact CB-CG 4.37Å; Q59-P65 HydrophobicContact CG-CG 4.27Å
66	K	98.3	Very high	98	Very high	121 Å²	121	62.3 Å²	62.3	53%	0.526	34%	0.342	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.6	128.9	177.3	-71.1	172.7	176.2	164.1	0	109.9	Y57 L58 E63 A64 L68	Y57-K66 CarbonylContact C-O 3.57Å; Y57-K66 VanDerWaalsContact CA-O 3.28Å; Y57-K66 WeakPolarHBondContact CA-O 3.33Å; L58-K66 PolarHBondContact N-O 3.06Å; L58-K66 PolarHBondContact O-N 2.84Å; E63-K66 WeakPolarHBondContact OE2-CE 3.47Å; E63-K66 IonicContact OE2-NZ 3.35Å; E63-K66 PolarHBondContact OE2-NZ 3.18Å; A64-K66 PolarHBondContact O-N 3.02Å; K66-L68 PolarHBondContact O-N 3.39Å
67	L	98.6	Very high	98	Very high	43 Å²	43	67.5 Å²	67.5	23%	0.225	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.5	130.4	178.4	-177.5	65.2	0	0	0	111.1	D55 Y57 I69 Y70 Q76	D55-L67 HydrophobicContact CB-CD1 3.99Å; Y57-L67 HydrophobicContact CD1-CB 4.18Å; Y57-L67 HydrophobicContact CD1-CD1 4.25Å; Y57-L67 HydrophobicContact CE1-CB 3.97Å; Y57-L67 HydrophobicContact CE1-CD1 3.74Å; Y57-L67 HydrophobicContact CE1-CG 4.45Å; Y57-L67 HydrophobicContact CE2-CD1 4.36Å; L67-I69 WeakPolarHBondContact CD1-O 3.39Å; L67-Y70 HydrophobicContact CD2-CD1 4.38Å; L67-Q76 HydrophobicContact CB-CG 4.49Å; L67-Q76 HydrophobicContact CD2-CB 4.42Å; L67-Q76 HydrophobicContact CD2-CG 4.35Å; L67-Q76 HydrophobicContact CG-CB 4.27Å; L67-Q76 HydrophobicContact CG-CG 4.45Å
68	L	98.7	Very high	98	Very high	13 Å²	13	69.3 Å²	69.3	7%	0.068	41%	0.41	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.4	-57.1	176.7	-65	-178.4	0	0	0	111.9	W56 L58 K66 Q76 V79 F83 L94 Y107	W56-L68 HydrophobicContact CB-CB 4.49Å; W56-L68 WeakPolarHBondContact O-CB 3.42Å; W56-L68 PolarHBondContact O-N 2.91Å; L58-L68 HydrophobicContact CB-CD1 3.78Å; L58-L68 HydrophobicContact CB-CD2 4.19Å; L58-L68 HydrophobicContact CB-CG 4.04Å; K66-L68 PolarHBondContact O-N 3.39Å; L68-Q76 PolarHBondContact O-N 3.38Å; L68-V79 HydrophobicContact CD2-CG1 4.09Å; L68-V79 HydrophobicContact CD2-CG2 4.14Å; L68-F83 HydrophobicContact CD1-CD1 3.92Å; L68-F83 HydrophobicContact CD1-CE1 3.81Å; L68-L94 HydrophobicContact CD1-CD2 4.26Å; L68-Y107 HydrophobicContact CD1-CD1 3.97Å; L68-Y107 HydrophobicContact CD1-CE1 3.63Å
69	I	98.8	Very high	98	Very high	0 Å²	0	70 Å²	70	0%	0	41%	0.414	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.1	136.3	-178.1	-55.7	-63.7	0	0	0	107.1	D55 W56 L67 T72 N74 R75 F83 L94	D55-I69 CarbonylContact C-O 3.55Å; D55-I69 WeakPolarHBondContact CA-O 3.09Å; W56-I69 HydrophobicContact CB-CB 4.16Å; W56-I69 PolarHBondContact N-O 3.28Å; W56-I69 PolarHBondContact O-N 2.91Å; L67-I69 WeakPolarHBondContact CD1-O 3.39Å; I69-T72 WeakPolarHBondContact CG2-O 3.43Å; I69-N74 CarbonylContact C-O 3.59Å; I69-N74 WeakPolarHBondContact CA-O 3.28Å; I69-N74 WeakPolarHBondContact CG2-O 3.45Å; I69-R75 HydrophobicContact CD1-CB 4.02Å; I69-R75 HydrophobicContact CD1-CG 4.09Å; I69-F83 HydrophobicContact CD1-CB 4.37Å; I69-L94 HydrophobicContact CG1-CD1 3.78Å
70	Y	98.3	Very high	98	Very high	73 Å²	73	68.7 Å²	68.7	29%	0.286	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.2	161.3	169.8	66.4	-81.6	0	0	0	111	D55 L67 T72 S73 N74	D55-Y70 WeakPolarHBondContact OD1-CA 3.38Å; D55-Y70 VanDerWaalsContact OD1-CB 3.28Å; D55-Y70 WeakPolarHBondContact OD1-CB 3.23Å; L67-Y70 HydrophobicContact CD2-CD1 4.38Å; Y70-T72 VanDerWaalsContact C-N 3.26Å; Y70-T72 PolarHBondContact O-N 2.82Å; Y70-S73 PolarHBondContact O-N 2.95Å; Y70-N74 HydrophobicContact CD1-CB 3.91Å; Y70-N74 WeakPolarHBondContact CD1-O 3.22Å; Y70-N74 HydrophobicContact CD2-CB 3.88Å; Y70-N74 HydrophobicContact CE1-CB 3.58Å; Y70-N74 HydrophobicContact CE2-CB 3.55Å; Y70-N74 HydrophobicContact CG-CB 4.05Å; Y70-N74 PolarHBondContact N-O 3.2Å; Y70-N74 WeakPolarHBondContact O-CA 3.31Å; Y70-N74 VanDerWaalsContact O-CB 3.32Å; Y70-N74 WeakPolarHBondContact O-CB 3.03Å; Y70-N74 PolarHBondContact O-N 3.13Å
71	W	97.7	Very high	98	Very high	124 Å²	124	71.5 Å²	71.5	47%	0.47	43%	0.431	S	S	.	.	T	Hydrogen-bonded Turn	trans	50	47.8	179.1	-68.9	-11	0	0	0	112.7	N52 E53 D55 S73	N52-W71 CarbonylContact O-C 3.5Å; N52-W71 WeakPolarHBondContact O-CA 3.45Å; E53-W71 PolarHBondContact OE2-NE1 2.88Å; D55-W71 PolarHBondContact OD1-N 3.16Å; D55-W71 VanDerWaalsContact OD1-N 3.14Å; W71-S73 PolarHBondContact O-N 2.77Å
72	T	98	Very high	98.1	Very high	9 Å²	9	66.6 Å²	66.6	6%	0.055	40%	0.396	C	S	.	.	T	Hydrogen-bonded Turn	trans	65.9	-38.2	-177.4	-72.1	0	0	0	0	115.8	N52 V54 I69 Y70 G85 Q87 F92	N52-T72 WeakPolarHBondContact CA-OG1 3.35Å; N52-T72 PolarHBondContact O-N 2.84Å; N52-T72 VanDerWaalsContact O-N 3.08Å; N52-T72 PolarHBondContact O-OG1 3.24Å; V54-T72 PolarHBondContact O-N 2.89Å; I69-T72 WeakPolarHBondContact CG2-O 3.43Å; Y70-T72 VanDerWaalsContact C-N 3.26Å; Y70-T72 PolarHBondContact O-N 2.82Å; T72-G85 CarbonylContact O-C 3.45Å; T72-G85 WeakPolarHBondContact O-CA 3.45Å; T72-Q87 HydrophobicContact CG2-CB 3.48Å; T72-Q87 VanDerWaalsContact CG2-CB 3.48Å; T72-Q87 PolarHBondContact OG1-OE1 2.97Å; T72-F92 HydrophobicContact CG2-CD1 4.41Å; T72-F92 WeakPolarHBondContact OG1-CE1 3.37Å
73	S	98.3	Very high	98.2	Very high	71 Å²	71	62.4 Å²	62.4	50%	0.497	35%	0.352	S	S	.	.	T	Hydrogen-bonded Turn	trans	-141.9	-12.1	-165.7	63.6	0	0	0	0	115.1	Y70 W71 R75	Y70-S73 PolarHBondContact O-N 2.95Å; W71-S73 PolarHBondContact O-N 2.77Å; S73-R75 PolarHBondContact O-N 3.22Å
74	N	98.6	Very high	98.3	Very high	61 Å²	61	60.8 Å²	60.8	33%	0.326	35%	0.349	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.8	126.4	179	-66.5	-34.8	0	0	0	110.1	I69 Y70	I69-N74 CarbonylContact C-O 3.59Å; I69-N74 WeakPolarHBondContact CA-O 3.28Å; I69-N74 WeakPolarHBondContact CG2-O 3.45Å; Y70-N74 HydrophobicContact CD1-CB 3.91Å; Y70-N74 WeakPolarHBondContact CD1-O 3.22Å; Y70-N74 HydrophobicContact CD2-CB 3.88Å; Y70-N74 HydrophobicContact CE1-CB 3.58Å; Y70-N74 HydrophobicContact CE2-CB 3.55Å; Y70-N74 HydrophobicContact CG-CB 4.05Å; Y70-N74 PolarHBondContact N-O 3.2Å; Y70-N74 WeakPolarHBondContact O-CA 3.31Å; Y70-N74 VanDerWaalsContact O-CB 3.32Å; Y70-N74 WeakPolarHBondContact O-CB 3.03Å; Y70-N74 PolarHBondContact O-N 3.13Å
75	R	98.6	Very high	98.4	Very high	87 Å²	87	57.6 Å²	57.6	33%	0.328	32%	0.323	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87	131.4	-179.4	-171.2	-167.3	-42.7	-94.3	-9	110.4	I69 S73 V79 S80 D81 F83	I69-R75 HydrophobicContact CD1-CB 4.02Å; I69-R75 HydrophobicContact CD1-CG 4.09Å; S73-R75 PolarHBondContact O-N 3.22Å; R75-V79 WeakPolarHBondContact CD-O 3.35Å; R75-V79 HydrophobicContact CG-CB 3.82Å; R75-V79 HydrophobicContact CG-CG1 3.93Å; R75-S80 PolarHBondContact NH1-O 2.02Å; R75-D81 VanDerWaalsContact CZ-CA 3.48Å; R75-D81 PolarHBondContact NH1-O 3.01Å; R75-D81 PolarHBondContact NH2-O 3.22Å; R75-F83 PolarHBondContact NH1-O 2.79Å; R75-F83 PolarHBondContact NH2-O 3.4Å
76	Q	98.6	Very high	98.4	Very high	73 Å²	73	57.9 Å²	57.9	34%	0.341	32%	0.324	S	S	.	.	P	Polyproline II helix	trans	-62.5	137.7	174.8	-178.6	66.8	-18.4	0	0	110.5	L67 L68 G78 V79	L67-Q76 HydrophobicContact CB-CG 4.49Å; L67-Q76 HydrophobicContact CD2-CB 4.42Å; L67-Q76 HydrophobicContact CD2-CG 4.35Å; L67-Q76 HydrophobicContact CG-CB 4.27Å; L67-Q76 HydrophobicContact CG-CG 4.45Å; L68-Q76 PolarHBondContact O-N 3.38Å; Q76-G78 PolarHBondContact O-N 3.48Å; Q76-V79 HydrophobicContact CB-CG2 3.91Å; Q76-V79 VanDerWaalsContact O-CB 3.31Å; Q76-V79 WeakPolarHBondContact O-CB 3.4Å; Q76-V79 WeakPolarHBondContact O-CG2 3.33Å; Q76-V79 PolarHBondContact O-N 3.08Å; Q76-V79 VanDerWaalsContact O-N 3.08Å
77	P	98.3	Very high	98.4	Very high	110 Å²	110	55.3 Å²	55.3	71%	0.714	31%	0.314	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.7	135.1	177.7	-28.4	37.1	0	0	0	112.7	V79	P77-V79 VanDerWaalsContact C-N 3.31Å
78	G	97.9	Very high	98.4	Very high	90 Å²	90	57.6 Å²	57.6	93%	0.928	33%	0.333	S	S	*	.	T	Hydrogen-bonded Turn	trans	87.4	-10.8	-176.9	0	0	0	0	0	114.8	Q76	Q76-G78 PolarHBondContact O-N 3.48Å
79	V	98.6	Very high	98.3	Very high	29 Å²	29	59.3 Å²	59.3	18%	0.176	36%	0.355	C	S	.	.	S	Bend	trans	-76.5	134.3	171.3	176	0	0	0	0	109.6	L68 R75 Q76 P77 F83	L68-V79 HydrophobicContact CD2-CG1 4.09Å; L68-V79 HydrophobicContact CD2-CG2 4.14Å; R75-V79 WeakPolarHBondContact CD-O 3.35Å; R75-V79 HydrophobicContact CG-CB 3.82Å; R75-V79 HydrophobicContact CG-CG1 3.93Å; Q76-V79 HydrophobicContact CB-CG2 3.91Å; Q76-V79 VanDerWaalsContact O-CB 3.31Å; Q76-V79 WeakPolarHBondContact O-CB 3.4Å; Q76-V79 WeakPolarHBondContact O-CG2 3.33Å; Q76-V79 PolarHBondContact O-N 3.08Å; Q76-V79 VanDerWaalsContact O-N 3.08Å; P77-V79 VanDerWaalsContact C-N 3.31Å; V79-F83 HydrophobicContact CG1-CB 4.14Å; V79-F83 HydrophobicContact CG1-CD2 3.81Å; V79-F83 HydrophobicContact CG1-CG 4.05Å
80	S	98.5	Very high	98.2	Very high	40 Å²	40	61.1 Å²	61.1	28%	0.28	37%	0.366	S	S	.	.			trans	-55.7	144.4	-179.3	179.7	0	0	0	0	112.1	R75 R82 F83	R75-S80 PolarHBondContact NH1-O 2.02Å; S80-R82 PolarHBondContact O-N 2.95Å; S80-R82 WeakPolarHBondContact OG-CG 3.24Å; S80-R82 PolarHBondContact OG-NH1 3.41Å; S80-F83 PolarHBondContact O-N 3.5Å
81	D	98.3	Very high	98.2	Very high	120 Å²	120	60.6 Å²	60.6	64%	0.642	37%	0.368	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.7	-15.1	178.9	71.9	-14	0	0	0	113.9	R75 F83	R75-D81 VanDerWaalsContact CZ-CA 3.48Å; R75-D81 PolarHBondContact NH1-O 3.01Å; R75-D81 PolarHBondContact NH2-O 3.22Å; D81-F83 VanDerWaalsContact C-N 3.29Å; D81-F83 PolarHBondContact O-N 2.83Å
82	R	98.6	Very high	98.3	Very high	20 Å²	20	54.8 Å²	54.8	8%	0.075	35%	0.346	C	S	.	.	T	Hydrogen-bonded Turn	trans	-67.9	-25.4	-179.5	-56.3	-169.7	-49.1	-101.8	6.4	114.5	S80 I96 S97 R98 Q100 D103	S80-R82 PolarHBondContact O-N 2.95Å; S80-R82 WeakPolarHBondContact OG-CG 3.24Å; S80-R82 PolarHBondContact OG-NH1 3.41Å; R82-I96 WeakPolarHBondContact O-CA 3.35Å; R82-S97 VanDerWaalsContact CA-OG 3.31Å; R82-S97 WeakPolarHBondContact CA-OG 3.39Å; R82-S97 PolarHBondContact O-N 2.77Å; R82-S97 PolarHBondContact O-OG 3.3Å; R82-S97 VanDerWaalsContact O-OG 3.09Å; R82-R98 WeakPolarHBondContact CD-O 3.14Å; R82-R98 PolarHBondContact NE-O 3.04Å; R82-Q100 VanDerWaalsContact NH1-NE2 3.14Å; R82-Q100 VanDerWaalsContact NH2-CG 3.32Å; R82-D103 IonicContact NH2-OD1 2.83Å; R82-D103 PolarHBondContact NH2-OD1 3.43Å; R82-D103 IonicContact NH2-OD2 3.05Å; R82-D103 PolarHBondContact NH2-OD2 2.78Å
83	F	98.8	Very high	98.3	Very high	7 Å²	7	56 Å²	56	3%	0.031	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77	154	176.1	-67	-94.2	0	0	0	110.4	L68 I69 R75 V79 S80 D81 L94 T95 I96 D103 Y107	L68-F83 HydrophobicContact CD1-CD1 3.92Å; L68-F83 HydrophobicContact CD1-CE1 3.81Å; I69-F83 HydrophobicContact CD1-CB 4.37Å; R75-F83 PolarHBondContact NH1-O 2.79Å; R75-F83 PolarHBondContact NH2-O 3.4Å; V79-F83 HydrophobicContact CG1-CB 4.14Å; V79-F83 HydrophobicContact CG1-CD2 3.81Å; V79-F83 HydrophobicContact CG1-CG 4.05Å; S80-F83 PolarHBondContact O-N 3.5Å; D81-F83 VanDerWaalsContact C-N 3.29Å; D81-F83 PolarHBondContact O-N 2.83Å; F83-L94 HydrophobicContact CD1-CD1 4.37Å; F83-T95 CarbonylContact C-O 3.19Å; F83-T95 VanDerWaalsContact CA-O 3.28Å; F83-T95 WeakPolarHBondContact CA-O 3.41Å; F83-I96 HydrophobicContact CD1-CD1 4.2Å; F83-I96 HydrophobicContact CD1-CG1 3.78Å; F83-I96 HydrophobicContact CE1-CD1 3.54Å; F83-I96 HydrophobicContact CE1-CG1 3.64Å; F83-I96 HydrophobicContact CE1-CG2 4.27Å; F83-I96 HydrophobicContact CZ-CD1 4.2Å; F83-I96 HydrophobicContact CZ-CG1 4.43Å; F83-I96 HydrophobicContact CZ-CG2 4.28Å; F83-D103 WeakPolarHBondContact CZ-OD1 3.36Å; F83-Y107 HydrophobicContact CE1-CE1 4.11Å
84	S	98.8	Very high	98.3	Very high	43 Å²	43	52.6 Å²	52.6	30%	0.301	33%	0.33	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-165.6	141.3	170.5	55.3	0	0	0	0	109.2	L94 T95	S84-L94 CarbonylContact O-C 3.57Å; S84-T95 PolarHBondContact N-O 3.16Å; S84-T95 PolarHBondContact O-N 2.8Å
85	G	98.6	Very high	98.3	Very high	8 Å²	8	50.3 Å²	50.3	8%	0.082	32%	0.317	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	147.4	172.5	0	0	0	0	0	112.1	T72 T93	T72-G85 CarbonylContact O-C 3.45Å; T72-G85 WeakPolarHBondContact O-CA 3.45Å; G85-T93 CarbonylContact C-O 3.57Å; G85-T93 VanDerWaalsContact CA-O 3.3Å; G85-T93 WeakPolarHBondContact CA-O 3.04Å
86	T	98.5	Very high	98.4	Very high	74 Å²	74	46.3 Å²	46.3	45%	0.454	30%	0.303	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.8	159.8	175.4	58.4	0	0	0	0	110.4	F92 T93	T86-F92 CarbonylContact O-C 3.56Å; T86-F92 WeakPolarHBondContact O-CA 3.32Å; T86-T93 PolarHBondContact N-O 3.22Å; T86-T93 PolarHBondContact O-N 2.83Å
87	Q	98.3	Very high	98.4	Very high	66 Å²	66	45 Å²	45	31%	0.308	30%	0.302	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.7	144.8	178.6	174	-177.2	-0.5	0	0	111.4	D51 T72 G89 D91 F92	D51-Q87 PolarHBondContact O-NE2 3.35Å; D51-Q87 PolarHBondContact O-OE1 3.11Å; T72-Q87 HydrophobicContact CG2-CB 3.48Å; T72-Q87 VanDerWaalsContact CG2-CB 3.48Å; T72-Q87 PolarHBondContact OG1-OE1 2.97Å; Q87-G89 PolarHBondContact NE2-O 3.34Å; Q87-D91 CarbonylContact C-O 3.57Å; Q87-D91 WeakPolarHBondContact CA-O 3.08Å; Q87-F92 HydrophobicContact CB-CD1 3.88Å; Q87-F92 HydrophobicContact CB-CE1 4Å; Q87-F92 HydrophobicContact CG-CD1 3.87Å; Q87-F92 HydrophobicContact CG-CE1 3.56Å; Q87-F92 HydrophobicContact CG-CZ 4.03Å
88	S	97.6	Very high	98.4	Very high	91 Å²	91	46.6 Å²	46.6	64%	0.636	29%	0.293	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-139.9	102.6	168.5	173.9	0	0	0	0	108.9	T90 D91	S88-T90 PolarHBondContact O-N 2.95Å; S88-D91 PolarHBondContact N-O 3.23Å; S88-D91 WeakPolarHBondContact O-CB 3.22Å; S88-D91 PolarHBondContact O-N 3.42Å
89	G	96.5	Very high	98.4	Very high	50 Å²	50	43.2 Å²	43.2	52%	0.515	26%	0.255	S	S	.	.	T	Hydrogen-bonded Turn	trans	64.6	-117.1	-175.2	0	0	0	0	0	111.2	Q87	Q87-G89 PolarHBondContact NE2-O 3.34Å
90	T	97.6	Very high	98.4	Very high	38 Å²	38	45.1 Å²	45.1	23%	0.233	26%	0.262	C	S	.	.	T	Hydrogen-bonded Turn	trans	-99	4.6	175.9	67.4	0	0	0	0	113.2	K45 A46 E48 S88 F92	K45-T90 WeakPolarHBondContact CA-O 3.29Å; A46-T90 PolarHBondContact N-O 2.95Å; A46-T90 WeakPolarHBondContact O-CB 3.42Å; A46-T90 PolarHBondContact O-OG1 2.8Å; E48-T90 WeakPolarHBondContact O-CG2 3.42Å; S88-T90 PolarHBondContact O-N 2.95Å; T90-F92 WeakPolarHBondContact O-CD2 3.33Å; T90-F92 WeakPolarHBondContact O-CE2 3.23Å
91	D	98.4	Very high	98.3	Very high	62 Å²	62	47.1 Å²	47.1	33%	0.332	28%	0.28	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.7	120.2	178.6	-62.5	-77.4	0	0	0	109.9	K45 Q87 S88	K45-D91 WeakPolarHBondContact CG-OD1 3.06Å; K45-D91 VanDerWaalsContact NZ-CG 3.35Å; K45-D91 IonicContact NZ-OD1 3.04Å; K45-D91 PolarHBondContact NZ-OD1 3.14Å; K45-D91 IonicContact NZ-OD2 2.67Å; K45-D91 PolarHBondContact NZ-OD2 2.77Å; Q87-D91 CarbonylContact C-O 3.57Å; Q87-D91 WeakPolarHBondContact CA-O 3.08Å; S88-D91 PolarHBondContact N-O 3.23Å; S88-D91 WeakPolarHBondContact O-CB 3.22Å; S88-D91 PolarHBondContact O-N 3.42Å
92	F	98.7	Very high	98.2	Very high	2 Å²	2	46.1 Å²	46.1	1%	0.009	27%	0.272	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.2	144.8	179.8	-57.8	-96.6	0	0	0	109.1	Q43 C44 A46 V50 V54 W56 T72 T86 Q87 T90	Q43-F92 CarbonylContact C-O 3.55Å; Q43-F92 WeakPolarHBondContact CA-O 2.97Å; C44-F92 HydrophobicContact CB-CB 4.33Å; C44-F92 PolarHBondContact N-O 2.85Å; C44-F92 PolarHBondContact O-N 2.9Å; A46-F92 HydrophobicContact CB-CE2 4.13Å; V50-F92 HydrophobicContact CG2-CE2 3.74Å; V50-F92 HydrophobicContact CG2-CZ 3.48Å; V50-F92 VanDerWaalsContact CG2-CZ 3.48Å; V54-F92 HydrophobicContact CB-CD1 3.7Å; V54-F92 HydrophobicContact CB-CE1 3.78Å; V54-F92 HydrophobicContact CB-CG 4.13Å; V54-F92 HydrophobicContact CB-CZ 4.31Å; V54-F92 HydrophobicContact CG1-CB 4.33Å; V54-F92 HydrophobicContact CG1-CD1 4.09Å; V54-F92 HydrophobicContact CG1-CG 4.08Å; V54-F92 HydrophobicContact CG2-CD1 3.75Å; V54-F92 HydrophobicContact CG2-CD2 3.96Å; V54-F92 HydrophobicContact CG2-CE1 3.46Å; V54-F92 VanDerWaalsContact CG2-CE1 3.46Å; V54-F92 HydrophobicContact CG2-CE2 3.72Å; V54-F92 HydrophobicContact CG2-CG 3.99Å; V54-F92 HydrophobicContact CG2-CZ 3.48Å; V54-F92 VanDerWaalsContact CG2-CZ 3.48Å; W56-F92 HydrophobicContact CZ2-CB 4.45Å; T72-F92 HydrophobicContact CG2-CD1 4.41Å; T72-F92 WeakPolarHBondContact OG1-CE1 3.37Å; T86-F92 CarbonylContact O-C 3.56Å; T86-F92 WeakPolarHBondContact O-CA 3.32Å; Q87-F92 HydrophobicContact CB-CD1 3.88Å; Q87-F92 HydrophobicContact CB-CE1 4Å; Q87-F92 HydrophobicContact CG-CD1 3.87Å; Q87-F92 HydrophobicContact CG-CE1 3.56Å; Q87-F92 HydrophobicContact CG-CZ 4.03Å; T90-F92 WeakPolarHBondContact O-CD2 3.33Å; T90-F92 WeakPolarHBondContact O-CE2 3.23Å
93	T	98.8	Very high	98.2	Very high	33 Å²	33	45.8 Å²	45.8	20%	0.202	27%	0.272	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136	123.1	-178.9	-60.5	0	0	0	0	110.7	I42 G85 T86	I42-T93 CarbonylContact O-C 3.57Å; I42-T93 WeakPolarHBondContact O-CA 3.36Å; G85-T93 CarbonylContact C-O 3.57Å; G85-T93 VanDerWaalsContact CA-O 3.3Å; G85-T93 WeakPolarHBondContact CA-O 3.04Å; T86-T93 PolarHBondContact N-O 3.22Å; T86-T93 PolarHBondContact O-N 2.83Å
94	L	98.8	Very high	98.1	Very high	1 Å²	1	48.8 Å²	48.8	1%	0.005	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.6	130.6	162.2	-179.2	66.9	0	0	0	108.8	S41 I42 W56 L68 I69 F83 S84 Y107	S41-L94 CarbonylContact C-O 3.57Å; S41-L94 VanDerWaalsContact CA-O 3.24Å; S41-L94 WeakPolarHBondContact CA-O 3.35Å; I42-L94 HydrophobicContact CB-CB 4.47Å; I42-L94 HydrophobicContact CD1-CD2 4.47Å; I42-L94 PolarHBondContact N-O 2.83Å; I42-L94 PolarHBondContact O-N 3.05Å; W56-L94 HydrophobicContact CB-CD1 4.33Å; W56-L94 HydrophobicContact CB-CD2 4.3Å; W56-L94 HydrophobicContact CD2-CB 3.56Å; W56-L94 HydrophobicContact CD2-CD2 4.07Å; W56-L94 HydrophobicContact CD2-CG 4.26Å; W56-L94 HydrophobicContact CE3-CB 3.79Å; W56-L94 HydrophobicContact CE3-CD2 3.84Å; W56-L94 HydrophobicContact CE3-CG 4.41Å; W56-L94 HydrophobicContact CG-CB 4.07Å; W56-L94 HydrophobicContact CG-CD1 4.16Å; W56-L94 HydrophobicContact CG-CD2 4.28Å; W56-L94 HydrophobicContact CG-CG 4.41Å; W56-L94 HydrophobicContact CH2-CB 4.01Å; W56-L94 HydrophobicContact CZ2-CB 3.82Å; W56-L94 HydrophobicContact CZ3-CB 4Å; W56-L94 HydrophobicContact CZ3-CD2 4.47Å; L68-L94 HydrophobicContact CD1-CD2 4.26Å; I69-L94 HydrophobicContact CG1-CD1 3.78Å; F83-L94 HydrophobicContact CD1-CD1 4.37Å; S84-L94 CarbonylContact O-C 3.57Å; L94-Y107 HydrophobicContact CD2-CD1 3.52Å; L94-Y107 HydrophobicContact CD2-CE1 3.87Å; L94-Y107 HydrophobicContact CD2-CG 4.5Å
95	T	98.8	Very high	98.1	Very high	12 Å²	12	48.5 Å²	48.5	7%	0.074	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.1	136.3	173.9	-65	0	0	0	0	110	R39 V40 S41 F83 S84	R39-T95 HydrophobicContact CG-CG2 4.15Å; V40-T95 WeakPolarHBondContact O-CA 3.4Å; S41-T95 PolarHBondContact OG-OG1 3.14Å; S41-T95 VanDerWaalsContact OG-OG1 3.13Å; F83-T95 CarbonylContact C-O 3.19Å; F83-T95 VanDerWaalsContact CA-O 3.28Å; F83-T95 WeakPolarHBondContact CA-O 3.41Å; S84-T95 PolarHBondContact N-O 3.16Å; S84-T95 PolarHBondContact O-N 2.8Å
96	I	98.8	Very high	98.1	Very high	4 Å²	4	52 Å²	52	2%	0.021	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.8	110.7	168.7	-43.9	176	0	0	0	106.4	R39 V40 R82 F83 V99 Y107	R39-I96 WeakPolarHBondContact CA-O 3.46Å; V40-I96 HydrophobicContact CG1-CB 3.75Å; V40-I96 HydrophobicContact CG1-CD1 3.92Å; V40-I96 HydrophobicContact CG1-CG1 3.94Å; V40-I96 PolarHBondContact N-O 3.02Å; V40-I96 PolarHBondContact O-N 3.35Å; R82-I96 WeakPolarHBondContact O-CA 3.35Å; F83-I96 HydrophobicContact CD1-CD1 4.2Å; F83-I96 HydrophobicContact CD1-CG1 3.78Å; F83-I96 HydrophobicContact CE1-CD1 3.54Å; F83-I96 HydrophobicContact CE1-CG1 3.64Å; F83-I96 HydrophobicContact CE1-CG2 4.27Å; F83-I96 HydrophobicContact CZ-CD1 4.2Å; F83-I96 HydrophobicContact CZ-CG1 4.43Å; F83-I96 HydrophobicContact CZ-CG2 4.28Å; I96-V99 HydrophobicContact CB-CG2 4.18Å; I96-V99 HydrophobicContact CG2-CG2 4.1Å; I96-Y107 HydrophobicContact CD1-CE1 4.04Å; I96-Y107 WeakPolarHBondContact CD1-OH 3.5Å
97	S	98.6	Very high	98.1	Very high	45 Å²	45	49.8 Å²	49.8	32%	0.315	30%	0.304	S	S	.	.	S	Bend	trans	-70.6	-33.5	-171.4	55	0	0	0	0	114	R82	R82-S97 VanDerWaalsContact CA-OG 3.31Å; R82-S97 WeakPolarHBondContact CA-OG 3.39Å; R82-S97 PolarHBondContact O-N 2.77Å; R82-S97 PolarHBondContact O-OG 3.3Å; R82-S97 VanDerWaalsContact O-OG 3.09Å
98	R	98.4	Very high	98	Very high	144 Å²	144	49.8 Å²	49.8	54%	0.543	31%	0.305	S	S	.	.	S	Bend	trans	-142.7	100	174.2	-59.1	174.2	-72.8	153.7	-2.1	108.6	R82	R82-R98 WeakPolarHBondContact CD-O 3.14Å; R82-R98 PolarHBondContact NE-O 3.04Å
99	V	98.4	Very high	98	Very high	19 Å²	19	45.9 Å²	45.9	12%	0.115	28%	0.277	C	S	.	.			trans	-62.5	142.1	179.8	172.5	0	0	0	0	110.7	V34 P36 G37 Q38 V40 I96 D103	V34-V99 HydrophobicContact CG1-CB 4.41Å; V34-V99 HydrophobicContact CG1-CG2 4.12Å; P36-V99 CarbonylContact C-O 3.02Å; P36-V99 WeakPolarHBondContact CA-O 3.49Å; G37-V99 PolarHBondContact N-O 3.19Å; Q38-V99 WeakPolarHBondContact O-CG2 3.42Å; Q38-V99 PolarHBondContact O-N 3.43Å; V40-V99 HydrophobicContact CB-CG2 4.26Å; V40-V99 HydrophobicContact CG1-CG2 3.45Å; V40-V99 VanDerWaalsContact CG1-CG2 3.45Å; I96-V99 HydrophobicContact CB-CG2 4.18Å; I96-V99 HydrophobicContact CG2-CG2 4.1Å; V99-D103 HydrophobicContact CG1-CB 4.4Å
100	Q	98.4	Very high	98	Very high	69 Å²	69	45.2 Å²	45.2	32%	0.322	26%	0.26	S	S	.	.			trans	-124	167.5	171.3	-61.3	-175.2	-29.2	0	0	110.8	R82 E102 D103	R82-Q100 VanDerWaalsContact NH1-NE2 3.14Å; R82-Q100 VanDerWaalsContact NH2-CG 3.32Å; Q100-E102 HydrophobicContact CB-CG 4.33Å; Q100-E102 WeakPolarHBondContact CB-OE2 3.47Å; Q100-E102 PolarHBondContact O-N 3.02Å; Q100-E102 PolarHBondContact OE1-OE1 3.41Å; Q100-D103 PolarHBondContact N-OD2 3.4Å; Q100-D103 VanDerWaalsContact O-CB 3.32Å; Q100-D103 WeakPolarHBondContact O-CB 3.5Å; Q100-D103 PolarHBondContact O-N 3.46Å
101	A	96.8	Very high	97.9	Very high	81 Å²	81	43.4 Å²	43.4	67%	0.669	25%	0.249	S	C	*	.	G	3₁₀ helix	trans	-62.5	-33.3	-175.7	0	0	0	0	0	112.3	D103 A104	A101-D103 PolarHBondContact O-N 2.91Å; A101-A104 WeakPolarHBondContact O-CB 3.32Å; A101-A104 PolarHBondContact O-N 3.08Å
102	E	96.8	Very high	97.7	Very high	100 Å²	100	43.1 Å²	43.1	47%	0.467	25%	0.248	S	C	.	.	G	3₁₀ helix	trans	-70.6	-12.1	176.7	64.1	-97	-132.2	0	0	114.5	K60 Q100 A104	K60-E102 WeakPolarHBondContact CE-O 3.3Å; K60-E102 PolarHBondContact NZ-O 3.17Å; Q100-E102 HydrophobicContact CB-CG 4.33Å; Q100-E102 WeakPolarHBondContact CB-OE2 3.47Å; Q100-E102 PolarHBondContact O-N 3.02Å; Q100-E102 PolarHBondContact OE1-OE1 3.41Å; E102-A104 PolarHBondContact O-N 3.49Å
103	D	97.8	Very high	97.3	Very high	13 Å²	13	49.3 Å²	49.3	7%	0.07	27%	0.271	C	S	.	.	G	3₁₀ helix	trans	-82.3	-2.5	178.7	-58.3	-29.4	0	0	0	111.3	R82 F83 V99 Q100 A101 G105 Y107	R82-D103 IonicContact NH2-OD1 2.83Å; R82-D103 PolarHBondContact NH2-OD1 3.43Å; R82-D103 IonicContact NH2-OD2 3.05Å; R82-D103 PolarHBondContact NH2-OD2 2.78Å; F83-D103 WeakPolarHBondContact CZ-OD1 3.36Å; V99-D103 HydrophobicContact CG1-CB 4.4Å; Q100-D103 PolarHBondContact N-OD2 3.4Å; Q100-D103 VanDerWaalsContact O-CB 3.32Å; Q100-D103 WeakPolarHBondContact O-CB 3.5Å; Q100-D103 PolarHBondContact O-N 3.46Å; A101-D103 PolarHBondContact O-N 2.91Å; D103-G105 PolarHBondContact O-N 3.44Å; D103-Y107 WeakPolarHBondContact O-CE2 3.48Å; D103-Y107 PolarHBondContact O-OH 3.12Å
104	A	97.8	Very high	96.8	Very high	70 Å²	70	48.8 Å²	48.8	58%	0.579	27%	0.269	S	S	*	.			trans	-68.2	125	175	0	0	0	0	0	111.6	A101 E102	A101-A104 WeakPolarHBondContact O-CB 3.32Å; A101-A104 PolarHBondContact O-N 3.08Å; E102-A104 PolarHBondContact O-N 3.49Å
105	G	97.4	Very high	96	Very high	37 Å²	37	56.4 Å²	56.4	38%	0.381	30%	0.303	S	S	.	.	S	Bend	trans	167.4	-171.9	177.4	0	0	0	0	0	112.1	D103	D103-G105 PolarHBondContact O-N 3.44Å
106	V	98.2	Very high	95	Very high	81 Å²	81	58.5 Å²	58.5	49%	0.491	32%	0.316	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.1	130.9	175.5	-173.8	0	0	0	0	108.5	Q59 H108	Q59-V106 PolarHBondContact N-O 2.79Å; Q59-V106 PolarHBondContact O-N 2.92Å; V106-H108 VanDerWaalsContact CG1-CE1 3.43Å; V106-H108 WeakPolarHBondContact CG1-CE1 3.28Å
107	Y	98.3	Very high	94	Very high	27 Å²	27	62.6 Å²	62.6	11%	0.106	33%	0.334	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.5	132.1	178.3	-70.6	-98.2	0	0	0	109.8	Q27 I42 Y57 L58 L68 F83 L94 I96 D103	Q27-Y107 PolarHBondContact NE2-O 2.92Å; I42-Y107 HydrophobicContact CD1-CD1 3.99Å; I42-Y107 HydrophobicContact CD1-CD2 3.68Å; I42-Y107 HydrophobicContact CD1-CE2 4.35Å; I42-Y107 HydrophobicContact CD1-CG 3.48Å; I42-Y107 VanDerWaalsContact CD1-CG 3.48Å; Y57-Y107 VanDerWaalsContact O-CA 3.29Å; Y57-Y107 WeakPolarHBondContact O-CA 3.43Å; L58-Y107 HydrophobicContact CB-CD1 4.48Å; L58-Y107 HydrophobicContact CB-CE1 4.23Å; L58-Y107 HydrophobicContact CD1-CD1 4.42Å; L58-Y107 HydrophobicContact CD1-CD2 4.18Å; L58-Y107 HydrophobicContact CD1-CE1 4.05Å; L58-Y107 HydrophobicContact CD1-CE2 3.76Å; L58-Y107 HydrophobicContact CD1-CG 4.49Å; L68-Y107 HydrophobicContact CD1-CD1 3.97Å; L68-Y107 HydrophobicContact CD1-CE1 3.63Å; F83-Y107 HydrophobicContact CE1-CE1 4.11Å; L94-Y107 HydrophobicContact CD2-CD1 3.52Å; L94-Y107 HydrophobicContact CD2-CE1 3.87Å; L94-Y107 HydrophobicContact CD2-CG 4.5Å; I96-Y107 HydrophobicContact CD1-CE1 4.04Å; I96-Y107 WeakPolarHBondContact CD1-OH 3.5Å; D103-Y107 WeakPolarHBondContact O-CE2 3.48Å; D103-Y107 PolarHBondContact O-OH 3.12Å
108	H	97.8	Very high	92.7	Very high	67 Å²	67	62.5 Å²	62.5	31%	0.31	33%	0.331	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.8	136.6	179.5	-58.4	-71.9	0	0	0	109.9	W56 Y57 Q59 V106	W56-H108 WeakPolarHBondContact CA-O 3.12Å; Y57-H108 PolarHBondContact N-O 2.87Å; Y57-H108 PolarHBondContact O-N 2.87Å; Q59-H108 PolarHBondContact OE1-NE2 2.96Å; V106-H108 VanDerWaalsContact CG1-CE1 3.43Å; V106-H108 WeakPolarHBondContact CG1-CE1 3.28Å
109	C	97.6	Very high	90.6	Very high	8 Å²	8	67.3 Å²	67.3	5%	0.054	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.4	145.2	163.2	62.7	0	0	0	0	109.9	M25 Q27 C44 V54 D55 W56	M25-C109 HydrophobicContact CE-CB 4.34Å; Q27-C109 VanDerWaalsContact CD-SG 3.54Å; Q27-C109 WeakPolarHBondContact CG-SG 3.3Å; Q27-C109 PolarHBondContact OE1-SG 3.46Å; C44-C109 HydrophobicContact CB-CB 3.51Å; C44-C109 WeakPolarHBondContact CB-SG 3.37Å; C44-C109 WeakPolarHBondContact SG-CB 3.42Å; C44-C109 CovalentContact SG-SG 2.02Å; C44-C109 PolarHBondContact SG-SG 3.39Å; V54-C109 HydrophobicContact CG1-CB 4.28Å; D55-C109 VanDerWaalsContact O-CA 3.28Å; D55-C109 WeakPolarHBondContact O-CA 3.31Å; W56-C109 HydrophobicContact CD2-CB 4.19Å; W56-C109 HydrophobicContact CE3-CB 4Å; W56-C109 HydrophobicContact CH2-CB 4Å; W56-C109 HydrophobicContact CZ2-CB 4.15Å; W56-C109 HydrophobicContact CZ3-CB 3.9Å
110	Q	96.6	Very high	90.2	Very high	36 Å²	36	69.7 Å²	69.7	17%	0.168	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.9	139.5	178.9	168.9	-98.2	-49.5	0	0	109.5	V54 D55 Y57 T118	V54-Q110 VanDerWaalsContact CA-O 3.31Å; V54-Q110 WeakPolarHBondContact CA-O 3.42Å; D55-Q110 PolarHBondContact N-O 2.98Å; D55-Q110 PolarHBondContact O-N 2.96Å; Y57-Q110 HydrophobicContact CE2-CB 4.14Å; Y57-Q110 PolarHBondContact OH-OE1 3.38Å; Q110-T118 WeakPolarHBondContact CA-OG1 3.16Å; Q110-T118 WeakPolarHBondContact CG-OG1 3.44Å
111	Q	95.5	Very high	89.8	Confident	0 Å²	0	69.7 Å²	69.7	0%	0	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.5	137.8	171.7	66.8	80.2	31.3	0	0	110.5	I23 M25 V50 E53 V54 S114 P116	I23-Q111 HydrophobicContact CB-CG 4.27Å; I23-Q111 HydrophobicContact CG2-CG 4.12Å; M25-Q111 HydrophobicContact CE-CB 4.02Å; M25-Q111 HydrophobicContact CG-CG 4.26Å; M25-Q111 HydrophobicContact SD-CB 4.12Å; M25-Q111 HydrophobicContact SD-CG 4.19Å; V50-Q111 HydrophobicContact CB-CB 4.26Å; V50-Q111 HydrophobicContact CG1-CB 4.02Å; V50-Q111 HydrophobicContact CG1-CG 4.26Å; V50-Q111 HydrophobicContact CG2-CB 4.38Å; E53-Q111 VanDerWaalsContact O-CA 3.23Å; E53-Q111 WeakPolarHBondContact O-CA 3.3Å; V54-Q111 HydrophobicContact CG2-CB 4.39Å; Q111-S114 PolarHBondContact NE2-O 3.49Å; Q111-S114 VanDerWaalsContact NE2-O 3.08Å; Q111-S114 PolarHBondContact OE1-O 3.2Å; Q111-S114 PolarHBondContact OE1-OG 2.94Å; Q111-P116 PolarHBondContact NE2-O 2.76Å
112	D	92.4	Very high	89.4	Confident	57 Å²	57	69.1 Å²	69.1	31%	0.305	36%	0.359	S	S	.	.			trans	-117.3	8.2	171.4	56.8	-24.6	0	0	0	113.8	E53 S114 F117	E53-D112 VanDerWaalsContact CB-OD1 3.28Å; E53-D112 WeakPolarHBondContact CB-OD1 3.38Å; E53-D112 PolarHBondContact O-N 3Å; D112-S114 VanDerWaalsContact C-N 3.26Å; D112-S114 PolarHBondContact O-N 3.35Å; D112-F117 HydrophobicContact CB-CD1 4.19Å; D112-F117 HydrophobicContact CB-CE1 3.77Å; D112-F117 HydrophobicContact CB-CZ 4.41Å
113	W	92.1	Very high	89	Confident	131 Å²	131	67.3 Å²	67.3	50%	0.496	35%	0.352	S	S	.	.	S	Bend	trans	-57.3	-37.9	174	179.3	-109.3	0	0	0	113.2	V50 D51 E53	V50-W113 HydrophobicContact CB-CB 3.73Å; V50-W113 HydrophobicContact CB-CG 4.18Å; V50-W113 HydrophobicContact CG1-CB 4.07Å; V50-W113 HydrophobicContact CG1-CG 4.48Å; D51-W113 HydrophobicContact CB-CD2 4.45Å; D51-W113 HydrophobicContact CB-CE3 3.78Å; D51-W113 HydrophobicContact CB-CH2 4.32Å; D51-W113 HydrophobicContact CB-CZ3 3.7Å; E53-W113 HydrophobicContact CB-CB 3.96Å; E53-W113 HydrophobicContact CG-CB 4.35Å; E53-W113 HydrophobicContact CG-CE3 3.78Å
114	S	87.3	Confident	88.4	Confident	23 Å²	23	70.7 Å²	70.7	16%	0.161	37%	0.37	C	S	.	.	S	Bend	trans	-144	157.2	-173.7	70.6	0	0	0	0	113.2	I23 Q111 D112 P116	I23-S114 WeakPolarHBondContact CD1-OG 3.41Å; Q111-S114 PolarHBondContact NE2-O 3.49Å; Q111-S114 VanDerWaalsContact NE2-O 3.08Å; Q111-S114 PolarHBondContact OE1-O 3.2Å; Q111-S114 PolarHBondContact OE1-OG 2.94Å; D112-S114 VanDerWaalsContact C-N 3.26Å; D112-S114 PolarHBondContact O-N 3.35Å; S114-P116 CarbonylContact O-C 3.56Å
115	F	82.7	Confident	87.8	Confident	161 Å²	161	70.7 Å²	70.7	71%	0.706	36%	0.356	S	S	*	.	S	Bend	trans	-96.3	146.4	173.2	-68.7	-82	0	0	0	111.5	F117	F115-F117 HydrophobicContact CD1-CD1 4.31Å; F115-F117 HydrophobicContact CD1-CD2 4.41Å; F115-F117 AromaticContact CD1-CE1 3.98Å; F115-F117 HydrophobicContact CD1-CE1 3.98Å; F115-F117 HydrophobicContact CD1-CE2 4.11Å; F115-F117 AromaticContact CD1-CZ 3.9Å; F115-F117 HydrophobicContact CD1-CZ 3.9Å; F115-F117 HydrophobicContact CE1-CD1 4.37Å; F115-F117 HydrophobicContact CE1-CD2 4.13Å; F115-F117 AromaticContact CE1-CE1 3.69Å; F115-F117 HydrophobicContact CE1-CE1 3.69Å; F115-F117 AromaticContact CE1-CE2 3.41Å; F115-F117 HydrophobicContact CE1-CE2 3.41Å; F115-F117 VanDerWaalsContact CE1-CE2 3.41Å; F115-F117 AromaticContact CE1-CZ 3.16Å; F115-F117 HydrophobicContact CE1-CZ 3.16Å; F115-F117 HydrophobicContact CE2-CZ 4.41Å; F115-F117 HydrophobicContact CZ-CE1 4Å; F115-F117 HydrophobicContact CZ-CE2 4.12Å; F115-F117 AromaticContact CZ-CZ 3.47Å; F115-F117 HydrophobicContact CZ-CZ 3.47Å; F115-F117 VanDerWaalsContact CZ-CZ 3.47Å
116	P	77.8	Confident	87.1	Confident	56 Å²	56	73.1 Å²	73.1	36%	0.364	35%	0.354	S	S	.	.	S	Bend	cis	-70.1	151.3	-6.9	31.7	-34.4	0	0	0	110.9	D22 Q111 S114	D22-P116 HydrophobicContact CB-CG 4.46Å; D22-P116 WeakPolarHBondContact OD1-CD 3.31Å; D22-P116 WeakPolarHBondContact OD1-CG 3.5Å; Q111-P116 PolarHBondContact NE2-O 2.76Å; S114-P116 CarbonylContact O-C 3.56Å
117	F	77	Confident	86.3	Confident	90 Å²	90	72.5 Å²	72.5	40%	0.395	34%	0.344	S	S	.	.	P	Polyproline II helix	trans	-60.9	160.9	167	-56.2	-42.3	0	0	0	109.8	D112 F115 Q119	D112-F117 HydrophobicContact CB-CD1 4.19Å; D112-F117 HydrophobicContact CB-CE1 3.77Å; D112-F117 HydrophobicContact CB-CZ 4.41Å; F115-F117 HydrophobicContact CD1-CD1 4.31Å; F115-F117 HydrophobicContact CD1-CD2 4.41Å; F115-F117 AromaticContact CD1-CE1 3.98Å; F115-F117 HydrophobicContact CD1-CE1 3.98Å; F115-F117 HydrophobicContact CD1-CE2 4.11Å; F115-F117 AromaticContact CD1-CZ 3.9Å; F115-F117 HydrophobicContact CD1-CZ 3.9Å; F115-F117 HydrophobicContact CE1-CD1 4.37Å; F115-F117 HydrophobicContact CE1-CD2 4.13Å; F115-F117 AromaticContact CE1-CE1 3.69Å; F115-F117 HydrophobicContact CE1-CE1 3.69Å; F115-F117 AromaticContact CE1-CE2 3.41Å; F115-F117 HydrophobicContact CE1-CE2 3.41Å; F115-F117 VanDerWaalsContact CE1-CE2 3.41Å; F115-F117 AromaticContact CE1-CZ 3.16Å; F115-F117 HydrophobicContact CE1-CZ 3.16Å; F115-F117 HydrophobicContact CE2-CZ 4.41Å; F115-F117 HydrophobicContact CZ-CE1 4Å; F115-F117 HydrophobicContact CZ-CE2 4.12Å; F115-F117 AromaticContact CZ-CZ 3.47Å; F115-F117 HydrophobicContact CZ-CZ 3.47Å; F115-F117 VanDerWaalsContact CZ-CZ 3.47Å; F117-Q119 PolarHBondContact O-N 3.37Å
118	T	71.8	Confident	85.3	Confident	42 Å²	42	76.3 Å²	76.3	26%	0.258	36%	0.363	S	S	.	.	P	Polyproline II helix	trans	-48.3	128.4	170.7	19.5	0	0	0	0	110.9	M25 Q110	M25-T118 HydrophobicContact CB-CG2 3.63Å; M25-T118 HydrophobicContact CG-CG2 3.23Å; Q110-T118 WeakPolarHBondContact CA-OG1 3.16Å; Q110-T118 WeakPolarHBondContact CG-OG1 3.44Å
119	Q	54.7	Low	84.1	Confident	245 Å²	245	77.2 Å²	77.2	100%	1.145	37%	0.368	S	S	*	.			trans	-72.6	0	172.6	-76.4	-171	-4.6	0	0	112.1	F117	F117-Q119 PolarHBondContact O-N 3.37Å

Retrieved 119 of 119 residues in 27.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).