A0A087X5Q0_POEFO Loading...

Prefoldin subunit 6

Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.

AlphaFold DB , UniProt , Accession A0A087X5Q0, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 143 aa.

						>A0A087X5Q0_POEFO|A0A087X5Q0
MAEAIQKKLKAEVEKYTQTQKDVSKSVSARQKLETQMAENNIVKEELDLLDSSNTVFKLIGPVLVKQDLDEAKATVAKRLEYINGEIQRYETLLKDYHKKSEQQREVLTSLQQDLQKAQGLTPGKIWLTRLQRHKSGKSGESH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	70.3	Confident	89.3	Confident	191 Å²	191	100.5 Å²	100.5	94%	0.941	51%	0.508	S	S	*	.				0	-54.9	0	-166.6	175.1	-87.2	0	0	111.7	E3 A4 I5	M1-E3 PolarHBondContact O-N 3.05Å; M1-A4 PolarHBondContact O-N 3.29Å; M1-I5 HydrophobicContact CG-CD1 4.39Å; M1-I5 PolarHBondContact O-N 2.87Å
2	A	80.9	Confident	89.8	Confident	35 Å²	35	94.4 Å²	94.4	29%	0.289	48%	0.476	S	S	.	.	H	α-helix	trans	-59.8	-40.8	178.8	0	0	0	0	0	114.6	A4 I5 Q6 L115 A118	A2-A4 PolarHBondContact O-N 2.81Å; A2-I5 PolarHBondContact O-N 3.47Å; A2-Q6 PolarHBondContact O-N 2.94Å; A2-L115 HydrophobicContact CB-CD1 4.47Å; A2-A118 HydrophobicContact CB-CB 4.47Å
3	E	87.5	Confident	90.3	Very high	160 Å²	160	92.2 Å²	92.2	75%	0.748	47%	0.469	S	S	*	.	H	α-helix	trans	-63.4	-39.2	179.8	-169.5	-178.6	179.8	0	0	113.1	M1 I5 Q6 K7	M1-E3 PolarHBondContact O-N 3.05Å; E3-I5 PolarHBondContact O-N 3.38Å; E3-Q6 PolarHBondContact O-N 2.79Å; E3-K7 PolarHBondContact O-N 2.91Å
4	A	90.3	Very high	90.7	Very high	61 Å²	61	93.7 Å²	93.7	50%	0.504	47%	0.474	S	S	.	.	H	α-helix	trans	-66	-37.7	175.7	0	0	0	0	0	112.1	M1 A2 K8	M1-A4 PolarHBondContact O-N 3.29Å; A2-A4 PolarHBondContact O-N 2.81Å; A4-K8 WeakPolarHBondContact O-CG 3.34Å; A4-K8 PolarHBondContact O-N 2.89Å; A4-K8 VanDerWaalsContact O-N 3.1Å
5	I	90.3	Very high	91.1	Very high	26 Å²	26	94.8 Å²	94.8	13%	0.133	47%	0.474	C	S	.	.	H	α-helix	trans	-66.5	-43.7	175	-63.3	168.1	0	0	0	110	M1 A2 E3 K7 K8 L9 L111 D114 L115 A118	M1-I5 HydrophobicContact CG-CD1 4.39Å; M1-I5 PolarHBondContact O-N 2.87Å; A2-I5 PolarHBondContact O-N 3.47Å; E3-I5 PolarHBondContact O-N 3.38Å; I5-K7 PolarHBondContact O-N 2.95Å; I5-K8 PolarHBondContact O-N 3.44Å; I5-L9 WeakPolarHBondContact O-CB 3.13Å; I5-L9 PolarHBondContact O-N 2.55Å; I5-L111 HydrophobicContact CG2-CD2 4.36Å; I5-D114 HydrophobicContact CD1-CB 4.34Å; I5-L115 HydrophobicContact CB-CD1 4.33Å; I5-L115 HydrophobicContact CG2-CB 3.86Å; I5-L115 HydrophobicContact CG2-CD1 4.11Å; I5-A118 HydrophobicContact CD1-CB 4.1Å
6	Q	89.8	Confident	91.4	Very high	117 Å²	117	92.9 Å²	92.9	55%	0.547	46%	0.461	S	S	.	.	H	α-helix	trans	-61.4	-41.5	177.1	-172.4	178	-3.2	0	0	112.3	A2 E3 L9 K10	A2-Q6 PolarHBondContact O-N 2.94Å; E3-Q6 PolarHBondContact O-N 2.79Å; Q6-L9 PolarHBondContact O-N 2.79Å; Q6-K10 PolarHBondContact O-N 3.28Å
7	K	94.4	Very high	91.7	Very high	168 Å²	168	91.2 Å²	91.2	73%	0.73	46%	0.456	S	S	*	.	H	α-helix	trans	-63.3	-43.9	175.6	-172.4	175.7	-179.8	177.5	0	111.9	E3 I5 K10 A11	E3-K7 PolarHBondContact O-N 2.91Å; I5-K7 PolarHBondContact O-N 2.95Å; K7-K10 PolarHBondContact O-N 3.14Å; K7-A11 PolarHBondContact O-N 2.96Å; K7-A11 VanDerWaalsContact O-N 3.12Å
8	K	94.2	Very high	92	Very high	141 Å²	141	90.7 Å²	90.7	61%	0.613	45%	0.452	S	S	*	.	H	α-helix	trans	-63.3	-43.3	175.7	-75	-177.1	178.7	-175	0	111.9	A4 I5 K10 A11 E12 L111	A4-K8 WeakPolarHBondContact O-CG 3.34Å; A4-K8 PolarHBondContact O-N 2.89Å; A4-K8 VanDerWaalsContact O-N 3.1Å; I5-K8 PolarHBondContact O-N 3.44Å; K8-K10 PolarHBondContact O-N 2.94Å; K8-A11 PolarHBondContact O-N 2.95Å; K8-E12 PolarHBondContact O-N 3.06Å; K8-L111 HydrophobicContact CB-CD1 4.28Å; K8-L111 HydrophobicContact CB-CD2 4.28Å
9	L	93.7	Very high	92.3	Very high	28 Å²	28	85.9 Å²	85.9	15%	0.147	43%	0.429	C	S	.	.	H	α-helix	trans	-59.1	-48.3	177.4	-177.2	70.2	0	0	0	111.1	I5 Q6 A11 E12 V13 L108 L111 Q112 L115	I5-L9 WeakPolarHBondContact O-CB 3.13Å; I5-L9 PolarHBondContact O-N 2.55Å; Q6-L9 PolarHBondContact O-N 2.79Å; L9-A11 PolarHBondContact O-N 3.31Å; L9-E12 PolarHBondContact O-N 2.85Å; L9-V13 WeakPolarHBondContact O-CG2 3.34Å; L9-V13 PolarHBondContact O-N 2.98Å; L9-L108 HydrophobicContact CD1-CD2 3.75Å; L9-L111 HydrophobicContact CD1-CB 3.96Å; L9-Q112 HydrophobicContact CD1-CG 3.93Å; L9-L115 HydrophobicContact CD2-CD2 4.15Å
10	K	94.4	Very high	92.5	Very high	140 Å²	140	85.3 Å²	85.3	61%	0.609	42%	0.424	S	S	*	.	H	α-helix	trans	-58.4	-47	177.5	-174.5	-179.7	175.3	-175.4	0	111.7	Q6 K7 K8 E12 V13 E14	Q6-K10 PolarHBondContact O-N 3.28Å; K7-K10 PolarHBondContact O-N 3.14Å; K8-K10 PolarHBondContact O-N 2.94Å; K10-E12 VanDerWaalsContact C-N 3.32Å; K10-E12 PolarHBondContact O-N 3.1Å; K10-V13 PolarHBondContact O-N 2.91Å; K10-E14 VanDerWaalsContact CE-OE1 3.23Å; K10-E14 WeakPolarHBondContact CE-OE1 3.42Å; K10-E14 WeakPolarHBondContact O-CG 3.18Å; K10-E14 PolarHBondContact O-N 3.31Å
11	A	96.2	Very high	92.7	Very high	39 Å²	39	86.7 Å²	86.7	32%	0.322	43%	0.428	S	S	.	.	H	α-helix	trans	-61.5	-40	178.6	0	0	0	0	0	112.2	K7 K8 L9 E14 K15	K7-A11 PolarHBondContact O-N 2.96Å; K7-A11 VanDerWaalsContact O-N 3.12Å; K8-A11 PolarHBondContact O-N 2.95Å; L9-A11 PolarHBondContact O-N 3.31Å; A11-E14 PolarHBondContact O-N 3.41Å; A11-K15 WeakPolarHBondContact O-CG 3.49Å; A11-K15 PolarHBondContact O-N 3.36Å; A11-K15 VanDerWaalsContact O-N 3.12Å
12	E	95.8	Very high	94	Very high	27 Å²	27	79.1 Å²	79.1	13%	0.126	39%	0.391	C	S	.	.	H	α-helix	trans	-72.9	-34	179.8	-155.8	57.2	-132.2	0	0	112.3	K8 L9 K10 K15 Y16 Q104 V107 L108 L111	K8-E12 PolarHBondContact O-N 3.06Å; L9-E12 PolarHBondContact O-N 2.85Å; K10-E12 VanDerWaalsContact C-N 3.32Å; K10-E12 PolarHBondContact O-N 3.1Å; E12-K15 PolarHBondContact O-N 3.08Å; E12-K15 IonicContact OE2-NZ 3.96Å; E12-K15 PolarHBondContact OE2-NZ 3.5Å; E12-Y16 WeakPolarHBondContact O-CB 3.39Å; E12-Y16 PolarHBondContact O-N 3.08Å; E12-Q104 WeakPolarHBondContact OE1-CG 3.37Å; E12-Q104 PolarHBondContact OE1-NE2 3.46Å; E12-V107 HydrophobicContact CG-CG1 4.05Å; E12-L108 HydrophobicContact CB-CD2 3.78Å; E12-L108 HydrophobicContact CB-CG 4.36Å; E12-L108 HydrophobicContact CG-CD2 4.08Å; E12-L108 HydrophobicContact CG-CG 4.1Å; E12-L111 HydrophobicContact CB-CD1 4.47Å
13	V	95.9	Very high	94.8	Very high	65 Å²	65	79.2 Å²	79.2	39%	0.394	39%	0.388	S	S	.	.	H	α-helix	trans	-62.6	-42	171.5	169.8	0	0	0	0	111.3	L9 K10 Y16 T17 L108	L9-V13 WeakPolarHBondContact O-CG2 3.34Å; L9-V13 PolarHBondContact O-N 2.98Å; K10-V13 PolarHBondContact O-N 2.91Å; V13-Y16 PolarHBondContact O-N 3.2Å; V13-T17 WeakPolarHBondContact O-CB 3.47Å; V13-T17 PolarHBondContact O-N 3.28Å; V13-T17 PolarHBondContact O-OG1 3.38Å; V13-L108 HydrophobicContact CG2-CD2 3.61Å
14	E	96.8	Very high	95.3	Very high	114 Å²	114	75.1 Å²	75.1	53%	0.533	38%	0.377	S	S	.	.	H	α-helix	trans	-61.4	-46.2	176.4	-74.5	170.2	-173.5	0	0	111.2	K10 A11 T17 Q18	K10-E14 VanDerWaalsContact CE-OE1 3.23Å; K10-E14 WeakPolarHBondContact CE-OE1 3.42Å; K10-E14 WeakPolarHBondContact O-CG 3.18Å; K10-E14 PolarHBondContact O-N 3.31Å; A11-E14 PolarHBondContact O-N 3.41Å; E14-T17 PolarHBondContact O-N 2.88Å; E14-Q18 PolarHBondContact O-N 3.16Å
15	K	96.1	Very high	95.7	Very high	110 Å²	110	78.6 Å²	78.6	48%	0.478	38%	0.381	S	S	.	.	H	α-helix	trans	-64.1	-42.1	176.3	-63.7	174.2	-167.6	163.3	0	112.4	A11 E12 T17 Q18 T19	A11-K15 WeakPolarHBondContact O-CG 3.49Å; A11-K15 PolarHBondContact O-N 3.36Å; A11-K15 VanDerWaalsContact O-N 3.12Å; E12-K15 PolarHBondContact O-N 3.08Å; E12-K15 IonicContact OE2-NZ 3.96Å; E12-K15 PolarHBondContact OE2-NZ 3.5Å; K15-T17 VanDerWaalsContact C-N 3.35Å; K15-Q18 WeakPolarHBondContact O-CB 3.45Å; K15-Q18 PolarHBondContact O-N 3.13Å; K15-T19 PolarHBondContact O-N 2.64Å; K15-T19 PolarHBondContact O-OG1 3.43Å; K15-T19 VanDerWaalsContact O-OG1 3.13Å
16	Y	95.9	Very high	96	Very high	65 Å²	65	77.7 Å²	77.7	26%	0.255	38%	0.377	S	S	.	.	H	α-helix	trans	-61.3	-46.3	177.5	-178.6	-96.6	0	0	0	110.8	E12 V13 Q18 T19 Q20 S101 Q104 L108	E12-Y16 WeakPolarHBondContact O-CB 3.39Å; E12-Y16 PolarHBondContact O-N 3.08Å; V13-Y16 PolarHBondContact O-N 3.2Å; Y16-Q18 VanDerWaalsContact C-N 3.26Å; Y16-Q18 PolarHBondContact O-N 3.37Å; Y16-T19 PolarHBondContact O-N 3.22Å; Y16-T19 VanDerWaalsContact O-N 3.16Å; Y16-Q20 HydrophobicContact CD1-CG 4.11Å; Y16-Q20 HydrophobicContact CE1-CG 3.76Å; Y16-Q20 WeakPolarHBondContact O-CG 3.41Å; Y16-Q20 PolarHBondContact O-N 3.27Å; Y16-Q20 PolarHBondContact OH-NE2 3.4Å; Y16-S101 VanDerWaalsContact CE2-OG 3.28Å; Y16-S101 WeakPolarHBondContact CE2-OG 3.22Å; Y16-Q104 HydrophobicContact CD2-CB 3.89Å; Y16-L108 HydrophobicContact CD2-CD1 4.36Å; Y16-L108 HydrophobicContact CG-CD1 4.1Å
17	T	96.3	Very high	96.4	Very high	63 Å²	63	74.3 Å²	74.3	39%	0.387	36%	0.364	S	S	.	.	H	α-helix	trans	-58.3	-39.7	175.7	-56.8	0	0	0	0	111.6	V13 E14 K15 Q20 K21	V13-T17 WeakPolarHBondContact O-CB 3.47Å; V13-T17 PolarHBondContact O-N 3.28Å; V13-T17 PolarHBondContact O-OG1 3.38Å; E14-T17 PolarHBondContact O-N 2.88Å; K15-T17 VanDerWaalsContact C-N 3.35Å; T17-Q20 PolarHBondContact O-N 3.34Å; T17-K21 WeakPolarHBondContact O-CG 3.48Å; T17-K21 PolarHBondContact O-N 3Å; T17-K21 VanDerWaalsContact O-N 3.15Å
18	Q	96.8	Very high	96.6	Very high	83 Å²	83	68.9 Å²	68.9	39%	0.388	35%	0.347	S	S	.	.	H	α-helix	trans	-64.7	-47.5	175.3	-175.1	54.5	47.7	0	0	111.8	E14 K15 Y16 Q20 K21 D22	E14-Q18 PolarHBondContact O-N 3.16Å; K15-Q18 WeakPolarHBondContact O-CB 3.45Å; K15-Q18 PolarHBondContact O-N 3.13Å; Y16-Q18 VanDerWaalsContact C-N 3.26Å; Y16-Q18 PolarHBondContact O-N 3.37Å; Q18-Q20 VanDerWaalsContact C-N 3.27Å; Q18-Q20 PolarHBondContact O-N 2.97Å; Q18-K21 WeakPolarHBondContact O-CB 3.41Å; Q18-K21 PolarHBondContact O-N 3.14Å; Q18-K21 VanDerWaalsContact O-N 3.08Å; Q18-D22 VanDerWaalsContact NE2-CG 3.35Å; Q18-D22 PolarHBondContact NE2-OD1 2.98Å; Q18-D22 PolarHBondContact NE2-OD2 3.42Å; Q18-D22 PolarHBondContact O-N 3.3Å
19	T	97.4	Very high	96.8	Very high	0 Å²	0	63.2 Å²	63.2	0%	0	33%	0.327	C	S	.	.	H	α-helix	trans	-56	-41.6	175.4	-56.2	0	0	0	0	111.3	K15 Y16 K21 D22 V23 Y97 K100 Q104	K15-T19 PolarHBondContact O-N 2.64Å; K15-T19 PolarHBondContact O-OG1 3.43Å; K15-T19 VanDerWaalsContact O-OG1 3.13Å; Y16-T19 PolarHBondContact O-N 3.22Å; Y16-T19 VanDerWaalsContact O-N 3.16Å; T19-K21 PolarHBondContact O-N 2.93Å; T19-D22 PolarHBondContact O-N 3.37Å; T19-V23 WeakPolarHBondContact O-CG2 3.42Å; T19-V23 PolarHBondContact O-N 3.37Å; T19-Y97 HydrophobicContact CG2-CD1 4.29Å; T19-K100 HydrophobicContact CG2-CD 4.25Å; T19-K100 HydrophobicContact CG2-CG 4.48Å; T19-K100 WeakPolarHBondContact OG1-CE 3.4Å; T19-Q104 PolarHBondContact OG1-OE1 3Å
20	Q	96.9	Very high	97	Very high	72 Å²	72	65 Å²	65	34%	0.336	33%	0.331	S	S	.	.	H	α-helix	trans	-63	-39.1	176.8	-67.3	-59.5	-36.9	0	0	113	Y16 T17 Q18 D22 V23 S24 S101	Y16-Q20 HydrophobicContact CD1-CG 4.11Å; Y16-Q20 HydrophobicContact CE1-CG 3.76Å; Y16-Q20 WeakPolarHBondContact O-CG 3.41Å; Y16-Q20 PolarHBondContact O-N 3.27Å; Y16-Q20 PolarHBondContact OH-NE2 3.4Å; T17-Q20 PolarHBondContact O-N 3.34Å; Q18-Q20 VanDerWaalsContact C-N 3.27Å; Q18-Q20 PolarHBondContact O-N 2.97Å; Q20-D22 VanDerWaalsContact C-N 3.33Å; Q20-V23 PolarHBondContact O-N 2.89Å; Q20-S24 PolarHBondContact O-N 3.16Å; Q20-S101 PolarHBondContact NE2-OG 2.81Å; Q20-S101 VanDerWaalsContact NE2-OG 3.13Å
21	K	97.8	Very high	97.2	Very high	115 Å²	115	63 Å²	63	50%	0.5	32%	0.324	S	S	.	.	H	α-helix	trans	-63.4	-40.9	173.6	-70.4	175.6	-178.8	177.3	0	111.6	T17 Q18 T19 S24 K25	T17-K21 WeakPolarHBondContact O-CG 3.48Å; T17-K21 PolarHBondContact O-N 3Å; T17-K21 VanDerWaalsContact O-N 3.15Å; Q18-K21 WeakPolarHBondContact O-CB 3.41Å; Q18-K21 PolarHBondContact O-N 3.14Å; Q18-K21 VanDerWaalsContact O-N 3.08Å; T19-K21 PolarHBondContact O-N 2.93Å; K21-S24 PolarHBondContact O-N 3.33Å; K21-K25 WeakPolarHBondContact O-CG 2.91Å; K21-K25 PolarHBondContact O-N 2.97Å
22	D	97.1	Very high	97.3	Very high	33 Å²	33	68 Å²	68	18%	0.176	34%	0.339	C	S	.	.	H	α-helix	trans	-71.4	-33.8	-178.7	-63.2	-31.9	0	0	0	112	Q18 T19 Q20 K25 S26 Y97	Q18-D22 VanDerWaalsContact NE2-CG 3.35Å; Q18-D22 PolarHBondContact NE2-OD1 2.98Å; Q18-D22 PolarHBondContact NE2-OD2 3.42Å; Q18-D22 PolarHBondContact O-N 3.3Å; T19-D22 PolarHBondContact O-N 3.37Å; Q20-D22 VanDerWaalsContact C-N 3.33Å; D22-K25 IonicContact OD1-NZ 3.34Å; D22-S26 VanDerWaalsContact O-CB 3.31Å; D22-S26 WeakPolarHBondContact O-CB 3.39Å; D22-S26 PolarHBondContact O-N 3.32Å; D22-S26 PolarHBondContact O-OG 3.19Å; D22-Y97 HydrophobicContact CB-CE1 4.26Å; D22-Y97 HydrophobicContact CB-CE2 3.91Å
23	V	98.1	Very high	97.4	Very high	37 Å²	37	67.8 Å²	67.8	22%	0.224	34%	0.338	C	S	.	.	H	α-helix	trans	-59	-53.3	167.8	169.8	0	0	0	0	110.4	T19 Q20 K25 S26 V27 L94 Y97	T19-V23 WeakPolarHBondContact O-CG2 3.42Å; T19-V23 PolarHBondContact O-N 3.37Å; Q20-V23 PolarHBondContact O-N 2.89Å; V23-K25 VanDerWaalsContact C-N 3.35Å; V23-K25 PolarHBondContact O-N 2.94Å; V23-S26 PolarHBondContact O-N 2.89Å; V23-S26 VanDerWaalsContact O-N 3.11Å; V23-V27 HydrophobicContact CG1-CG2 4.31Å; V23-V27 WeakPolarHBondContact O-CG2 3.46Å; V23-V27 PolarHBondContact O-N 2.9Å; V23-L94 HydrophobicContact CG1-CD2 4.17Å; V23-Y97 HydrophobicContact CG2-CD2 4.09Å; V23-Y97 HydrophobicContact CG2-CG 4.11Å
24	S	97.8	Very high	97.5	Very high	73 Å²	73	68.3 Å²	68.3	51%	0.51	34%	0.337	S	S	.	.	H	α-helix	trans	-57	-46.4	-179.1	174.4	0	0	0	0	112.1	Q20 K21 S26 V27 S28	Q20-S24 PolarHBondContact O-N 3.16Å; K21-S24 PolarHBondContact O-N 3.33Å; S24-S26 VanDerWaalsContact C-N 3.34Å; S24-S26 PolarHBondContact O-N 3.48Å; S24-V27 PolarHBondContact O-N 2.77Å; S24-S28 PolarHBondContact O-N 3.42Å; S24-S28 PolarHBondContact O-OG 3.49Å
25	K	97.8	Very high	97.6	Very high	135 Å²	135	66.8 Å²	66.8	59%	0.587	34%	0.335	S	S	*	.	H	α-helix	trans	-59.5	-43.5	175.8	-71.9	173.4	-176.4	173.6	0	112.4	K21 D22 V23 S28 A29	K21-K25 WeakPolarHBondContact O-CG 2.91Å; K21-K25 PolarHBondContact O-N 2.97Å; D22-K25 IonicContact OD1-NZ 3.34Å; V23-K25 VanDerWaalsContact C-N 3.35Å; V23-K25 PolarHBondContact O-N 2.94Å; K25-S28 PolarHBondContact O-N 3.27Å; K25-A29 WeakPolarHBondContact O-CB 3.49Å; K25-A29 PolarHBondContact O-N 2.94Å
26	S	97.9	Very high	97.7	Very high	7 Å²	7	65 Å²	65	5%	0.049	33%	0.329	C	S	.	.	H	α-helix	trans	-68.3	-40.2	-178	-59.2	0	0	0	0	111.8	D22 V23 S24 A29 R30	D22-S26 VanDerWaalsContact O-CB 3.31Å; D22-S26 WeakPolarHBondContact O-CB 3.39Å; D22-S26 PolarHBondContact O-N 3.32Å; D22-S26 PolarHBondContact O-OG 3.19Å; V23-S26 PolarHBondContact O-N 2.89Å; V23-S26 VanDerWaalsContact O-N 3.11Å; S24-S26 VanDerWaalsContact C-N 3.34Å; S24-S26 PolarHBondContact O-N 3.48Å; S26-A29 PolarHBondContact O-N 3.46Å; S26-R30 WeakPolarHBondContact O-CB 3.49Å; S26-R30 PolarHBondContact O-N 2.95Å
27	V	98.1	Very high	97.8	Very high	46 Å²	46	63.2 Å²	63.2	28%	0.279	32%	0.323	S	S	.	.	H	α-helix	trans	-61.2	-49.2	173.7	171.4	0	0	0	0	110.7	V23 S24 A29 R30 Q31 L94	V23-V27 HydrophobicContact CG1-CG2 4.31Å; V23-V27 WeakPolarHBondContact O-CG2 3.46Å; V23-V27 PolarHBondContact O-N 2.9Å; S24-V27 PolarHBondContact O-N 2.77Å; V27-A29 VanDerWaalsContact C-N 3.31Å; V27-A29 PolarHBondContact O-N 3.09Å; V27-R30 PolarHBondContact O-N 3.45Å; V27-Q31 HydrophobicContact CG1-CG 4.46Å; V27-Q31 WeakPolarHBondContact O-CG 3.49Å; V27-Q31 PolarHBondContact O-N 2.91Å; V27-L94 HydrophobicContact CG2-CD1 4.27Å; V27-L94 HydrophobicContact CG2-CD2 3.84Å
28	S	98	Very high	97.8	Very high	53 Å²	53	62.8 Å²	62.8	37%	0.371	33%	0.325	S	S	.	.	H	α-helix	trans	-63.2	-36.3	178.7	-62.1	0	0	0	0	112.8	S24 K25 K32	S24-S28 PolarHBondContact O-N 3.42Å; S24-S28 PolarHBondContact O-OG 3.49Å; K25-S28 PolarHBondContact O-N 3.27Å; S28-K32 WeakPolarHBondContact O-CG 3.29Å; S28-K32 PolarHBondContact O-N 3.28Å
29	A	97.8	Very high	97.9	Very high	23 Å²	23	64 Å²	64	19%	0.19	33%	0.331	C	S	.	.	H	α-helix	trans	-66.9	-44.5	175.1	0	0	0	0	0	111.7	K25 S26 V27 K32 L33 Y90	K25-A29 WeakPolarHBondContact O-CB 3.49Å; K25-A29 PolarHBondContact O-N 2.94Å; S26-A29 PolarHBondContact O-N 3.46Å; V27-A29 VanDerWaalsContact C-N 3.31Å; V27-A29 PolarHBondContact O-N 3.09Å; A29-K32 PolarHBondContact O-N 3.04Å; A29-L33 PolarHBondContact O-N 3.31Å; A29-L33 VanDerWaalsContact O-N 3.16Å; A29-Y90 HydrophobicContact CB-CD1 4.49Å; A29-Y90 HydrophobicContact CB-CE1 3.79Å; A29-Y90 HydrophobicContact CB-CE2 3.98Å
30	R	98.1	Very high	97.9	Very high	65 Å²	65	64.5 Å²	64.5	25%	0.245	33%	0.334	C	S	.	.	H	α-helix	trans	-61.7	-45.1	177.5	-163.8	-169.1	77.8	-163.1	0.8	112	S26 V27 K32 L33 E34 I87	S26-R30 WeakPolarHBondContact O-CB 3.49Å; S26-R30 PolarHBondContact O-N 2.95Å; V27-R30 PolarHBondContact O-N 3.45Å; R30-K32 VanDerWaalsContact C-N 3.3Å; R30-K32 PolarHBondContact O-N 3.27Å; R30-L33 WeakPolarHBondContact O-CB 3.48Å; R30-L33 PolarHBondContact O-N 3.27Å; R30-E34 IonicContact CZ-OE1 3.27Å; R30-E34 IonicContact NE-OE1 2.73Å; R30-E34 PolarHBondContact NE-OE1 2.96Å; R30-E34 IonicContact NH2-OE1 3.43Å; R30-E34 PolarHBondContact NH2-OE1 2.98Å; R30-E34 WeakPolarHBondContact O-CG 3.45Å; R30-E34 PolarHBondContact O-N 3.34Å; R30-I87 HydrophobicContact CG-CG2 4.38Å
31	Q	98.2	Very high	98	Very high	99 Å²	99	64 Å²	64	46%	0.463	33%	0.334	S	S	.	.	H	α-helix	trans	-58.1	-40.9	177	-76	172.5	-24	0	0	112.4	V27 L33 E34 T35	V27-Q31 HydrophobicContact CG1-CG 4.46Å; V27-Q31 WeakPolarHBondContact O-CG 3.49Å; V27-Q31 PolarHBondContact O-N 2.91Å; Q31-L33 VanDerWaalsContact C-N 3.33Å; Q31-L33 PolarHBondContact O-N 3.28Å; Q31-E34 PolarHBondContact O-N 3.38Å; Q31-T35 PolarHBondContact O-N 3.1Å; Q31-T35 PolarHBondContact O-OG1 3.27Å
32	K	98.3	Very high	98	Very high	144 Å²	144	63.2 Å²	63.2	63%	0.626	33%	0.334	S	S	*	.	H	α-helix	trans	-62.9	-40.5	175.1	-71.4	174.7	-178	-176.3	0	112	S28 A29 R30 T35 Q36	S28-K32 WeakPolarHBondContact O-CG 3.29Å; S28-K32 PolarHBondContact O-N 3.28Å; A29-K32 PolarHBondContact O-N 3.04Å; R30-K32 VanDerWaalsContact C-N 3.3Å; R30-K32 PolarHBondContact O-N 3.27Å; K32-T35 PolarHBondContact O-N 3.37Å; K32-Q36 WeakPolarHBondContact O-CG 3.47Å; K32-Q36 PolarHBondContact O-N 3.33Å
33	L	98.5	Very high	98	Very high	22 Å²	22	64.8 Å²	64.8	12%	0.115	34%	0.344	C	S	.	.	H	α-helix	trans	-67.6	-37.6	176.4	-69.2	168.5	0	0	0	111.7	A29 R30 Q31 Q36 M37 I83 E86 I87 Y90	A29-L33 PolarHBondContact O-N 3.31Å; A29-L33 VanDerWaalsContact O-N 3.16Å; R30-L33 WeakPolarHBondContact O-CB 3.48Å; R30-L33 PolarHBondContact O-N 3.27Å; Q31-L33 VanDerWaalsContact C-N 3.33Å; Q31-L33 PolarHBondContact O-N 3.28Å; L33-Q36 PolarHBondContact O-N 3.46Å; L33-M37 WeakPolarHBondContact O-CB 3.5Å; L33-M37 PolarHBondContact O-N 2.91Å; L33-I83 HydrophobicContact CB-CG2 4.07Å; L33-I83 HydrophobicContact CD2-CG2 4.18Å; L33-I83 WeakPolarHBondContact O-CG2 3.45Å; L33-E86 HydrophobicContact CD1-CB 3.73Å; L33-I87 HydrophobicContact CB-CD1 4.2Å; L33-I87 HydrophobicContact CB-CG1 3.74Å; L33-I87 HydrophobicContact CD1-CG1 4.38Å; L33-Y90 HydrophobicContact CD1-CD2 3.69Å; L33-Y90 HydrophobicContact CD1-CE2 3.75Å
34	E	98	Very high	98	Very high	76 Å²	76	66.8 Å²	66.8	36%	0.355	35%	0.35	S	S	.	.	H	α-helix	trans	-61	-43.1	174.1	-71.8	166.6	-172.5	0	0	111.3	R30 Q31 M37 A38 I87	R30-E34 IonicContact CZ-OE1 3.27Å; R30-E34 IonicContact NE-OE1 2.73Å; R30-E34 PolarHBondContact NE-OE1 2.96Å; R30-E34 IonicContact NH2-OE1 3.43Å; R30-E34 PolarHBondContact NH2-OE1 2.98Å; R30-E34 WeakPolarHBondContact O-CG 3.45Å; R30-E34 PolarHBondContact O-N 3.34Å; Q31-E34 PolarHBondContact O-N 3.38Å; E34-M37 WeakPolarHBondContact O-CB 3.24Å; E34-M37 PolarHBondContact O-N 3.45Å; E34-A38 PolarHBondContact O-N 3.44Å; E34-I87 HydrophobicContact CG-CD1 4.22Å
35	T	98.3	Very high	98	Very high	82 Å²	82	69.2 Å²	69.2	50%	0.503	35%	0.353	S	S	.	.	H	α-helix	trans	-61.6	-47.9	173.6	-53.7	0	0	0	0	111.4	Q31 K32 M37 A38 E39	Q31-T35 PolarHBondContact O-N 3.1Å; Q31-T35 PolarHBondContact O-OG1 3.27Å; K32-T35 PolarHBondContact O-N 3.37Å; T35-M37 VanDerWaalsContact C-N 3.28Å; T35-M37 PolarHBondContact O-N 3.29Å; T35-A38 PolarHBondContact O-N 3.05Å; T35-E39 WeakPolarHBondContact O-CG 3.49Å; T35-E39 PolarHBondContact O-N 2.99Å
36	Q	98.2	Very high	98	Very high	73 Å²	73	68.4 Å²	68.4	34%	0.341	35%	0.352	S	S	.	.	H	α-helix	trans	-62	-36.4	177.6	-71.2	179.8	-4	0	0	112.4	K32 L33 N40 I83	K32-Q36 WeakPolarHBondContact O-CG 3.47Å; K32-Q36 PolarHBondContact O-N 3.33Å; L33-Q36 PolarHBondContact O-N 3.46Å; Q36-N40 WeakPolarHBondContact O-CB 3.41Å; Q36-N40 PolarHBondContact O-N 3.44Å; Q36-N40 PolarHBondContact O-ND2 3.04Å; Q36-I83 HydrophobicContact CB-CD1 4.05Å
37	M	98.1	Very high	97.9	Very high	27 Å²	27	68.9 Å²	68.9	13%	0.133	35%	0.354	C	S	.	.	H	α-helix	trans	-61.2	-49.8	175.8	-177.6	64.4	82.5	0	0	110.6	L33 E34 T35 E39 N40 N41 L80 I83 N84 I87	L33-M37 WeakPolarHBondContact O-CB 3.5Å; L33-M37 PolarHBondContact O-N 2.91Å; E34-M37 WeakPolarHBondContact O-CB 3.24Å; E34-M37 PolarHBondContact O-N 3.45Å; T35-M37 VanDerWaalsContact C-N 3.28Å; T35-M37 PolarHBondContact O-N 3.29Å; M37-E39 PolarHBondContact O-N 2.73Å; M37-N40 PolarHBondContact O-N 2.79Å; M37-N41 WeakPolarHBondContact O-CB 3.47Å; M37-N41 PolarHBondContact O-N 3.29Å; M37-N41 PolarHBondContact O-ND2 2.97Å; M37-L80 HydrophobicContact SD-CB 4.47Å; M37-L80 HydrophobicContact SD-CD2 3.36Å; M37-L80 WeakPolarHBondContact SD-CD2 3.33Å; M37-I83 HydrophobicContact CB-CG2 3.95Å; M37-I83 HydrophobicContact CE-CB 3.82Å; M37-I83 HydrophobicContact CE-CG2 3.62Å; M37-I83 HydrophobicContact SD-CG2 4.36Å; M37-N84 VanDerWaalsContact CE-CA 3.45Å; M37-N84 HydrophobicContact CE-CB 3.55Å; M37-N84 VanDerWaalsContact CE-N 3.26Å; M37-I87 HydrophobicContact CB-CD1 4.37Å; M37-I87 HydrophobicContact CE-CD1 4.11Å
38	A	98	Very high	97.8	Very high	53 Å²	53	70.4 Å²	70.4	44%	0.438	36%	0.36	S	S	.	.	H	α-helix	trans	-59.5	-46.8	178.9	0	0	0	0	0	111.6	E34 T35 N40 N41 I42	E34-A38 PolarHBondContact O-N 3.44Å; T35-A38 PolarHBondContact O-N 3.05Å; A38-N40 PolarHBondContact O-N 3.04Å; A38-N41 PolarHBondContact O-N 3.35Å; A38-I42 WeakPolarHBondContact O-CG1 3.42Å; A38-I42 PolarHBondContact O-N 3.02Å; A38-I42 VanDerWaalsContact O-N 3.1Å
39	E	98	Very high	97.8	Very high	108 Å²	108	74.4 Å²	74.4	51%	0.505	38%	0.377	S	S	.	.	H	α-helix	trans	-59.4	-44.3	176.8	-70.1	171.9	-178.3	0	0	112.2	T35 M37 I42 V43	T35-E39 WeakPolarHBondContact O-CG 3.49Å; T35-E39 PolarHBondContact O-N 2.99Å; M37-E39 PolarHBondContact O-N 2.73Å; E39-I42 PolarHBondContact O-N 3.39Å; E39-V43 WeakPolarHBondContact O-CG2 3.27Å; E39-V43 PolarHBondContact O-N 3.39Å; E39-V43 VanDerWaalsContact O-N 3.09Å
40	N	97.9	Very high	97.7	Very high	11 Å²	11	76 Å²	76	6%	0.059	38%	0.381	C	S	.	.	H	α-helix	trans	-73.2	-28.3	-179.4	-77.7	-92.9	0	0	0	112.6	Q36 M37 A38 V43 K44 R79 L80	Q36-N40 WeakPolarHBondContact O-CB 3.41Å; Q36-N40 PolarHBondContact O-N 3.44Å; Q36-N40 PolarHBondContact O-ND2 3.04Å; M37-N40 PolarHBondContact O-N 2.79Å; A38-N40 PolarHBondContact O-N 3.04Å; N40-V43 PolarHBondContact O-N 3.24Å; N40-K44 WeakPolarHBondContact O-CB 3.47Å; N40-K44 PolarHBondContact O-N 3.37Å; N40-R79 VanDerWaalsContact OD1-CD 3.27Å; N40-R79 WeakPolarHBondContact OD1-CD 3.41Å; N40-L80 HydrophobicContact CB-CD2 3.51Å; N40-L80 HydrophobicContact CB-CG 4.06Å
41	N	98.2	Very high	97.4	Very high	63 Å²	63	77 Å²	77	34%	0.337	39%	0.392	S	S	.	.	H	α-helix	trans	-65.7	-43.3	172	-80.2	-32.4	0	0	0	111	M37 A38 V43 K44 E45 L80	M37-N41 WeakPolarHBondContact O-CB 3.47Å; M37-N41 PolarHBondContact O-N 3.29Å; M37-N41 PolarHBondContact O-ND2 2.97Å; A38-N41 PolarHBondContact O-N 3.35Å; N41-V43 VanDerWaalsContact C-N 3.34Å; N41-V43 PolarHBondContact O-N 3.33Å; N41-K44 WeakPolarHBondContact O-CB 3.4Å; N41-K44 PolarHBondContact O-N 2.99Å; N41-K44 VanDerWaalsContact O-N 3.16Å; N41-E45 WeakPolarHBondContact O-CG 3.41Å; N41-E45 PolarHBondContact O-N 3.1Å; N41-L80 WeakPolarHBondContact OD1-CD2 3.38Å
42	I	98.1	Very high	97	Very high	97 Å²	97	78.3 Å²	78.3	50%	0.497	41%	0.412	S	S	.	.	H	α-helix	trans	-59	-47.6	173.9	-64.8	164.8	0	0	0	110	A38 E39 K44 E45 E46	A38-I42 WeakPolarHBondContact O-CG1 3.42Å; A38-I42 PolarHBondContact O-N 3.02Å; A38-I42 VanDerWaalsContact O-N 3.1Å; E39-I42 PolarHBondContact O-N 3.39Å; I42-K44 VanDerWaalsContact C-N 3.28Å; I42-K44 PolarHBondContact O-N 2.88Å; I42-E45 PolarHBondContact O-N 2.73Å; I42-E46 HydrophobicContact CG2-CG 4.43Å; I42-E46 WeakPolarHBondContact O-CG 3.42Å; I42-E46 PolarHBondContact O-N 3.38Å
43	V	97.4	Very high	96.8	Very high	67 Å²	67	76 Å²	76	41%	0.406	41%	0.414	S	S	.	.	H	α-helix	trans	-59.8	-40	177.3	175	0	0	0	0	111.7	E39 N40 N41 E46 L47 V76	E39-V43 WeakPolarHBondContact O-CG2 3.27Å; E39-V43 PolarHBondContact O-N 3.39Å; E39-V43 VanDerWaalsContact O-N 3.09Å; N40-V43 PolarHBondContact O-N 3.24Å; N41-V43 VanDerWaalsContact C-N 3.34Å; N41-V43 PolarHBondContact O-N 3.33Å; V43-E46 PolarHBondContact O-N 2.92Å; V43-L47 HydrophobicContact CG1-CD1 4.09Å; V43-L47 HydrophobicContact CG1-CG 4.34Å; V43-L47 WeakPolarHBondContact O-CB 3.33Å; V43-L47 VanDerWaalsContact O-CG 3.29Å; V43-L47 WeakPolarHBondContact O-CG 3.44Å; V43-L47 PolarHBondContact O-N 3.34Å; V43-V76 HydrophobicContact CG1-CG2 3.91Å
44	K	97.8	Very high	96.7	Very high	79 Å²	79	78.1 Å²	78.1	34%	0.343	43%	0.425	S	S	.	.	H	α-helix	trans	-62	-47.3	176.3	-174.9	-169.4	170.1	-63.2	0	111.1	N40 N41 I42 E46 L47 D48 V76 L80	N40-K44 WeakPolarHBondContact O-CB 3.47Å; N40-K44 PolarHBondContact O-N 3.37Å; N41-K44 WeakPolarHBondContact O-CB 3.4Å; N41-K44 PolarHBondContact O-N 2.99Å; N41-K44 VanDerWaalsContact O-N 3.16Å; I42-K44 VanDerWaalsContact C-N 3.28Å; I42-K44 PolarHBondContact O-N 2.88Å; K44-E46 VanDerWaalsContact C-N 3.35Å; K44-E46 PolarHBondContact O-N 2.94Å; K44-L47 PolarHBondContact O-N 2.88Å; K44-D48 IonicContact NZ-OD2 2.64Å; K44-D48 PolarHBondContact NZ-OD2 2.87Å; K44-D48 WeakPolarHBondContact O-CB 3.25Å; K44-D48 VanDerWaalsContact O-CG 3.23Å; K44-D48 PolarHBondContact O-N 3.29Å; K44-V76 HydrophobicContact CB-CG1 3.85Å; K44-L80 HydrophobicContact CB-CD1 4.1Å; K44-L80 HydrophobicContact CD-CD1 3.71Å; K44-L80 HydrophobicContact CG-CD1 4.37Å
45	E	97.8	Very high	96.5	Very high	123 Å²	123	78.1 Å²	78.1	58%	0.575	43%	0.431	S	S	*	.	H	α-helix	trans	-58.6	-46.3	177.8	-72	170.6	-168.4	0	0	111.2	N41 I42 L47 D48 L49	N41-E45 WeakPolarHBondContact O-CG 3.41Å; N41-E45 PolarHBondContact O-N 3.1Å; I42-E45 PolarHBondContact O-N 2.73Å; E45-L47 PolarHBondContact O-N 3.07Å; E45-D48 PolarHBondContact O-N 3.16Å; E45-L49 WeakPolarHBondContact O-CG 3.37Å; E45-L49 PolarHBondContact O-N 3.3Å
46	E	97.2	Very high	96.4	Very high	118 Å²	118	75.2 Å²	75.2	55%	0.551	41%	0.412	S	S	*	.	H	α-helix	trans	-62.2	-42.8	176.2	-67.2	-64.7	153.3	0	0	112.4	I42 V43 K44 D48 L49	I42-E46 HydrophobicContact CG2-CG 4.43Å; I42-E46 WeakPolarHBondContact O-CG 3.42Å; I42-E46 PolarHBondContact O-N 3.38Å; V43-E46 PolarHBondContact O-N 2.92Å; K44-E46 VanDerWaalsContact C-N 3.35Å; K44-E46 PolarHBondContact O-N 2.94Å; E46-D48 VanDerWaalsContact C-N 3.29Å; E46-D48 PolarHBondContact O-N 3.04Å; E46-L49 PolarHBondContact O-N 3.47Å
47	L	96.5	Very high	96.4	Very high	18 Å²	18	77.1 Å²	77.1	9%	0.094	42%	0.42	C	S	.	.	H	α-helix	trans	-64.9	-33.7	176.4	-74.3	176.1	0	0	0	112.4	V43 K44 E45 L49 L50 L69 A72 K73 V76	V43-L47 HydrophobicContact CG1-CD1 4.09Å; V43-L47 HydrophobicContact CG1-CG 4.34Å; V43-L47 WeakPolarHBondContact O-CB 3.33Å; V43-L47 VanDerWaalsContact O-CG 3.29Å; V43-L47 WeakPolarHBondContact O-CG 3.44Å; V43-L47 PolarHBondContact O-N 3.34Å; K44-L47 PolarHBondContact O-N 2.88Å; E45-L47 PolarHBondContact O-N 3.07Å; L47-L49 PolarHBondContact O-N 3.17Å; L47-L50 HydrophobicContact CD2-CD1 3.95Å; L47-L50 WeakPolarHBondContact O-CB 3.37Å; L47-L50 PolarHBondContact O-N 3.25Å; L47-L69 HydrophobicContact CD2-CD1 4.13Å; L47-A72 HydrophobicContact CD1-CB 4.36Å; L47-A72 HydrophobicContact CD2-CB 4.41Å; L47-K73 HydrophobicContact CB-CG 4.06Å; L47-K73 HydrophobicContact CD1-CG 4.42Å; L47-K73 WeakPolarHBondContact O-CE 3.4Å; L47-K73 PolarHBondContact O-NZ 3.36Å; L47-V76 HydrophobicContact CD1-CB 4.34Å; L47-V76 HydrophobicContact CD1-CG2 3.72Å
48	D	95.9	Very high	96.3	Very high	78 Å²	78	80.1 Å²	80.1	42%	0.417	43%	0.432	S	S	.	.	H	α-helix	trans	-69.7	-21.6	179.3	-73.6	-20.9	0	0	0	112.6	K44 E45 E46 L50	K44-D48 IonicContact NZ-OD2 2.64Å; K44-D48 PolarHBondContact NZ-OD2 2.87Å; K44-D48 WeakPolarHBondContact O-CB 3.25Å; K44-D48 VanDerWaalsContact O-CG 3.23Å; K44-D48 PolarHBondContact O-N 3.29Å; E45-D48 PolarHBondContact O-N 3.16Å; E46-D48 VanDerWaalsContact C-N 3.29Å; E46-D48 PolarHBondContact O-N 3.04Å; D48-L50 VanDerWaalsContact C-N 3.33Å
49	L	96.7	Very high	96.2	Very high	136 Å²	136	83.4 Å²	83.4	71%	0.712	44%	0.442	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.1	-15.3	173.1	-62.3	175.5	0	0	0	113.6	E45 E46 L47	E45-L49 WeakPolarHBondContact O-CG 3.37Å; E45-L49 PolarHBondContact O-N 3.3Å; E46-L49 PolarHBondContact O-N 3.47Å; L47-L49 PolarHBondContact O-N 3.17Å
50	L	96	Very high	96	Very high	56 Å²	56	82.5 Å²	82.5	29%	0.293	44%	0.44	S	S	.	.			trans	-82.1	143.1	-178.5	-56.2	-178.4	0	0	0	111.9	L47 D48 N54 V56 L69	L47-L50 HydrophobicContact CD2-CD1 3.95Å; L47-L50 WeakPolarHBondContact O-CB 3.37Å; L47-L50 PolarHBondContact O-N 3.25Å; D48-L50 VanDerWaalsContact C-N 3.33Å; L50-N54 HydrophobicContact CB-CB 4.22Å; L50-N54 HydrophobicContact CD2-CB 4.2Å; L50-V56 HydrophobicContact CD1-CG2 3.78Å; L50-L69 HydrophobicContact CB-CD1 3.96Å; L50-L69 HydrophobicContact CB-CD2 4.02Å; L50-L69 HydrophobicContact CD1-CD1 3.93Å
51	D	93.1	Very high	95.9	Very high	88 Å²	88	85 Å²	85	47%	0.471	47%	0.468	S	S	.	.			trans	-110.8	178.4	172.7	69.8	47.6	0	0	0	112	S53 N54	D51-S53 PolarHBondContact O-N 3.06Å; D51-S53 VanDerWaalsContact O-N 3.14Å; D51-S53 WeakPolarHBondContact OD1-CA 3.38Å; D51-S53 WeakPolarHBondContact OD1-CB 3.33Å; D51-S53 PolarHBondContact OD1-N 2.91Å; D51-S53 PolarHBondContact OD1-OG 3.28Å; D51-N54 PolarHBondContact N-OD1 3.05Å; D51-N54 WeakPolarHBondContact O-CB 3.36Å; D51-N54 PolarHBondContact O-N 3.45Å; D51-N54 PolarHBondContact O-OD1 2.95Å; D51-N54 PolarHBondContact OD1-OD1 3.38Å
52	S	89.6	Confident	95.9	Very high	126 Å²	126	88.3 Å²	88.3	88%	0.881	49%	0.493	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.6	-13.6	-175.9	56.3	0	0	0	0	114.8
53	S	93.7	Very high	95.8	Very high	94 Å²	94	87.6 Å²	87.6	66%	0.657	49%	0.493	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.1	-21	174.7	77.2	0	0	0	0	112.3	D51	D51-S53 PolarHBondContact O-N 3.06Å; D51-S53 VanDerWaalsContact O-N 3.14Å; D51-S53 WeakPolarHBondContact OD1-CA 3.38Å; D51-S53 WeakPolarHBondContact OD1-CB 3.33Å; D51-S53 PolarHBondContact OD1-N 2.91Å; D51-S53 PolarHBondContact OD1-OG 3.28Å
54	N	95.7	Very high	95.9	Very high	68 Å²	68	90 Å²	90	36%	0.364	50%	0.503	S	S	.	.	S	Bend	trans	-76.4	145.4	178.6	-57.9	113.8	0	0	0	111.3	L50 D51	L50-N54 HydrophobicContact CB-CB 4.22Å; L50-N54 HydrophobicContact CD2-CB 4.2Å; D51-N54 PolarHBondContact N-OD1 3.05Å; D51-N54 WeakPolarHBondContact O-CB 3.36Å; D51-N54 PolarHBondContact O-N 3.45Å; D51-N54 PolarHBondContact O-OD1 2.95Å; D51-N54 PolarHBondContact OD1-OD1 3.38Å
55	T	95.4	Very high	95.8	Very high	76 Å²	76	89.5 Å²	89.5	47%	0.466	51%	0.506	S	S	.	.			trans	-108.9	123	174.9	-58.6	0	0	0	0	110	F57 K66	T55-F57 HydrophobicContact CG2-CD2 4.17Å; T55-F57 HydrophobicContact CG2-CE1 4.37Å; T55-F57 HydrophobicContact CG2-CE2 3.43Å; T55-F57 VanDerWaalsContact CG2-CE2 3.43Å; T55-F57 HydrophobicContact CG2-CZ 3.55Å; T55-K66 HydrophobicContact CG2-CD 4.01Å; T55-K66 HydrophobicContact CG2-CG 4.06Å
56	V	96.1	Very high	95.8	Very high	20 Å²	20	90.8 Å²	90.8	12%	0.121	51%	0.51	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99	141	178	-178.3	0	0	0	0	110.1	L50 Q67 L69 A72	L50-V56 HydrophobicContact CD1-CG2 3.78Å; V56-Q67 PolarHBondContact O-N 3.47Å; V56-L69 HydrophobicContact CG2-CB 4.46Å; V56-L69 HydrophobicContact CG2-CD1 3.71Å; V56-A72 HydrophobicContact CG1-CB 4.14Å
57	F	96.6	Very high	95.8	Very high	114 Å²	114	86.4 Å²	86.4	50%	0.5	49%	0.489	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.5	139.8	175.1	-64.2	-91	0	0	0	110.6	T55 L64 V65 K66	T55-F57 HydrophobicContact CG2-CD2 4.17Å; T55-F57 HydrophobicContact CG2-CE1 4.37Å; T55-F57 HydrophobicContact CG2-CE2 3.43Å; T55-F57 VanDerWaalsContact CG2-CE2 3.43Å; T55-F57 HydrophobicContact CG2-CZ 3.55Å; F57-L64 HydrophobicContact CB-CB 4.26Å; F57-L64 HydrophobicContact CB-CD2 4.35Å; F57-L64 HydrophobicContact CD1-CB 4.39Å; F57-V65 CarbonylContact C-O 3.55Å; F57-V65 WeakPolarHBondContact CA-O 3.33Å; F57-K66 HydrophobicContact CD1-CB 4.14Å; F57-K66 HydrophobicContact CE1-CB 3.96Å
58	K	96.3	Very high	95.8	Very high	89 Å²	89	90 Å²	90	39%	0.387	51%	0.509	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.6	131.4	173.3	-174.9	177.4	-178.1	174.5	0	110.1	I60 V65 Q67	K58-I60 HydrophobicContact CD-CD1 4.46Å; K58-I60 HydrophobicContact CD-CG1 4.41Å; K58-I60 HydrophobicContact CG-CG1 4.24Å; K58-V65 PolarHBondContact N-O 2.91Å; K58-V65 PolarHBondContact O-N 3.4Å; K58-Q67 HydrophobicContact CB-CB 4.29Å
59	L	95.9	Very high	95.8	Very high	122 Å²	122	87.3 Å²	87.3	64%	0.639	49%	0.494	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-78.5	122.8	172	-176.1	66.4	0	0	0	110.3	G61 L64	L59-G61 WeakPolarHBondContact CD1-O 3.49Å; L59-L64 HydrophobicContact CB-CD2 4.04Å; L59-L64 HydrophobicContact CD1-CD2 3.95Å
60	I	94.4	Very high	95.7	Very high	90 Å²	90	86.3 Å²	86.3	46%	0.462	49%	0.489	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.7	104.3	174.6	-56.9	-179.2	0	0	0	107.6	K58 V63 V65	K58-I60 HydrophobicContact CD-CD1 4.46Å; K58-I60 HydrophobicContact CD-CG1 4.41Å; K58-I60 HydrophobicContact CG-CG1 4.24Å; I60-V63 HydrophobicContact CB-CG2 4.45Å; I60-V63 PolarHBondContact N-O 3.45Å; I60-V63 WeakPolarHBondContact O-CG2 3.43Å; I60-V63 PolarHBondContact O-N 3.34Å; I60-V63 VanDerWaalsContact O-N 3.1Å; I60-V65 HydrophobicContact CD1-CB 4.4Å; I60-V65 HydrophobicContact CD1-CG2 4.08Å
61	G	96.1	Very high	95.7	Very high	63 Å²	63	88.6 Å²	88.6	65%	0.649	50%	0.498	S	S	*	.	T	Hydrogen-bonded Turn	trans	59.2	-126.5	-173	0	0	0	0	0	110.9	L59	L59-G61 WeakPolarHBondContact CD1-O 3.49Å
62	P	96.6	Very high	95.9	Very high	133 Å²	133	84.6 Å²	84.6	86%	0.864	48%	0.478	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.8	4	177.4	35.4	-33.9	0	0	0	114.3
63	V	97.6	Very high	96.2	Very high	81 Å²	81	81.2 Å²	81.2	49%	0.491	45%	0.447	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.5	147.1	-173	-59.6	0	0	0	0	113.6	I60 V65	I60-V63 HydrophobicContact CB-CG2 4.45Å; I60-V63 PolarHBondContact N-O 3.45Å; I60-V63 WeakPolarHBondContact O-CG2 3.43Å; I60-V63 PolarHBondContact O-N 3.34Å; I60-V63 VanDerWaalsContact O-N 3.1Å; V63-V65 HydrophobicContact CG2-CG2 4.26Å
64	L	98	Very high	96.4	Very high	119 Å²	119	79.5 Å²	79.5	62%	0.623	44%	0.439	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-97.9	124.4	170.3	-69.3	176.5	0	0	0	109.9	F57 L59	F57-L64 HydrophobicContact CB-CB 4.26Å; F57-L64 HydrophobicContact CB-CD2 4.35Å; F57-L64 HydrophobicContact CD1-CB 4.39Å; L59-L64 HydrophobicContact CB-CD2 4.04Å; L59-L64 HydrophobicContact CD1-CD2 3.95Å
65	V	97.4	Very high	96.5	Very high	68 Å²	68	79.4 Å²	79.4	41%	0.412	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.8	129.4	178.3	-177.5	0	0	0	0	108.6	F57 K58 I60 V63 Q67	F57-V65 CarbonylContact C-O 3.55Å; F57-V65 WeakPolarHBondContact CA-O 3.33Å; K58-V65 PolarHBondContact N-O 2.91Å; K58-V65 PolarHBondContact O-N 3.4Å; I60-V65 HydrophobicContact CD1-CB 4.4Å; I60-V65 HydrophobicContact CD1-CG2 4.08Å; V63-V65 HydrophobicContact CG2-CG2 4.26Å; V65-Q67 PolarHBondContact O-N 3.28Å
66	K	97.3	Very high	96.6	Very high	150 Å²	150	76.6 Å²	76.6	65%	0.652	42%	0.423	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-59.1	128	174.9	-176.9	172.8	173.9	170.2	0	108.7	T55 F57	T55-K66 HydrophobicContact CG2-CD 4.01Å; T55-K66 HydrophobicContact CG2-CG 4.06Å; F57-K66 HydrophobicContact CD1-CB 4.14Å; F57-K66 HydrophobicContact CE1-CB 3.96Å
67	Q	96.4	Very high	96.7	Very high	26 Å²	26	77.4 Å²	77.4	12%	0.121	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.8	144	177.9	-165.7	176.2	12.3	0	0	109	V56 K58 V65 E71	V56-Q67 PolarHBondContact O-N 3.47Å; K58-Q67 HydrophobicContact CB-CB 4.29Å; V65-Q67 PolarHBondContact O-N 3.28Å; Q67-E71 HydrophobicContact CG-CB 4.45Å; Q67-E71 PolarHBondContact NE2-OE1 3.38Å
68	D	96.2	Very high	96.7	Very high	93 Å²	93	79.3 Å²	79.3	50%	0.497	44%	0.44	S	S	.	.			trans	-64.7	141	170.5	179	-98.1	0	0	0	110.8	D70 E71 A72	D68-D70 WeakPolarHBondContact OD1-CA 3.37Å; D68-D70 WeakPolarHBondContact OD1-CB 3.46Å; D68-D70 PolarHBondContact OD1-N 3.18Å; D68-E71 HydrophobicContact CB-CB 3.97Å; D68-E71 PolarHBondContact O-N 2.9Å; D68-E71 PolarHBondContact OD1-N 3.04Å; D68-A72 WeakPolarHBondContact O-CB 3.36Å; D68-A72 PolarHBondContact O-N 3.45Å
69	L	96	Very high	96.8	Very high	22 Å²	22	80.9 Å²	80.9	12%	0.115	44%	0.444	C	S	.	.	H	α-helix	trans	-65.7	-41	-176	176.7	61	0	0	0	111.5	L47 L50 V56 A72 K73	L47-L69 HydrophobicContact CD2-CD1 4.13Å; L50-L69 HydrophobicContact CB-CD1 3.96Å; L50-L69 HydrophobicContact CB-CD2 4.02Å; L50-L69 HydrophobicContact CD1-CD1 3.93Å; V56-L69 HydrophobicContact CG2-CB 4.46Å; V56-L69 HydrophobicContact CG2-CD1 3.71Å; L69-A72 PolarHBondContact O-N 3.36Å; L69-K73 HydrophobicContact CG-CD 4.48Å; L69-K73 WeakPolarHBondContact O-CG 3.42Å; L69-K73 PolarHBondContact O-N 2.76Å
70	D	95.5	Very high	97	Very high	114 Å²	114	76 Å²	76	61%	0.61	42%	0.418	S	S	*	.	H	α-helix	trans	-69.8	-37.2	-180	-65.6	-31.7	0	0	0	110.5	D68 K73 A74	D68-D70 WeakPolarHBondContact OD1-CA 3.37Å; D68-D70 WeakPolarHBondContact OD1-CB 3.46Å; D68-D70 PolarHBondContact OD1-N 3.18Å; D70-K73 PolarHBondContact O-N 3.02Å; D70-A74 WeakPolarHBondContact O-CB 3.44Å; D70-A74 PolarHBondContact O-N 3.38Å
71	E	95.7	Very high	97.1	Very high	104 Å²	104	78.3 Å²	78.3	49%	0.486	43%	0.427	S	S	.	.	H	α-helix	trans	-63.5	-40.8	172.6	-164	-159.6	130.6	0	0	112.3	Q67 D68 A74 T75	Q67-E71 HydrophobicContact CG-CB 4.45Å; Q67-E71 PolarHBondContact NE2-OE1 3.38Å; D68-E71 HydrophobicContact CB-CB 3.97Å; D68-E71 PolarHBondContact O-N 2.9Å; D68-E71 PolarHBondContact OD1-N 3.04Å; E71-A74 PolarHBondContact O-N 3.02Å; E71-T75 WeakPolarHBondContact O-CB 3.25Å; E71-T75 PolarHBondContact O-N 3.16Å; E71-T75 PolarHBondContact O-OG1 3.3Å
72	A	97	Very high	97.2	Very high	5 Å²	5	82.6 Å²	82.6	4%	0.041	43%	0.425	C	S	.	.	H	α-helix	trans	-62.1	-47.2	175.1	0	0	0	0	0	111	L47 V56 D68 L69 T75 V76	L47-A72 HydrophobicContact CD1-CB 4.36Å; L47-A72 HydrophobicContact CD2-CB 4.41Å; V56-A72 HydrophobicContact CG1-CB 4.14Å; D68-A72 WeakPolarHBondContact O-CB 3.36Å; D68-A72 PolarHBondContact O-N 3.45Å; L69-A72 PolarHBondContact O-N 3.36Å; A72-T75 WeakPolarHBondContact O-CB 3.35Å; A72-T75 PolarHBondContact O-N 2.95Å; A72-V76 WeakPolarHBondContact O-CG2 3.42Å; A72-V76 PolarHBondContact O-N 3.08Å; A72-V76 VanDerWaalsContact O-N 3.08Å
73	K	96.9	Very high	97.3	Very high	55 Å²	55	76.4 Å²	76.4	24%	0.239	38%	0.384	C	S	.	.	H	α-helix	trans	-59.1	-47.8	175.5	-74.8	178.9	177.1	179.9	0	112	L47 L69 D70 T75 V76 A77	L47-K73 HydrophobicContact CB-CG 4.06Å; L47-K73 HydrophobicContact CD1-CG 4.42Å; L47-K73 WeakPolarHBondContact O-CE 3.4Å; L47-K73 PolarHBondContact O-NZ 3.36Å; L69-K73 HydrophobicContact CG-CD 4.48Å; L69-K73 WeakPolarHBondContact O-CG 3.42Å; L69-K73 PolarHBondContact O-N 2.76Å; D70-K73 PolarHBondContact O-N 3.02Å; K73-T75 VanDerWaalsContact C-N 3.3Å; K73-T75 PolarHBondContact O-N 2.89Å; K73-V76 PolarHBondContact O-N 3.4Å; K73-A77 WeakPolarHBondContact O-CB 3.31Å; K73-A77 PolarHBondContact O-N 3.11Å
74	A	97.3	Very high	97.4	Very high	58 Å²	58	76.1 Å²	76.1	48%	0.479	38%	0.38	S	S	.	.	H	α-helix	trans	-61.8	-38.2	178.4	0	0	0	0	0	112.3	D70 E71 A77 K78	D70-A74 WeakPolarHBondContact O-CB 3.44Å; D70-A74 PolarHBondContact O-N 3.38Å; E71-A74 PolarHBondContact O-N 3.02Å; A74-A77 PolarHBondContact O-N 3.02Å; A74-K78 WeakPolarHBondContact O-CB 3.37Å; A74-K78 PolarHBondContact O-N 2.92Å
75	T	96.9	Very high	97.4	Very high	65 Å²	65	72 Å²	72	40%	0.399	37%	0.366	S	S	.	.	H	α-helix	trans	-63.4	-46.1	176.8	-60.9	0	0	0	0	111.5	E71 A72 K73 R79	E71-T75 WeakPolarHBondContact O-CB 3.25Å; E71-T75 PolarHBondContact O-N 3.16Å; E71-T75 PolarHBondContact O-OG1 3.3Å; A72-T75 WeakPolarHBondContact O-CB 3.35Å; A72-T75 PolarHBondContact O-N 2.95Å; K73-T75 VanDerWaalsContact C-N 3.3Å; K73-T75 PolarHBondContact O-N 2.89Å; T75-R79 WeakPolarHBondContact O-CB 3.45Å; T75-R79 PolarHBondContact O-N 3.19Å; T75-R79 VanDerWaalsContact O-N 3.08Å
76	V	97.7	Very high	97.4	Very high	17 Å²	17	70.6 Å²	70.6	10%	0.103	36%	0.355	C	S	.	.	H	α-helix	trans	-66.7	-43.4	178.6	175.5	0	0	0	0	110.8	V43 K44 L47 A72 K73 K78 R79 L80	V43-V76 HydrophobicContact CG1-CG2 3.91Å; K44-V76 HydrophobicContact CB-CG1 3.85Å; L47-V76 HydrophobicContact CD1-CB 4.34Å; L47-V76 HydrophobicContact CD1-CG2 3.72Å; A72-V76 WeakPolarHBondContact O-CG2 3.42Å; A72-V76 PolarHBondContact O-N 3.08Å; A72-V76 VanDerWaalsContact O-N 3.08Å; K73-V76 PolarHBondContact O-N 3.4Å; V76-K78 PolarHBondContact O-N 3.47Å; V76-R79 WeakPolarHBondContact O-CB 3.41Å; V76-R79 PolarHBondContact O-N 3.02Å; V76-R79 VanDerWaalsContact O-N 3.16Å; V76-L80 HydrophobicContact CG1-CD1 4.11Å; V76-L80 HydrophobicContact CG1-CG 4.48Å; V76-L80 WeakPolarHBondContact O-CG 3.44Å; V76-L80 PolarHBondContact O-N 3.45Å
77	A	98	Very high	97.5	Very high	37 Å²	37	64.3 Å²	64.3	31%	0.306	33%	0.329	S	S	.	.	H	α-helix	trans	-57.8	-49.3	176.6	0	0	0	0	0	112	K73 A74 R79 L80 E81	K73-A77 WeakPolarHBondContact O-CB 3.31Å; K73-A77 PolarHBondContact O-N 3.11Å; A74-A77 PolarHBondContact O-N 3.02Å; A77-R79 VanDerWaalsContact C-N 3.26Å; A77-R79 PolarHBondContact O-N 3.35Å; A77-L80 WeakPolarHBondContact O-CB 3.43Å; A77-L80 PolarHBondContact O-N 3.06Å; A77-L80 VanDerWaalsContact O-N 3.14Å; A77-E81 WeakPolarHBondContact O-CG 3.42Å; A77-E81 PolarHBondContact O-N 3.24Å
78	K	98.3	Very high	97.5	Very high	154 Å²	154	68.2 Å²	68.2	67%	0.67	35%	0.347	S	S	*	.	H	α-helix	trans	-61.6	-35.1	177.4	-172.3	171.9	-174.7	174.8	0	112.6	A74 V76 Y82	A74-K78 WeakPolarHBondContact O-CB 3.37Å; A74-K78 PolarHBondContact O-N 2.92Å; V76-K78 PolarHBondContact O-N 3.47Å; K78-Y82 PolarHBondContact O-N 3.01Å; K78-Y82 VanDerWaalsContact O-N 3.13Å
79	R	98.1	Very high	97.6	Very high	122 Å²	122	69.2 Å²	69.2	46%	0.46	34%	0.344	S	S	.	.	H	α-helix	trans	-66.9	-43.2	175.3	-177.2	164.9	-179.5	-172.7	4	111.5	N40 T75 V76 A77 Y82 I83	N40-R79 VanDerWaalsContact OD1-CD 3.27Å; N40-R79 WeakPolarHBondContact OD1-CD 3.41Å; T75-R79 WeakPolarHBondContact O-CB 3.45Å; T75-R79 PolarHBondContact O-N 3.19Å; T75-R79 VanDerWaalsContact O-N 3.08Å; V76-R79 WeakPolarHBondContact O-CB 3.41Å; V76-R79 PolarHBondContact O-N 3.02Å; V76-R79 VanDerWaalsContact O-N 3.16Å; A77-R79 VanDerWaalsContact C-N 3.26Å; A77-R79 PolarHBondContact O-N 3.35Å; R79-Y82 PolarHBondContact O-N 3.33Å; R79-I83 HydrophobicContact CG-CD1 3.8Å; R79-I83 HydrophobicContact CG-CG1 4.4Å; R79-I83 VanDerWaalsContact O-CG1 3.24Å; R79-I83 WeakPolarHBondContact O-CG1 3.37Å; R79-I83 PolarHBondContact O-N 3.43Å
80	L	98.5	Very high	97.7	Very high	19 Å²	19	70.4 Å²	70.4	10%	0.099	35%	0.347	C	S	.	.	H	α-helix	trans	-61.3	-44.8	175.7	-70.7	167.9	0	0	0	111.7	M37 N40 N41 K44 V76 A77 Y82 I83 N84	M37-L80 HydrophobicContact SD-CB 4.47Å; M37-L80 HydrophobicContact SD-CD2 3.36Å; M37-L80 WeakPolarHBondContact SD-CD2 3.33Å; N40-L80 HydrophobicContact CB-CD2 3.51Å; N40-L80 HydrophobicContact CB-CG 4.06Å; N41-L80 WeakPolarHBondContact OD1-CD2 3.38Å; K44-L80 HydrophobicContact CB-CD1 4.1Å; K44-L80 HydrophobicContact CD-CD1 3.71Å; K44-L80 HydrophobicContact CG-CD1 4.37Å; V76-L80 HydrophobicContact CG1-CD1 4.11Å; V76-L80 HydrophobicContact CG1-CG 4.48Å; V76-L80 WeakPolarHBondContact O-CG 3.44Å; V76-L80 PolarHBondContact O-N 3.45Å; A77-L80 WeakPolarHBondContact O-CB 3.43Å; A77-L80 PolarHBondContact O-N 3.06Å; A77-L80 VanDerWaalsContact O-N 3.14Å; L80-Y82 VanDerWaalsContact C-N 3.35Å; L80-Y82 PolarHBondContact O-N 3.43Å; L80-I83 PolarHBondContact O-N 3.4Å; L80-N84 WeakPolarHBondContact O-CB 3.4Å; L80-N84 PolarHBondContact O-N 3.42Å
81	E	98.4	Very high	97.8	Very high	139 Å²	139	68.9 Å²	68.9	65%	0.65	34%	0.336	S	S	*	.	H	α-helix	trans	-56.7	-47.6	175.7	-72.7	173.8	-174.9	0	0	112	A77 N84 G85	A77-E81 WeakPolarHBondContact O-CG 3.42Å; A77-E81 PolarHBondContact O-N 3.24Å; E81-N84 PolarHBondContact O-N 3.04Å; E81-G85 PolarHBondContact O-N 2.93Å
82	Y	98.3	Very high	97.9	Very high	153 Å²	153	67.7 Å²	67.7	60%	0.6	34%	0.336	S	S	*	.	H	α-helix	trans	-61.6	-48.9	177.7	175.8	-93	0	0	0	112.2	K78 R79 L80 N84 G85 E86	K78-Y82 PolarHBondContact O-N 3.01Å; K78-Y82 VanDerWaalsContact O-N 3.13Å; R79-Y82 PolarHBondContact O-N 3.33Å; L80-Y82 VanDerWaalsContact C-N 3.35Å; L80-Y82 PolarHBondContact O-N 3.43Å; Y82-N84 VanDerWaalsContact C-N 3.26Å; Y82-N84 PolarHBondContact O-N 3.23Å; Y82-G85 PolarHBondContact O-N 2.85Å; Y82-E86 HydrophobicContact CD1-CG 4.36Å; Y82-E86 HydrophobicContact CE1-CG 3.78Å; Y82-E86 HydrophobicContact CE2-CG 4.19Å; Y82-E86 PolarHBondContact O-N 2.8Å
83	I	98.3	Very high	98	Very high	3 Å²	3	69.8 Å²	69.8	2%	0.015	35%	0.346	C	S	.	.	H	α-helix	trans	-61	-40.7	-180	-64.8	166.9	0	0	0	109.9	L33 Q36 M37 R79 L80 E86 I87	L33-I83 HydrophobicContact CB-CG2 4.07Å; L33-I83 HydrophobicContact CD2-CG2 4.18Å; L33-I83 WeakPolarHBondContact O-CG2 3.45Å; Q36-I83 HydrophobicContact CB-CD1 4.05Å; M37-I83 HydrophobicContact CB-CG2 3.95Å; M37-I83 HydrophobicContact CE-CB 3.82Å; M37-I83 HydrophobicContact CE-CG2 3.62Å; M37-I83 HydrophobicContact SD-CG2 4.36Å; R79-I83 HydrophobicContact CG-CD1 3.8Å; R79-I83 HydrophobicContact CG-CG1 4.4Å; R79-I83 VanDerWaalsContact O-CG1 3.24Å; R79-I83 WeakPolarHBondContact O-CG1 3.37Å; R79-I83 PolarHBondContact O-N 3.43Å; L80-I83 PolarHBondContact O-N 3.4Å; I83-E86 PolarHBondContact O-N 2.87Å; I83-I87 HydrophobicContact CG2-CD1 4.03Å; I83-I87 HydrophobicContact CG2-CG1 4.45Å; I83-I87 WeakPolarHBondContact O-CG1 3.38Å; I83-I87 PolarHBondContact O-N 3.28Å
84	N	98.3	Very high	98	Very high	75 Å²	75	68.4 Å²	68.4	40%	0.401	34%	0.342	S	S	.	.	H	α-helix	trans	-64.3	-44.3	179.9	-169.5	61.3	0	0	0	111.3	M37 L80 E81 Y82 E86 I87 Q88	M37-N84 VanDerWaalsContact CE-CA 3.45Å; M37-N84 HydrophobicContact CE-CB 3.55Å; M37-N84 VanDerWaalsContact CE-N 3.26Å; L80-N84 WeakPolarHBondContact O-CB 3.4Å; L80-N84 PolarHBondContact O-N 3.42Å; E81-N84 PolarHBondContact O-N 3.04Å; Y82-N84 VanDerWaalsContact C-N 3.26Å; Y82-N84 PolarHBondContact O-N 3.23Å; N84-E86 VanDerWaalsContact C-N 3.33Å; N84-E86 PolarHBondContact O-N 3.37Å; N84-I87 PolarHBondContact O-N 3.09Å; N84-Q88 WeakPolarHBondContact O-CG 3.38Å; N84-Q88 PolarHBondContact O-N 3Å
85	G	98.4	Very high	98.1	Very high	32 Å²	32	71.9 Å²	71.9	33%	0.33	35%	0.346	S	S	.	.	H	α-helix	trans	-59.8	-42.1	174.4	0	0	0	0	0	112.6	E81 Y82 Q88 R89	E81-G85 PolarHBondContact O-N 2.93Å; Y82-G85 PolarHBondContact O-N 2.85Å; G85-Q88 PolarHBondContact O-N 3.01Å; G85-R89 PolarHBondContact O-N 2.95Å
86	E	98.4	Very high	98.1	Very high	39 Å²	39	72.7 Å²	72.7	18%	0.182	35%	0.347	C	S	.	.	H	α-helix	trans	-67.4	-38.5	177.1	-77.7	-66	97	0	0	112.8	L33 Y82 I83 N84 R89 Y90	L33-E86 HydrophobicContact CD1-CB 3.73Å; Y82-E86 HydrophobicContact CD1-CG 4.36Å; Y82-E86 HydrophobicContact CE1-CG 3.78Å; Y82-E86 HydrophobicContact CE2-CG 4.19Å; Y82-E86 PolarHBondContact O-N 2.8Å; I83-E86 PolarHBondContact O-N 2.87Å; N84-E86 VanDerWaalsContact C-N 3.33Å; N84-E86 PolarHBondContact O-N 3.37Å; E86-R89 WeakPolarHBondContact O-CB 3.19Å; E86-R89 PolarHBondContact O-N 3.41Å; E86-R89 WeakPolarHBondContact OE1-CD 3.43Å; E86-R89 IonicContact OE1-CZ 2.76Å; E86-R89 IonicContact OE1-NE 3.36Å; E86-R89 PolarHBondContact OE1-NE 3.13Å; E86-R89 IonicContact OE1-NH2 2.85Å; E86-R89 IonicContact OE2-CZ 3.72Å; E86-R89 IonicContact OE2-NE 2.81Å; E86-R89 PolarHBondContact OE2-NE 3.42Å; E86-R89 IonicContact OE2-NH2 3.79Å; E86-R89 PolarHBondContact OE2-NH2 3.44Å; E86-Y90 VanDerWaalsContact O-CD2 3.25Å; E86-Y90 WeakPolarHBondContact O-CD2 3.48Å; E86-Y90 PolarHBondContact O-N 3.13Å
87	I	98.1	Very high	98.1	Very high	19 Å²	19	74 Å²	74	10%	0.097	35%	0.351	C	S	.	.	H	α-helix	trans	-59.2	-49	173.1	-71.8	171.6	0	0	0	110	R30 L33 E34 M37 I83 N84 R89 Y90 E91	R30-I87 HydrophobicContact CG-CG2 4.38Å; L33-I87 HydrophobicContact CB-CD1 4.2Å; L33-I87 HydrophobicContact CB-CG1 3.74Å; L33-I87 HydrophobicContact CD1-CG1 4.38Å; E34-I87 HydrophobicContact CG-CD1 4.22Å; M37-I87 HydrophobicContact CB-CD1 4.37Å; M37-I87 HydrophobicContact CE-CD1 4.11Å; I83-I87 HydrophobicContact CG2-CD1 4.03Å; I83-I87 HydrophobicContact CG2-CG1 4.45Å; I83-I87 WeakPolarHBondContact O-CG1 3.38Å; I83-I87 PolarHBondContact O-N 3.28Å; N84-I87 PolarHBondContact O-N 3.09Å; I87-R89 VanDerWaalsContact C-N 3.28Å; I87-R89 PolarHBondContact O-N 3.12Å; I87-Y90 PolarHBondContact O-N 3.31Å; I87-Y90 VanDerWaalsContact O-N 3.1Å; I87-E91 HydrophobicContact CG2-CG 4.45Å; I87-E91 WeakPolarHBondContact O-CG 3.39Å; I87-E91 PolarHBondContact O-N 3.38Å
88	Q	98.2	Very high	98	Very high	107 Å²	107	77.9 Å²	77.9	50%	0.5	36%	0.363	S	S	.	.	H	α-helix	trans	-60.3	-37.4	177.7	-70.9	-179.4	-15.2	0	0	112.5	N84 G85 E91 T92	N84-Q88 WeakPolarHBondContact O-CG 3.38Å; N84-Q88 PolarHBondContact O-N 3Å; G85-Q88 PolarHBondContact O-N 3.01Å; Q88-E91 PolarHBondContact O-N 3.23Å; Q88-T92 PolarHBondContact O-N 2.88Å; Q88-T92 PolarHBondContact O-OG1 3.36Å
89	R	98.3	Very high	97.9	Very high	115 Å²	115	76.6 Å²	76.6	43%	0.434	36%	0.357	S	S	.	.	H	α-helix	trans	-61.9	-45.6	173.9	-171.1	179.3	68.8	81.7	2.2	111.3	G85 E86 I87 T92 L93	G85-R89 PolarHBondContact O-N 2.95Å; E86-R89 WeakPolarHBondContact O-CB 3.19Å; E86-R89 PolarHBondContact O-N 3.41Å; E86-R89 WeakPolarHBondContact OE1-CD 3.43Å; E86-R89 IonicContact OE1-CZ 2.76Å; E86-R89 IonicContact OE1-NE 3.36Å; E86-R89 PolarHBondContact OE1-NE 3.13Å; E86-R89 IonicContact OE1-NH2 2.85Å; E86-R89 IonicContact OE2-CZ 3.72Å; E86-R89 IonicContact OE2-NE 2.81Å; E86-R89 PolarHBondContact OE2-NE 3.42Å; E86-R89 IonicContact OE2-NH2 3.79Å; E86-R89 PolarHBondContact OE2-NH2 3.44Å; I87-R89 VanDerWaalsContact C-N 3.28Å; I87-R89 PolarHBondContact O-N 3.12Å; R89-T92 PolarHBondContact O-N 3.25Å; R89-L93 WeakPolarHBondContact O-CB 3.24Å; R89-L93 PolarHBondContact O-N 2.97Å
90	Y	98.2	Very high	97.9	Very high	46 Å²	46	75 Å²	75	18%	0.18	35%	0.353	C	S	.	.	H	α-helix	trans	-66.8	-36.8	176.5	-83.9	-66.6	0	0	0	112.9	A29 L33 E86 I87 T92 L93 L94	A29-Y90 HydrophobicContact CB-CD1 4.49Å; A29-Y90 HydrophobicContact CB-CE1 3.79Å; A29-Y90 HydrophobicContact CB-CE2 3.98Å; L33-Y90 HydrophobicContact CD1-CD2 3.69Å; L33-Y90 HydrophobicContact CD1-CE2 3.75Å; E86-Y90 VanDerWaalsContact O-CD2 3.25Å; E86-Y90 WeakPolarHBondContact O-CD2 3.48Å; E86-Y90 PolarHBondContact O-N 3.13Å; I87-Y90 PolarHBondContact O-N 3.31Å; I87-Y90 VanDerWaalsContact O-N 3.1Å; Y90-T92 VanDerWaalsContact C-N 3.34Å; Y90-L93 HydrophobicContact CD1-CD2 4.34Å; Y90-L93 PolarHBondContact O-N 3.39Å; Y90-L94 WeakPolarHBondContact O-CB 3.45Å; Y90-L94 VanDerWaalsContact O-CG 3.25Å; Y90-L94 WeakPolarHBondContact O-CG 3.48Å; Y90-L94 PolarHBondContact O-N 3.12Å
91	E	97.1	Very high	97.7	Very high	82 Å²	82	74.5 Å²	74.5	38%	0.383	35%	0.352	S	S	.	.	H	α-helix	trans	-62.1	-42.6	174	-73	-174.9	163	0	0	112.2	I87 Q88 L94 K95	I87-E91 HydrophobicContact CG2-CG 4.45Å; I87-E91 WeakPolarHBondContact O-CG 3.39Å; I87-E91 PolarHBondContact O-N 3.38Å; Q88-E91 PolarHBondContact O-N 3.23Å; E91-L94 PolarHBondContact O-N 3.03Å; E91-K95 WeakPolarHBondContact O-CG 3.36Å; E91-K95 PolarHBondContact O-N 3.43Å
92	T	98.1	Very high	97.6	Very high	79 Å²	79	70.6 Å²	70.6	49%	0.485	33%	0.333	S	S	.	.	H	α-helix	trans	-62.9	-47.4	175.5	-57	0	0	0	0	110.6	Q88 R89 Y90 L94 K95 D96	Q88-T92 PolarHBondContact O-N 2.88Å; Q88-T92 PolarHBondContact O-OG1 3.36Å; R89-T92 PolarHBondContact O-N 3.25Å; Y90-T92 VanDerWaalsContact C-N 3.34Å; T92-L94 VanDerWaalsContact C-N 3.33Å; T92-L94 PolarHBondContact O-N 2.77Å; T92-K95 WeakPolarHBondContact O-CB 3.4Å; T92-K95 PolarHBondContact O-N 2.96Å; T92-D96 PolarHBondContact O-N 3.09Å
93	L	97.6	Very high	97.5	Very high	50 Å²	50	69.3 Å²	69.3	26%	0.262	33%	0.333	S	S	.	.	H	α-helix	trans	-60.3	-41.8	178.5	-173.2	66.1	0	0	0	112.3	R89 Y90 D96 Y97	R89-L93 WeakPolarHBondContact O-CB 3.24Å; R89-L93 PolarHBondContact O-N 2.97Å; Y90-L93 HydrophobicContact CD1-CD2 4.34Å; Y90-L93 PolarHBondContact O-N 3.39Å; L93-D96 PolarHBondContact O-N 3.42Å; L93-Y97 HydrophobicContact CD1-CE1 4.2Å; L93-Y97 HydrophobicContact CD1-CE2 3.9Å; L93-Y97 HydrophobicContact CD2-CE2 3.72Å; L93-Y97 HydrophobicContact CG-CD2 4.02Å; L93-Y97 HydrophobicContact CG-CE2 3.42Å; L93-Y97 VanDerWaalsContact CG-CE2 3.42Å; L93-Y97 WeakPolarHBondContact O-CD2 3.36Å; L93-Y97 PolarHBondContact O-N 3.47Å
94	L	98.1	Very high	97.4	Very high	26 Å²	26	69.7 Å²	69.7	14%	0.136	33%	0.334	C	S	.	.	H	α-helix	trans	-65.5	-39	176.8	-76.5	168.3	0	0	0	112.2	V23 V27 Y90 E91 T92 D96 Y97 H98	V23-L94 HydrophobicContact CG1-CD2 4.17Å; V27-L94 HydrophobicContact CG2-CD1 4.27Å; V27-L94 HydrophobicContact CG2-CD2 3.84Å; Y90-L94 WeakPolarHBondContact O-CB 3.45Å; Y90-L94 VanDerWaalsContact O-CG 3.25Å; Y90-L94 WeakPolarHBondContact O-CG 3.48Å; Y90-L94 PolarHBondContact O-N 3.12Å; E91-L94 PolarHBondContact O-N 3.03Å; T92-L94 VanDerWaalsContact C-N 3.33Å; T92-L94 PolarHBondContact O-N 2.77Å; L94-D96 VanDerWaalsContact C-N 3.3Å; L94-D96 PolarHBondContact O-N 3.38Å; L94-Y97 PolarHBondContact O-N 3.14Å; L94-H98 WeakPolarHBondContact O-CB 3.36Å; L94-H98 PolarHBondContact O-N 2.89Å
95	K	98	Very high	97.2	Very high	131 Å²	131	72.3 Å²	72.3	57%	0.57	34%	0.339	S	S	*	.	H	α-helix	trans	-60.7	-41.7	173.2	-74.7	171	-176.2	171.6	0	111.2	E91 T92 H98 K99	E91-K95 WeakPolarHBondContact O-CG 3.36Å; E91-K95 PolarHBondContact O-N 3.43Å; T92-K95 WeakPolarHBondContact O-CB 3.4Å; T92-K95 PolarHBondContact O-N 2.96Å; K95-H98 PolarHBondContact O-N 3.32Å; K95-K99 WeakPolarHBondContact O-CG 3.4Å; K95-K99 PolarHBondContact O-N 3.15Å
96	D	97.8	Very high	97.1	Very high	81 Å²	81	77 Å²	77	43%	0.433	35%	0.352	S	S	.	.	H	α-helix	trans	-69.2	-41	178.8	-68.4	-20.8	0	0	0	112	T92 L93 L94 H98 K99 K100	T92-D96 PolarHBondContact O-N 3.09Å; L93-D96 PolarHBondContact O-N 3.42Å; L94-D96 VanDerWaalsContact C-N 3.3Å; L94-D96 PolarHBondContact O-N 3.38Å; D96-H98 VanDerWaalsContact C-N 3.32Å; D96-H98 PolarHBondContact O-N 3.01Å; D96-K99 PolarHBondContact O-N 3.38Å; D96-K100 WeakPolarHBondContact O-CB 3.39Å; D96-K100 PolarHBondContact O-N 3.39Å
97	Y	97.8	Very high	97	Very high	46 Å²	46	78.4 Å²	78.4	18%	0.18	36%	0.363	C	S	.	.	H	α-helix	trans	-63.4	-37.2	172.7	-68.8	-35	0	0	0	113	T19 D22 V23 L93 L94 K100 S101	T19-Y97 HydrophobicContact CG2-CD1 4.29Å; D22-Y97 HydrophobicContact CB-CE1 4.26Å; D22-Y97 HydrophobicContact CB-CE2 3.91Å; V23-Y97 HydrophobicContact CG2-CD2 4.09Å; V23-Y97 HydrophobicContact CG2-CG 4.11Å; L93-Y97 HydrophobicContact CD1-CE1 4.2Å; L93-Y97 HydrophobicContact CD1-CE2 3.9Å; L93-Y97 HydrophobicContact CD2-CE2 3.72Å; L93-Y97 HydrophobicContact CG-CD2 4.02Å; L93-Y97 HydrophobicContact CG-CE2 3.42Å; L93-Y97 VanDerWaalsContact CG-CE2 3.42Å; L93-Y97 WeakPolarHBondContact O-CD2 3.36Å; L93-Y97 PolarHBondContact O-N 3.47Å; L94-Y97 PolarHBondContact O-N 3.14Å; Y97-K100 PolarHBondContact O-N 2.89Å; Y97-S101 VanDerWaalsContact O-CB 3.24Å; Y97-S101 WeakPolarHBondContact O-CB 3.47Å; Y97-S101 PolarHBondContact O-N 2.86Å
98	H	95.3	Very high	96.9	Very high	118 Å²	118	78.3 Å²	78.3	55%	0.546	36%	0.363	S	S	.	.	H	α-helix	trans	-62.4	-48.4	175.1	-172.6	-75.4	0	0	0	111.1	L94 K95 D96 K100 S101 E102	L94-H98 WeakPolarHBondContact O-CB 3.36Å; L94-H98 PolarHBondContact O-N 2.89Å; K95-H98 PolarHBondContact O-N 3.32Å; D96-H98 VanDerWaalsContact C-N 3.32Å; D96-H98 PolarHBondContact O-N 3.01Å; H98-K100 VanDerWaalsContact C-N 3.33Å; H98-K100 PolarHBondContact O-N 2.92Å; H98-S101 WeakPolarHBondContact O-CB 3.23Å; H98-S101 PolarHBondContact O-N 3.4Å; H98-E102 PolarHBondContact O-N 2.71Å
99	K	97.3	Very high	96.7	Very high	126 Å²	126	76.3 Å²	76.3	55%	0.548	36%	0.358	S	S	.	.	H	α-helix	trans	-58.3	-45.9	175.5	-70.2	171.7	-175.3	169.8	0	111.7	K95 D96 E102 Q103	K95-K99 WeakPolarHBondContact O-CG 3.4Å; K95-K99 PolarHBondContact O-N 3.15Å; D96-K99 PolarHBondContact O-N 3.38Å; K99-E102 PolarHBondContact O-N 3.28Å; K99-Q103 WeakPolarHBondContact O-CG 3.38Å; K99-Q103 PolarHBondContact O-N 3.31Å; K99-Q103 VanDerWaalsContact O-N 3.09Å
100	K	96.8	Very high	96.6	Very high	88 Å²	88	73.5 Å²	73.5	38%	0.383	36%	0.356	S	S	.	.	H	α-helix	trans	-60.8	-45.4	176.9	-176.2	-179.6	179.1	-168.8	0	111.1	T19 D96 Y97 H98 E102 Q103 Q104	T19-K100 HydrophobicContact CG2-CD 4.25Å; T19-K100 HydrophobicContact CG2-CG 4.48Å; T19-K100 WeakPolarHBondContact OG1-CE 3.4Å; D96-K100 WeakPolarHBondContact O-CB 3.39Å; D96-K100 PolarHBondContact O-N 3.39Å; Y97-K100 PolarHBondContact O-N 2.89Å; H98-K100 VanDerWaalsContact C-N 3.33Å; H98-K100 PolarHBondContact O-N 2.92Å; K100-E102 VanDerWaalsContact C-N 3.34Å; K100-E102 PolarHBondContact O-N 3.1Å; K100-Q103 PolarHBondContact O-N 3.43Å; K100-Q104 HydrophobicContact CG-CG 4.37Å; K100-Q104 WeakPolarHBondContact O-CB 3.44Å; K100-Q104 WeakPolarHBondContact O-CG 3.35Å; K100-Q104 PolarHBondContact O-N 3.39Å
101	S	95.3	Very high	96.4	Very high	10 Å²	10	72.5 Å²	72.5	7%	0.07	35%	0.353	C	S	.	.	H	α-helix	trans	-59	-44	178.4	-176.1	0	0	0	0	111.8	Y16 Q20 Y97 H98 Q104 R105	Y16-S101 VanDerWaalsContact CE2-OG 3.28Å; Y16-S101 WeakPolarHBondContact CE2-OG 3.22Å; Q20-S101 PolarHBondContact NE2-OG 2.81Å; Q20-S101 VanDerWaalsContact NE2-OG 3.13Å; Y97-S101 VanDerWaalsContact O-CB 3.24Å; Y97-S101 WeakPolarHBondContact O-CB 3.47Å; Y97-S101 PolarHBondContact O-N 2.86Å; H98-S101 WeakPolarHBondContact O-CB 3.23Å; H98-S101 PolarHBondContact O-N 3.4Å; S101-Q104 PolarHBondContact O-N 3.32Å; S101-R105 WeakPolarHBondContact O-CB 3.44Å; S101-R105 PolarHBondContact O-N 2.95Å
102	E	96	Very high	96.1	Very high	56 Å²	56	73.3 Å²	73.3	26%	0.262	36%	0.357	S	S	.	.	H	α-helix	trans	-63.3	-46.9	176.9	-72.1	-54.1	119.7	0	0	112.3	H98 K99 K100 Q104 R105 E106	H98-E102 PolarHBondContact O-N 2.71Å; K99-E102 PolarHBondContact O-N 3.28Å; K100-E102 VanDerWaalsContact C-N 3.34Å; K100-E102 PolarHBondContact O-N 3.1Å; E102-Q104 VanDerWaalsContact C-N 3.32Å; E102-Q104 PolarHBondContact O-N 3.5Å; E102-R105 WeakPolarHBondContact O-CB 3.36Å; E102-R105 PolarHBondContact O-N 3.27Å; E102-R105 VanDerWaalsContact O-N 3.14Å; E102-R105 IonicContact OE1-NE 3.74Å; E102-R105 IonicContact OE1-NH2 3.77Å; E102-R105 IonicContact OE2-CZ 2.71Å; E102-R105 IonicContact OE2-NE 3.96Å; E102-R105 PolarHBondContact OE2-NE 3.48Å; E102-R105 IonicContact OE2-NH2 3.28Å; E102-R105 PolarHBondContact OE2-NH2 3.44Å; E102-E106 PolarHBondContact O-N 2.95Å
103	Q	96.4	Very high	95.8	Very high	127 Å²	127	74.2 Å²	74.2	59%	0.593	36%	0.356	S	S	*	.	H	α-helix	trans	-59.4	-43.3	176.2	-70.4	172.8	-13.8	0	0	112	K99 K100 R105 E106 V107	K99-Q103 WeakPolarHBondContact O-CG 3.38Å; K99-Q103 PolarHBondContact O-N 3.31Å; K99-Q103 VanDerWaalsContact O-N 3.09Å; K100-Q103 PolarHBondContact O-N 3.43Å; Q103-R105 VanDerWaalsContact C-N 3.31Å; Q103-R105 PolarHBondContact O-N 2.94Å; Q103-E106 PolarHBondContact O-N 3.47Å; Q103-V107 WeakPolarHBondContact O-CG2 3.38Å; Q103-V107 PolarHBondContact O-N 3.38Å; Q103-V107 VanDerWaalsContact O-N 3.09Å
104	Q	95.8	Very high	95.5	Very high	10 Å²	10	74.8 Å²	74.8	5%	0.047	36%	0.359	C	S	.	.	H	α-helix	trans	-64.7	-38	177.5	-69.5	-173.6	-61.2	0	0	111.7	E12 Y16 T19 K100 S101 E102 V107 L108	E12-Q104 WeakPolarHBondContact OE1-CG 3.37Å; E12-Q104 PolarHBondContact OE1-NE2 3.46Å; Y16-Q104 HydrophobicContact CD2-CB 3.89Å; T19-Q104 PolarHBondContact OG1-OE1 3Å; K100-Q104 HydrophobicContact CG-CG 4.37Å; K100-Q104 WeakPolarHBondContact O-CB 3.44Å; K100-Q104 WeakPolarHBondContact O-CG 3.35Å; K100-Q104 PolarHBondContact O-N 3.39Å; S101-Q104 PolarHBondContact O-N 3.32Å; E102-Q104 VanDerWaalsContact C-N 3.32Å; E102-Q104 PolarHBondContact O-N 3.5Å; Q104-V107 PolarHBondContact O-N 2.94Å; Q104-L108 WeakPolarHBondContact O-CB 3.28Å; Q104-L108 VanDerWaalsContact O-CG 3.22Å; Q104-L108 WeakPolarHBondContact O-CG 3.36Å; Q104-L108 PolarHBondContact O-N 3.36Å
105	R	94.9	Very high	95.1	Very high	130 Å²	130	74.7 Å²	74.7	49%	0.491	36%	0.359	S	S	.	.	H	α-helix	trans	-62.7	-45.3	176.3	-171.3	175.5	70.6	133.9	-0.4	111.4	S101 E102 Q103 L108 T109	S101-R105 WeakPolarHBondContact O-CB 3.44Å; S101-R105 PolarHBondContact O-N 2.95Å; E102-R105 WeakPolarHBondContact O-CB 3.36Å; E102-R105 PolarHBondContact O-N 3.27Å; E102-R105 VanDerWaalsContact O-N 3.14Å; E102-R105 IonicContact OE1-NE 3.74Å; E102-R105 IonicContact OE1-NH2 3.77Å; E102-R105 IonicContact OE2-CZ 2.71Å; E102-R105 IonicContact OE2-NE 3.96Å; E102-R105 PolarHBondContact OE2-NE 3.48Å; E102-R105 IonicContact OE2-NH2 3.28Å; E102-R105 PolarHBondContact OE2-NH2 3.44Å; Q103-R105 VanDerWaalsContact C-N 3.31Å; Q103-R105 PolarHBondContact O-N 2.94Å; R105-L108 PolarHBondContact O-N 3.38Å; R105-T109 PolarHBondContact O-N 2.91Å; R105-T109 PolarHBondContact O-OG1 3.21Å; R105-T109 VanDerWaalsContact O-OG1 3.1Å
106	E	96.4	Very high	94.6	Very high	131 Å²	131	74.1 Å²	74.1	61%	0.612	36%	0.358	S	S	*	.	H	α-helix	trans	-60	-46.6	176	-70.4	175.2	-177.6	0	0	112	E102 Q103 L108 T109 S110	E102-E106 PolarHBondContact O-N 2.95Å; Q103-E106 PolarHBondContact O-N 3.47Å; E106-L108 PolarHBondContact O-N 3.3Å; E106-T109 PolarHBondContact O-N 3.5Å; E106-S110 PolarHBondContact O-N 2.96Å
107	V	95.8	Very high	94.1	Very high	68 Å²	68	77.2 Å²	77.2	41%	0.412	37%	0.368	S	S	.	.	H	α-helix	trans	-62.2	-43.1	177.1	174.3	0	0	0	0	111.1	E12 Q103 Q104 S110 L111	E12-V107 HydrophobicContact CG-CG1 4.05Å; Q103-V107 WeakPolarHBondContact O-CG2 3.38Å; Q103-V107 PolarHBondContact O-N 3.38Å; Q103-V107 VanDerWaalsContact O-N 3.09Å; Q104-V107 PolarHBondContact O-N 2.94Å; V107-S110 PolarHBondContact O-N 2.96Å; V107-L111 HydrophobicContact CG1-CD1 3.85Å; V107-L111 HydrophobicContact CG1-CG 4.32Å; V107-L111 WeakPolarHBondContact O-CB 3.46Å; V107-L111 VanDerWaalsContact O-CG 3.31Å; V107-L111 WeakPolarHBondContact O-CG 3.24Å; V107-L111 PolarHBondContact O-N 2.92Å
108	L	95.4	Very high	93.4	Very high	18 Å²	18	77.1 Å²	77.1	9%	0.094	38%	0.377	C	S	.	.	H	α-helix	trans	-60.9	-45.3	176.4	-77.1	171.6	0	0	0	111.7	L9 E12 V13 Y16 Q104 R105 E106 L111 Q112	L9-L108 HydrophobicContact CD1-CD2 3.75Å; E12-L108 HydrophobicContact CB-CD2 3.78Å; E12-L108 HydrophobicContact CB-CG 4.36Å; E12-L108 HydrophobicContact CG-CD2 4.08Å; E12-L108 HydrophobicContact CG-CG 4.1Å; V13-L108 HydrophobicContact CG2-CD2 3.61Å; Y16-L108 HydrophobicContact CD2-CD1 4.36Å; Y16-L108 HydrophobicContact CG-CD1 4.1Å; Q104-L108 WeakPolarHBondContact O-CB 3.28Å; Q104-L108 VanDerWaalsContact O-CG 3.22Å; Q104-L108 WeakPolarHBondContact O-CG 3.36Å; Q104-L108 PolarHBondContact O-N 3.36Å; R105-L108 PolarHBondContact O-N 3.38Å; E106-L108 PolarHBondContact O-N 3.3Å; L108-L111 PolarHBondContact O-N 3.22Å; L108-Q112 WeakPolarHBondContact O-CB 3.33Å; L108-Q112 VanDerWaalsContact O-CG 3.24Å; L108-Q112 WeakPolarHBondContact O-CG 3.31Å; L108-Q112 PolarHBondContact O-N 2.93Å
109	T	95.1	Very high	92.6	Very high	64 Å²	64	76.6 Å²	76.6	39%	0.393	37%	0.374	S	S	.	.	H	α-helix	trans	-61.3	-44.4	176.6	-61.4	0	0	0	0	111.5	R105 E106 Q112 Q113	R105-T109 PolarHBondContact O-N 2.91Å; R105-T109 PolarHBondContact O-OG1 3.21Å; R105-T109 VanDerWaalsContact O-OG1 3.1Å; E106-T109 PolarHBondContact O-N 3.5Å; T109-Q112 PolarHBondContact O-N 3.42Å; T109-Q113 WeakPolarHBondContact O-CG 3.36Å; T109-Q113 PolarHBondContact O-N 3.4Å
110	S	95.3	Very high	90.9	Very high	57 Å²	57	72.8 Å²	72.8	40%	0.399	37%	0.371	S	S	.	.	H	α-helix	trans	-61.7	-46.9	176.4	172.4	0	0	0	0	112	E106 V107 Q112 Q113 D114	E106-S110 PolarHBondContact O-N 2.96Å; V107-S110 PolarHBondContact O-N 2.96Å; S110-Q112 VanDerWaalsContact C-N 3.31Å; S110-Q112 PolarHBondContact O-N 3.33Å; S110-Q113 PolarHBondContact O-N 3.34Å; S110-D114 PolarHBondContact O-N 3.1Å
111	L	94.3	Very high	88.9	Confident	24 Å²	24	74.2 Å²	74.2	13%	0.126	38%	0.382	C	S	.	.	H	α-helix	trans	-63.2	-36.3	178.1	-72.1	171	0	0	0	112.5	I5 K8 L9 E12 V107 L108 D114 L115	I5-L111 HydrophobicContact CG2-CD2 4.36Å; K8-L111 HydrophobicContact CB-CD1 4.28Å; K8-L111 HydrophobicContact CB-CD2 4.28Å; L9-L111 HydrophobicContact CD1-CB 3.96Å; E12-L111 HydrophobicContact CB-CD1 4.47Å; V107-L111 HydrophobicContact CG1-CD1 3.85Å; V107-L111 HydrophobicContact CG1-CG 4.32Å; V107-L111 WeakPolarHBondContact O-CB 3.46Å; V107-L111 VanDerWaalsContact O-CG 3.31Å; V107-L111 WeakPolarHBondContact O-CG 3.24Å; V107-L111 PolarHBondContact O-N 2.92Å; L108-L111 PolarHBondContact O-N 3.22Å; L111-D114 PolarHBondContact O-N 3.34Å; L111-L115 WeakPolarHBondContact O-CB 3.44Å; L111-L115 PolarHBondContact O-N 3.5Å
112	Q	90.6	Very high	86.5	Confident	99 Å²	99	77 Å²	77	46%	0.463	40%	0.399	S	S	.	.	H	α-helix	trans	-64.9	-43.9	174.6	-75.7	173.4	-8.1	0	0	111.8	L9 L108 T109 S110 L115 Q116	L9-Q112 HydrophobicContact CD1-CG 3.93Å; L108-Q112 WeakPolarHBondContact O-CB 3.33Å; L108-Q112 VanDerWaalsContact O-CG 3.24Å; L108-Q112 WeakPolarHBondContact O-CG 3.31Å; L108-Q112 PolarHBondContact O-N 2.93Å; T109-Q112 PolarHBondContact O-N 3.42Å; S110-Q112 VanDerWaalsContact C-N 3.31Å; S110-Q112 PolarHBondContact O-N 3.33Å; Q112-L115 PolarHBondContact O-N 3.29Å; Q112-Q116 WeakPolarHBondContact O-CG 3.27Å; Q112-Q116 PolarHBondContact O-N 2.96Å; Q112-Q116 VanDerWaalsContact O-N 3.09Å
113	Q	92.4	Very high	84.4	Confident	98 Å²	98	80 Å²	80	46%	0.458	42%	0.423	S	S	.	.	H	α-helix	trans	-62.8	-42.8	176	-71.1	175.6	0.4	0	0	111.8	T109 S110 Q116 K117	T109-Q113 WeakPolarHBondContact O-CG 3.36Å; T109-Q113 PolarHBondContact O-N 3.4Å; S110-Q113 PolarHBondContact O-N 3.34Å; Q113-Q116 PolarHBondContact O-N 2.89Å; Q113-K117 WeakPolarHBondContact O-CG 3.36Å; Q113-K117 PolarHBondContact O-N 3.08Å; Q113-K117 VanDerWaalsContact O-N 3.08Å
114	D	90.2	Very high	82.1	Confident	62 Å²	62	76.3 Å²	76.3	33%	0.332	42%	0.419	S	S	.	.	H	α-helix	trans	-67.7	-36.5	179.1	-72.5	-13.7	0	0	0	112.2	I5 S110 L111 K117 A118	I5-D114 HydrophobicContact CD1-CB 4.34Å; S110-D114 PolarHBondContact O-N 3.1Å; L111-D114 PolarHBondContact O-N 3.34Å; D114-K117 PolarHBondContact O-N 3.34Å; D114-K117 IonicContact OD1-NZ 3.44Å; D114-A118 VanDerWaalsContact O-CB 3.27Å; D114-A118 WeakPolarHBondContact O-CB 3.45Å; D114-A118 PolarHBondContact O-N 3.04Å
115	L	90	Very high	79.8	Confident	24 Å²	24	82.4 Å²	82.4	13%	0.126	45%	0.446	C	S	.	.	H	α-helix	trans	-63.4	-43.3	174.1	-172.6	63.3	0	0	0	111.6	A2 I5 L9 L111 Q112 K117 A118 Q119	A2-L115 HydrophobicContact CB-CD1 4.47Å; I5-L115 HydrophobicContact CB-CD1 4.33Å; I5-L115 HydrophobicContact CG2-CB 3.86Å; I5-L115 HydrophobicContact CG2-CD1 4.11Å; L9-L115 HydrophobicContact CD2-CD2 4.15Å; L111-L115 WeakPolarHBondContact O-CB 3.44Å; L111-L115 PolarHBondContact O-N 3.5Å; Q112-L115 PolarHBondContact O-N 3.29Å; L115-K117 PolarHBondContact O-N 3.41Å; L115-A118 PolarHBondContact O-N 3.48Å; L115-Q119 HydrophobicContact CD1-CG 4.36Å; L115-Q119 WeakPolarHBondContact O-CB 3.36Å; L115-Q119 WeakPolarHBondContact O-CG 3.41Å; L115-Q119 PolarHBondContact O-N 3.09Å
116	Q	87.9	Confident	77.7	Confident	120 Å²	120	81.7 Å²	81.7	56%	0.561	45%	0.451	S	S	*	.	H	α-helix	trans	-60.6	-43.7	176.2	-73.6	176.2	0.4	0	0	112	Q112 Q113 Q119	Q112-Q116 WeakPolarHBondContact O-CG 3.27Å; Q112-Q116 PolarHBondContact O-N 2.96Å; Q112-Q116 VanDerWaalsContact O-N 3.09Å; Q113-Q116 PolarHBondContact O-N 2.89Å; Q116-Q119 PolarHBondContact O-N 3.2Å
117	K	87.6	Confident	75.4	Confident	146 Å²	146	84.9 Å²	84.9	64%	0.635	46%	0.457	S	S	*	.	H	α-helix	trans	-63.4	-44.8	175.5	-67.9	169.8	-170.3	164.6	0	111.5	Q113 D114 L115 Q119 G120	Q113-K117 WeakPolarHBondContact O-CG 3.36Å; Q113-K117 PolarHBondContact O-N 3.08Å; Q113-K117 VanDerWaalsContact O-N 3.08Å; D114-K117 PolarHBondContact O-N 3.34Å; D114-K117 IonicContact OD1-NZ 3.44Å; L115-K117 PolarHBondContact O-N 3.41Å; K117-Q119 VanDerWaalsContact C-N 3.32Å; K117-Q119 PolarHBondContact O-N 3.43Å; K117-G120 PolarHBondContact O-N 3.48Å
118	A	82.4	Confident	73.3	Confident	44 Å²	44	87.1 Å²	87.1	36%	0.364	47%	0.466	S	S	.	.	H	α-helix	trans	-68.2	-27.9	-178.7	0	0	0	0	0	113.5	A2 I5 D114 L115 G120	A2-A118 HydrophobicContact CB-CB 4.47Å; I5-A118 HydrophobicContact CD1-CB 4.1Å; D114-A118 VanDerWaalsContact O-CB 3.27Å; D114-A118 WeakPolarHBondContact O-CB 3.45Å; D114-A118 PolarHBondContact O-N 3.04Å; L115-A118 PolarHBondContact O-N 3.48Å; A118-G120 VanDerWaalsContact C-N 3.28Å
119	Q	78	Confident	71.3	Confident	106 Å²	106	90.9 Å²	90.9	50%	0.495	49%	0.49	S	S	.	.	T	Hydrogen-bonded Turn	trans	-82.9	-0.5	175.8	-71.7	179.4	-13.1	0	0	113.5	L115 Q116 K117 L121	L115-Q119 HydrophobicContact CD1-CG 4.36Å; L115-Q119 WeakPolarHBondContact O-CB 3.36Å; L115-Q119 WeakPolarHBondContact O-CG 3.41Å; L115-Q119 PolarHBondContact O-N 3.09Å; Q116-Q119 PolarHBondContact O-N 3.2Å; K117-Q119 VanDerWaalsContact C-N 3.32Å; K117-Q119 PolarHBondContact O-N 3.43Å; Q119-L121 HydrophobicContact CB-CD1 4.47Å; Q119-L121 PolarHBondContact O-N 2.81Å
120	G	62.3	Low	69.2	Low	47 Å²	47	97.8 Å²	97.8	49%	0.485	51%	0.509	S	S	.	.	T	Hydrogen-bonded Turn	trans	66.3	18.6	173.9	0	0	0	0	0	114.6	K117 A118 T122	K117-G120 PolarHBondContact O-N 3.48Å; A118-G120 VanDerWaalsContact C-N 3.28Å; G120-T122 PolarHBondContact O-N 3.19Å
121	L	55.2	Low	67.1	Low	118 Å²	118	100.1 Å²	100.1	62%	0.618	52%	0.516	S	S	*	.			trans	-72.8	66.7	173.2	-75	163.3	0	0	0	110.1	Q119	Q119-L121 HydrophobicContact CB-CD1 4.47Å; Q119-L121 PolarHBondContact O-N 2.81Å
122	T	44.7	Very low	65	Low	67 Å²	67	105.9 Å²	105.9	41%	0.411	54%	0.542	S	S	.	.			trans	-83.2	121.5	161.4	39.9	0	0	0	0	108.6	G120 G124 K125	G120-T122 PolarHBondContact O-N 3.19Å; T122-G124 PolarHBondContact O-N 3.23Å; T122-K125 PolarHBondContact O-N 2.96Å; T122-K125 WeakPolarHBondContact OG1-CD 3.42Å; T122-K125 WeakPolarHBondContact OG1-CG 3.36Å
123	P	51.6	Low	63.1	Low	119 Å²	119	110.6 Å²	110.6	77%	0.773	56%	0.556	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.8	-22.2	177.9	-27.9	34.9	0	0	0	114.6
124	G	49.2	Very low	61.2	Low	50 Å²	50	113.6 Å²	113.6	52%	0.515	57%	0.57	S	S	.	*	T	Hydrogen-bonded Turn	trans	-82.1	-18	-177.5	0	0	0	0	0	116.9	T122	T122-G124 PolarHBondContact O-N 3.23Å
125	K	45.8	Very low	59.4	Low	139 Å²	139	119.7 Å²	119.7	60%	0.604	59%	0.593	S	S	*	*	H	α-helix	trans	-85.6	-21.7	-174.5	-74.1	-177.2	-177.1	176.1	0	114.1	T122 T129	T122-K125 PolarHBondContact O-N 2.96Å; T122-K125 WeakPolarHBondContact OG1-CD 3.42Å; T122-K125 WeakPolarHBondContact OG1-CG 3.36Å; K125-T129 PolarHBondContact O-N 2.75Å; K125-T129 PolarHBondContact O-OG1 3.4Å
126	I	52.3	Low	57.7	Low	115 Å²	115	122.9 Å²	122.9	59%	0.59	62%	0.618	S	S	*	*	H	α-helix	trans	-68.2	-37.1	178.9	-60.3	171.8	0	0	0	110.7	R130	I126-R130 PolarHBondContact O-N 3.48Å
127	W	48	Very low	56	Low	197 Å²	197	120.5 Å²	120.5	75%	0.746	63%	0.625	S	S	*	*	H	α-helix	trans	-69.9	-43	178	-90.7	81.9	0	0	0	113.4	T129 R130 L131	W127-T129 PolarHBondContact O-N 3.31Å; W127-R130 PolarHBondContact O-N 3.06Å; W127-L131 HydrophobicContact CE3-CD1 4.47Å; W127-L131 PolarHBondContact O-N 3.27Å
128	L	51.6	Low	54.5	Low	115 Å²	115	122.9 Å²	122.9	60%	0.602	64%	0.635	S	S	*	*	H	α-helix	trans	-66.6	-37.7	-179.9	-83.7	156.2	0	0	0	112.5	R130 L131 Q132	L128-R130 VanDerWaalsContact C-N 3.29Å; L128-R130 PolarHBondContact O-N 3.24Å; L128-L131 PolarHBondContact O-N 3.45Å; L128-Q132 PolarHBondContact O-N 3.39Å
129	T	52.8	Low	53	Low	97 Å²	97	126.2 Å²	126.2	60%	0.595	66%	0.656	S	S	*	*	H	α-helix	trans	-70.2	-27.4	179.3	-40.1	0	0	0	0	111.9	K125 W127	K125-T129 PolarHBondContact O-N 2.75Å; K125-T129 PolarHBondContact O-OG1 3.4Å; W127-T129 PolarHBondContact O-N 3.31Å
130	R	51.6	Low	51.8	Low	210 Å²	210	124.6 Å²	124.6	79%	0.792	67%	0.668	S	S	*	*	H	α-helix	trans	-82.8	-33.3	177	-160.7	165.2	-159.5	156.2	4.7	113	I126 W127 L128	I126-R130 PolarHBondContact O-N 3.48Å; W127-R130 PolarHBondContact O-N 3.06Å; L128-R130 VanDerWaalsContact C-N 3.29Å; L128-R130 PolarHBondContact O-N 3.24Å
131	L	50.3	Low	50.7	Low	106 Å²	106	131.8 Å²	131.8	56%	0.555	69%	0.689	S	S	*	*	H	α-helix	trans	-71.5	-33.4	178	-129.7	86.4	0	0	0	112.9	W127 L128 R133 H134	W127-L131 HydrophobicContact CE3-CD1 4.47Å; W127-L131 PolarHBondContact O-N 3.27Å; L128-L131 PolarHBondContact O-N 3.45Å; L131-R133 VanDerWaalsContact C-N 3.35Å; L131-R133 PolarHBondContact O-N 3.45Å; L131-H134 PolarHBondContact O-N 3.47Å
132	Q	50.3	Low	50	Low	144 Å²	144	131.6 Å²	131.6	67%	0.673	70%	0.698	S	S	*	*	H	α-helix	trans	-68.2	-33.2	-179.5	-144	104.8	-35.1	0	0	112.5	L128	L128-Q132 PolarHBondContact O-N 3.39Å
133	R	50.7	Low	49.8	Very low	199 Å²	199	141.4 Å²	141.4	75%	0.751	74%	0.738	S	S	*	*	H	α-helix	trans	-73.4	-25.4	-179.9	-167.6	178.2	-65	-154.5	-1.3	113.3	L131 S136	L131-R133 VanDerWaalsContact C-N 3.35Å; L131-R133 PolarHBondContact O-N 3.45Å; R133-S136 PolarHBondContact O-OG 3.32Å
134	H	52.7	Low	49.7	Very low	160 Å²	160	142.6 Å²	142.6	74%	0.741	74%	0.737	S	S	*	*	H	α-helix	trans	-84.7	-16.7	-178.5	-148.8	-64.1	0	0	0	113.2	L131	L131-H134 PolarHBondContact O-N 3.47Å
135	K	52.6	Low	49.7	Very low	190 Å²	190	147.4 Å²	147.4	83%	0.826	75%	0.748	S	S	*	*	H	α-helix	trans	-87.1	-18.5	174.6	-84.6	-169.4	174.1	-174.3	0	114
136	S	54.4	Low	49.9	Very low	92 Å²	92	147.9 Å²	147.9	64%	0.643	76%	0.756	S	S	*	*	S	Bend	trans	-92.9	-3.3	-179.6	61.6	0	0	0	0	114.8	R133	R133-S136 PolarHBondContact O-OG 3.32Å
137	G	53	Low	49.8	Very low	69 Å²	69	149.8 Å²	149.8	71%	0.711	77%	0.766	S	S	*	*	S	Bend	trans	-105.4	17.5	-174.7	0	0	0	0	0	115.9
138	K	54.7	Low	49.9	Very low	196 Å²	196	146.9 Å²	146.9	85%	0.852	77%	0.767	S	S	*	*	S	Bend	trans	-123.3	21.5	-175	-119.7	-173.9	-175.6	-171.6	0	115.4
139	S	51.8	Low	49.8	Very low	114 Å²	114	149 Å²	149	80%	0.797	78%	0.778	S	S	*	*	S	Bend	trans	-133.6	96.4	173.1	60.1	0	0	0	0	110.5
140	G	51.4	Low	49.6	Very low	73 Å²	73	152.7 Å²	152.7	75%	0.753	79%	0.792	S	S	*	*			trans	134	78.6	166.9	0	0	0	0	0	113.4
141	E	39.6	Very low	49.4	Very low	198 Å²	198	148.3 Å²	148.3	93%	0.925	79%	0.791	S	S	*	*			trans	-176.3	81.1	135.6	-101.8	171.1	167.1	0	0	107.5
142	S	41.2	Very low	49.4	Very low	114 Å²	114	151.8 Å²	151.8	80%	0.797	81%	0.811	S	S	*	*			trans	-115.4	114.6	151	-50.2	0	0	0	0	103.7
143	H	40.1	Very low	49.3	Very low	273 Å²	273	152.5 Å²	152.5	100%	1.264	82%	0.824	S	S	*	*			trans	-179.1	0	141	-95.6	68.2	0	0	0	107.2

Retrieved 143 of 143 residues in 327.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).