A0A087X5Q2_POEFO Loading...

Prefoldin subunit 6

Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.

AlphaFold DB , UniProt , Accession A0A087X5Q2, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 126 aa.

						>A0A087X5Q2_POEFO|A0A087X5Q2
MAEAIQKKLKAEVEKYTQTQKDVSKSVSARQKLETQMAENNIVKEELDLLDSSNTVFKLIGPVLVKQDLDEAKATVAKRLEYINGEIQRYETLLKDYHKKSEQQREVLTSLQQDLQKAQGLTPGKV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	71.2	Confident	90.2	Very high	194 Å²	194	99.5 Å²	99.5	96%	0.956	50%	0.501	S	S	*	.				0	-54.1	0	-165.4	174.5	-81.7	0	0	111.5	E3 A4 I5	M1-E3 PolarHBondContact O-N 3.42Å; M1-A4 PolarHBondContact O-N 3.07Å; M1-I5 HydrophobicContact CG-CD1 4.42Å; M1-I5 PolarHBondContact O-N 2.93Å
2	A	82.5	Confident	90.7	Very high	30 Å²	30	93.3 Å²	93.3	25%	0.248	47%	0.469	C	S	.	.	H	α-helix	trans	-58.1	-41.1	177.9	0	0	0	0	0	114.6	A4 I5 Q6 L115 A118	A2-A4 PolarHBondContact O-N 3.12Å; A2-I5 PolarHBondContact O-N 3.29Å; A2-Q6 PolarHBondContact O-N 3.33Å; A2-L115 HydrophobicContact CB-CD1 4.37Å; A2-A118 HydrophobicContact CB-CB 4.33Å
3	E	88.5	Confident	91.2	Very high	159 Å²	159	91.2 Å²	91.2	74%	0.743	46%	0.464	S	S	*	.	H	α-helix	trans	-63.2	-38.4	179.9	-168.1	-179.1	179.8	0	0	113.1	M1 Q6 K7	M1-E3 PolarHBondContact O-N 3.42Å; E3-Q6 PolarHBondContact O-N 2.89Å; E3-K7 PolarHBondContact O-N 2.56Å
4	A	91.1	Very high	91.6	Very high	60 Å²	60	92.8 Å²	92.8	50%	0.496	47%	0.469	S	S	.	.	H	α-helix	trans	-66.9	-37.7	175.9	0	0	0	0	0	112	M1 A2 K8	M1-A4 PolarHBondContact O-N 3.07Å; A2-A4 PolarHBondContact O-N 3.12Å; A4-K8 WeakPolarHBondContact O-CG 3.4Å; A4-K8 PolarHBondContact O-N 2.7Å; A4-K8 VanDerWaalsContact O-N 3.1Å
5	I	91.3	Very high	91.9	Very high	26 Å²	26	93.8 Å²	93.8	13%	0.133	47%	0.469	C	S	.	.	H	α-helix	trans	-66.3	-44.1	174.8	-63.2	168.2	0	0	0	109.9	M1 A2 K7 K8 L9 L111 D114 L115 A118	M1-I5 HydrophobicContact CG-CD1 4.42Å; M1-I5 PolarHBondContact O-N 2.93Å; A2-I5 PolarHBondContact O-N 3.29Å; I5-K7 PolarHBondContact O-N 2.78Å; I5-K8 PolarHBondContact O-N 3.4Å; I5-L9 WeakPolarHBondContact O-CB 3.48Å; I5-L9 PolarHBondContact O-N 2.94Å; I5-L111 HydrophobicContact CG2-CD2 4.34Å; I5-D114 HydrophobicContact CD1-CB 4.3Å; I5-L115 HydrophobicContact CB-CD1 4.33Å; I5-L115 HydrophobicContact CG2-CB 3.84Å; I5-L115 HydrophobicContact CG2-CD1 4.14Å; I5-A118 HydrophobicContact CD1-CB 4.04Å
6	Q	91.4	Very high	92.2	Very high	114 Å²	114	92 Å²	92	53%	0.533	46%	0.455	S	S	.	.	H	α-helix	trans	-61.2	-41.8	177.2	-169.9	178	9.7	0	0	112.2	A2 E3 L9 K10	A2-Q6 PolarHBondContact O-N 3.33Å; E3-Q6 PolarHBondContact O-N 2.89Å; Q6-L9 PolarHBondContact O-N 2.93Å; Q6-K10 PolarHBondContact O-N 3.48Å
7	K	94.9	Very high	92.5	Very high	168 Å²	168	90.3 Å²	90.3	73%	0.73	45%	0.451	S	S	*	.	H	α-helix	trans	-63.1	-43.4	175.3	-171.7	176.3	-178.7	178	0	112	E3 I5 A11	E3-K7 PolarHBondContact O-N 2.56Å; I5-K7 PolarHBondContact O-N 2.78Å; K7-A11 PolarHBondContact O-N 3.36Å; K7-A11 VanDerWaalsContact O-N 3.12Å
8	K	94.8	Very high	92.8	Very high	139 Å²	139	89.9 Å²	89.9	60%	0.604	45%	0.448	S	S	*	.	H	α-helix	trans	-63.5	-43.6	175.2	-75	-177.3	179.2	-175.4	0	111.9	A4 I5 K10 A11 E12 L111	A4-K8 WeakPolarHBondContact O-CG 3.4Å; A4-K8 PolarHBondContact O-N 2.7Å; A4-K8 VanDerWaalsContact O-N 3.1Å; I5-K8 PolarHBondContact O-N 3.4Å; K8-K10 PolarHBondContact O-N 2.87Å; K8-A11 PolarHBondContact O-N 2.97Å; K8-E12 PolarHBondContact O-N 3.29Å; K8-L111 HydrophobicContact CB-CD1 4.27Å; K8-L111 HydrophobicContact CB-CD2 4.23Å
9	L	94.7	Very high	93	Very high	28 Å²	28	85.2 Å²	85.2	15%	0.147	42%	0.424	C	S	.	.	H	α-helix	trans	-59.1	-48.4	177.7	-177.5	69.3	0	0	0	111	I5 Q6 A11 E12 V13 L108 L111 Q112 L115	I5-L9 WeakPolarHBondContact O-CB 3.48Å; I5-L9 PolarHBondContact O-N 2.94Å; Q6-L9 PolarHBondContact O-N 2.93Å; L9-A11 PolarHBondContact O-N 3.07Å; L9-E12 PolarHBondContact O-N 2.91Å; L9-V13 WeakPolarHBondContact O-CG2 2.89Å; L9-V13 PolarHBondContact O-N 2.8Å; L9-L108 HydrophobicContact CD1-CD2 3.75Å; L9-L111 HydrophobicContact CD1-CB 3.89Å; L9-Q112 HydrophobicContact CD1-CG 3.89Å; L9-Q112 HydrophobicContact CD2-CG 4.44Å; L9-L115 HydrophobicContact CD2-CD2 4.05Å
10	K	95	Very high	93.2	Very high	137 Å²	137	84.8 Å²	84.8	60%	0.596	42%	0.421	S	S	*	.	H	α-helix	trans	-58.3	-47.4	177.3	-175.6	179.4	175.7	-176.7	0	111.8	Q6 K8 E12 V13 E14	Q6-K10 PolarHBondContact O-N 3.48Å; K8-K10 PolarHBondContact O-N 2.87Å; K10-E12 VanDerWaalsContact C-N 3.31Å; K10-E12 PolarHBondContact O-N 3.28Å; K10-V13 PolarHBondContact O-N 3.37Å; K10-E14 WeakPolarHBondContact CE-OE1 3.17Å; K10-E14 WeakPolarHBondContact O-CG 3.46Å; K10-E14 PolarHBondContact O-N 3.06Å
11	A	96.6	Very high	93.5	Very high	40 Å²	40	86.1 Å²	86.1	33%	0.331	42%	0.424	S	S	.	.	H	α-helix	trans	-61.2	-39.9	178.5	0	0	0	0	0	112	K7 K8 L9 E14 K15	K7-A11 PolarHBondContact O-N 3.36Å; K7-A11 VanDerWaalsContact O-N 3.12Å; K8-A11 PolarHBondContact O-N 2.97Å; L9-A11 PolarHBondContact O-N 3.07Å; A11-E14 PolarHBondContact O-N 3.47Å; A11-K15 WeakPolarHBondContact O-CG 3.43Å; A11-K15 PolarHBondContact O-N 2.89Å; A11-K15 VanDerWaalsContact O-N 3.11Å
12	E	96.8	Very high	94.7	Very high	25 Å²	25	78.5 Å²	78.5	12%	0.117	39%	0.387	C	S	.	.	H	α-helix	trans	-72.4	-34.5	179.4	-156.6	57	-131.1	0	0	112.4	K8 L9 K10 K15 Y16 Q104 V107 L108 L111	K8-E12 PolarHBondContact O-N 3.29Å; L9-E12 PolarHBondContact O-N 2.91Å; K10-E12 VanDerWaalsContact C-N 3.31Å; K10-E12 PolarHBondContact O-N 3.28Å; E12-K15 PolarHBondContact O-N 2.81Å; E12-K15 IonicContact OE2-NZ 3.45Å; E12-K15 PolarHBondContact OE2-NZ 2.85Å; E12-Y16 WeakPolarHBondContact O-CB 3.37Å; E12-Y16 PolarHBondContact O-N 2.89Å; E12-Q104 WeakPolarHBondContact OE1-CG 3.39Å; E12-Q104 PolarHBondContact OE1-NE2 3.41Å; E12-Q104 VanDerWaalsContact OE1-NE2 3.08Å; E12-V107 HydrophobicContact CG-CB 4.47Å; E12-V107 HydrophobicContact CG-CG1 4.02Å; E12-L108 HydrophobicContact CB-CD2 3.79Å; E12-L108 HydrophobicContact CB-CG 4.36Å; E12-L108 HydrophobicContact CG-CD2 4.07Å; E12-L108 HydrophobicContact CG-CG 4.07Å; E12-L111 HydrophobicContact CB-CD1 4.38Å
13	V	96.5	Very high	95.5	Very high	65 Å²	65	78.8 Å²	78.8	39%	0.394	39%	0.386	S	S	.	.	H	α-helix	trans	-62.3	-42.5	171.7	169.6	0	0	0	0	111.2	L9 K10 Y16 T17 L108	L9-V13 WeakPolarHBondContact O-CG2 2.89Å; L9-V13 PolarHBondContact O-N 2.8Å; K10-V13 PolarHBondContact O-N 3.37Å; V13-Y16 PolarHBondContact O-N 3.09Å; V13-T17 WeakPolarHBondContact O-CB 3.45Å; V13-T17 PolarHBondContact O-N 2.62Å; V13-T17 PolarHBondContact O-OG1 2.93Å; V13-L108 HydrophobicContact CG2-CD2 3.57Å
14	E	97.2	Very high	95.9	Very high	114 Å²	114	74.7 Å²	74.7	53%	0.533	38%	0.375	S	S	.	.	H	α-helix	trans	-61.4	-45.6	176.8	-74.5	171	-174.2	0	0	111.2	K10 A11 T17 Q18	K10-E14 WeakPolarHBondContact CE-OE1 3.17Å; K10-E14 WeakPolarHBondContact O-CG 3.46Å; K10-E14 PolarHBondContact O-N 3.06Å; A11-E14 PolarHBondContact O-N 3.47Å; E14-T17 PolarHBondContact O-N 3.25Å; E14-Q18 PolarHBondContact O-N 3.41Å
15	K	96.6	Very high	96.2	Very high	108 Å²	108	78.2 Å²	78.2	47%	0.47	38%	0.379	S	S	.	.	H	α-helix	trans	-64.6	-43.2	176.2	-64.5	174	-167.2	163.5	0	112.5	A11 E12 T17 Q18 T19	A11-K15 WeakPolarHBondContact O-CG 3.43Å; A11-K15 PolarHBondContact O-N 2.89Å; A11-K15 VanDerWaalsContact O-N 3.11Å; E12-K15 PolarHBondContact O-N 2.81Å; E12-K15 IonicContact OE2-NZ 3.45Å; E12-K15 PolarHBondContact OE2-NZ 2.85Å; K15-T17 VanDerWaalsContact C-N 3.34Å; K15-Q18 WeakPolarHBondContact O-CB 3.43Å; K15-Q18 PolarHBondContact O-N 3.17Å; K15-T19 PolarHBondContact O-N 3.14Å; K15-T19 PolarHBondContact O-OG1 3.47Å
16	Y	96.8	Very high	96.6	Very high	65 Å²	65	77.2 Å²	77.2	26%	0.255	38%	0.375	S	S	.	.	H	α-helix	trans	-60.8	-45.9	177.2	-179.3	-97.9	0	0	0	110.8	E12 V13 Q18 T19 Q20 S101 Q104 L108	E12-Y16 WeakPolarHBondContact O-CB 3.37Å; E12-Y16 PolarHBondContact O-N 2.89Å; V13-Y16 PolarHBondContact O-N 3.09Å; Y16-Q18 VanDerWaalsContact C-N 3.25Å; Y16-Q18 PolarHBondContact O-N 3.26Å; Y16-T19 WeakPolarHBondContact O-CB 3.48Å; Y16-T19 PolarHBondContact O-N 3.35Å; Y16-T19 VanDerWaalsContact O-N 3.13Å; Y16-Q20 HydrophobicContact CD1-CG 4.1Å; Y16-Q20 HydrophobicContact CE1-CG 3.75Å; Y16-Q20 WeakPolarHBondContact O-CG 3.34Å; Y16-Q20 PolarHBondContact O-N 2.84Å; Y16-S101 WeakPolarHBondContact CE2-OG 3.4Å; Y16-Q104 HydrophobicContact CD2-CB 3.86Å; Y16-L108 HydrophobicContact CD1-CD1 4.5Å; Y16-L108 HydrophobicContact CD2-CD1 4.33Å; Y16-L108 HydrophobicContact CG-CD1 4.02Å
17	T	96.8	Very high	96.9	Very high	63 Å²	63	74 Å²	74	39%	0.387	36%	0.362	S	S	.	.	H	α-helix	trans	-58.3	-39.7	175.7	-57.6	0	0	0	0	111.4	V13 E14 K15 Q20 K21	V13-T17 WeakPolarHBondContact O-CB 3.45Å; V13-T17 PolarHBondContact O-N 2.62Å; V13-T17 PolarHBondContact O-OG1 2.93Å; E14-T17 PolarHBondContact O-N 3.25Å; K15-T17 VanDerWaalsContact C-N 3.34Å; T17-Q20 PolarHBondContact O-N 3.17Å; T17-K21 WeakPolarHBondContact O-CG 3.37Å; T17-K21 PolarHBondContact O-N 2.96Å; T17-K21 VanDerWaalsContact O-N 3.14Å
18	Q	97.3	Very high	97	Very high	83 Å²	83	69.1 Å²	69.1	39%	0.388	35%	0.35	S	S	.	.	H	α-helix	trans	-64.9	-47.2	174.9	-174.8	54.9	47.4	0	0	111.8	E14 K15 Y16 Q20 K21 D22	E14-Q18 PolarHBondContact O-N 3.41Å; K15-Q18 WeakPolarHBondContact O-CB 3.43Å; K15-Q18 PolarHBondContact O-N 3.17Å; Y16-Q18 VanDerWaalsContact C-N 3.25Å; Y16-Q18 PolarHBondContact O-N 3.26Å; Q18-Q20 VanDerWaalsContact C-N 3.28Å; Q18-Q20 PolarHBondContact O-N 3.37Å; Q18-K21 WeakPolarHBondContact O-CB 3.46Å; Q18-K21 PolarHBondContact O-N 3.39Å; Q18-K21 VanDerWaalsContact O-N 3.1Å; Q18-D22 VanDerWaalsContact NE2-CG 3.34Å; Q18-D22 PolarHBondContact NE2-OD1 3.3Å; Q18-D22 PolarHBondContact NE2-OD2 3.26Å; Q18-D22 PolarHBondContact O-N 2.91Å
19	T	97.8	Very high	97.2	Very high	0 Å²	0	63.8 Å²	63.8	0%	0	33%	0.332	C	S	.	.	H	α-helix	trans	-55.4	-43.3	174.6	-57.1	0	0	0	0	111.3	K15 Y16 K21 D22 V23 Y97 K100 Q104	K15-T19 PolarHBondContact O-N 3.14Å; K15-T19 PolarHBondContact O-OG1 3.47Å; Y16-T19 WeakPolarHBondContact O-CB 3.48Å; Y16-T19 PolarHBondContact O-N 3.35Å; Y16-T19 VanDerWaalsContact O-N 3.13Å; T19-K21 VanDerWaalsContact C-N 3.35Å; T19-K21 PolarHBondContact O-N 3.19Å; T19-D22 PolarHBondContact O-N 3.04Å; T19-D22 VanDerWaalsContact O-N 3.16Å; T19-V23 WeakPolarHBondContact O-CG2 3.48Å; T19-V23 PolarHBondContact O-N 3.44Å; T19-Y97 HydrophobicContact CG2-CD1 4.49Å; T19-K100 HydrophobicContact CG2-CD 4.28Å; T19-K100 WeakPolarHBondContact OG1-CE 3.44Å; T19-K100 PolarHBondContact OG1-NZ 3.43Å; T19-Q104 PolarHBondContact OG1-OE1 3.22Å
20	Q	97.3	Very high	97.4	Very high	77 Å²	77	65.7 Å²	65.7	36%	0.36	34%	0.337	S	S	.	.	H	α-helix	trans	-63.6	-37.1	178.2	-65.1	-57.6	99.2	0	0	112.9	Y16 T17 Q18 D22 S24 S101	Y16-Q20 HydrophobicContact CD1-CG 4.1Å; Y16-Q20 HydrophobicContact CE1-CG 3.75Å; Y16-Q20 WeakPolarHBondContact O-CG 3.34Å; Y16-Q20 PolarHBondContact O-N 2.84Å; T17-Q20 PolarHBondContact O-N 3.17Å; Q18-Q20 VanDerWaalsContact C-N 3.28Å; Q18-Q20 PolarHBondContact O-N 3.37Å; Q20-D22 VanDerWaalsContact C-N 3.35Å; Q20-S24 PolarHBondContact O-N 3.02Å; Q20-S24 VanDerWaalsContact O-N 3.08Å; Q20-S101 PolarHBondContact OE1-OG 3.12Å
21	K	97.9	Very high	97.5	Very high	114 Å²	114	64 Å²	64	50%	0.496	33%	0.331	S	S	.	.	H	α-helix	trans	-64.4	-41.1	173.4	-71.4	175.3	-178.2	176.8	0	111.5	T17 Q18 T19 S24 K25	T17-K21 WeakPolarHBondContact O-CG 3.37Å; T17-K21 PolarHBondContact O-N 2.96Å; T17-K21 VanDerWaalsContact O-N 3.14Å; Q18-K21 WeakPolarHBondContact O-CB 3.46Å; Q18-K21 PolarHBondContact O-N 3.39Å; Q18-K21 VanDerWaalsContact O-N 3.1Å; T19-K21 VanDerWaalsContact C-N 3.35Å; T19-K21 PolarHBondContact O-N 3.19Å; K21-S24 PolarHBondContact O-N 2.97Å; K21-K25 WeakPolarHBondContact O-CG 3.16Å; K21-K25 PolarHBondContact O-N 3.36Å
22	D	97.5	Very high	97.6	Very high	33 Å²	33	68.6 Å²	68.6	18%	0.176	34%	0.344	C	S	.	.	H	α-helix	trans	-70.6	-34.4	-179	-62.9	-31.2	0	0	0	112	Q18 T19 Q20 S26 Y97	Q18-D22 VanDerWaalsContact NE2-CG 3.34Å; Q18-D22 PolarHBondContact NE2-OD1 3.3Å; Q18-D22 PolarHBondContact NE2-OD2 3.26Å; Q18-D22 PolarHBondContact O-N 2.91Å; T19-D22 PolarHBondContact O-N 3.04Å; T19-D22 VanDerWaalsContact O-N 3.16Å; Q20-D22 VanDerWaalsContact C-N 3.35Å; D22-S26 WeakPolarHBondContact O-CB 3.49Å; D22-S26 PolarHBondContact O-N 2.93Å; D22-S26 PolarHBondContact O-OG 2.95Å; D22-Y97 HydrophobicContact CB-CD2 4.42Å; D22-Y97 HydrophobicContact CB-CE1 4.33Å; D22-Y97 HydrophobicContact CB-CE2 3.78Å
23	V	98.1	Very high	97.7	Very high	37 Å²	37	68.3 Å²	68.3	22%	0.224	34%	0.343	C	S	.	.	H	α-helix	trans	-58.6	-53.6	168.1	170.2	0	0	0	0	110.5	T19 K25 S26 V27 L94 Y97	T19-V23 WeakPolarHBondContact O-CG2 3.48Å; T19-V23 PolarHBondContact O-N 3.44Å; V23-K25 VanDerWaalsContact C-N 3.35Å; V23-K25 PolarHBondContact O-N 2.94Å; V23-S26 PolarHBondContact O-N 3.5Å; V23-S26 VanDerWaalsContact O-N 3.11Å; V23-V27 HydrophobicContact CG1-CG2 4.32Å; V23-V27 WeakPolarHBondContact O-CG2 3.32Å; V23-V27 PolarHBondContact O-N 3.27Å; V23-L94 HydrophobicContact CG1-CD2 4.18Å; V23-Y97 HydrophobicContact CG2-CD2 4.09Å; V23-Y97 HydrophobicContact CG2-CG 4.15Å
24	S	97.9	Very high	97.7	Very high	72 Å²	72	68.9 Å²	68.9	50%	0.503	34%	0.341	S	S	.	.	H	α-helix	trans	-57.5	-46	-178.7	173.6	0	0	0	0	112.1	Q20 K21 S26 V27 S28	Q20-S24 PolarHBondContact O-N 3.02Å; Q20-S24 VanDerWaalsContact O-N 3.08Å; K21-S24 PolarHBondContact O-N 2.97Å; S24-S26 VanDerWaalsContact C-N 3.34Å; S24-S26 PolarHBondContact O-N 2.92Å; S24-V27 PolarHBondContact O-N 3.4Å; S24-S28 PolarHBondContact O-N 2.89Å; S24-S28 PolarHBondContact O-OG 3.14Å
25	K	98	Very high	97.8	Very high	134 Å²	134	67.3 Å²	67.3	58%	0.583	34%	0.339	S	S	*	.	H	α-helix	trans	-59.3	-43.8	175.6	-72	174.3	-177.3	174.4	0	112.4	K21 V23 S28 A29	K21-K25 WeakPolarHBondContact O-CG 3.16Å; K21-K25 PolarHBondContact O-N 3.36Å; V23-K25 VanDerWaalsContact C-N 3.35Å; V23-K25 PolarHBondContact O-N 2.94Å; K25-S28 PolarHBondContact O-N 3.4Å; K25-A29 WeakPolarHBondContact O-CB 3.49Å; K25-A29 PolarHBondContact O-N 3.44Å
26	S	97.9	Very high	97.9	Very high	6 Å²	6	65.5 Å²	65.5	4%	0.042	33%	0.333	C	S	.	.	H	α-helix	trans	-68.1	-39.1	-178.1	-58.6	0	0	0	0	111.8	D22 V23 S24 A29 R30	D22-S26 WeakPolarHBondContact O-CB 3.49Å; D22-S26 PolarHBondContact O-N 2.93Å; D22-S26 PolarHBondContact O-OG 2.95Å; V23-S26 PolarHBondContact O-N 3.5Å; V23-S26 VanDerWaalsContact O-N 3.11Å; S24-S26 VanDerWaalsContact C-N 3.34Å; S24-S26 PolarHBondContact O-N 2.92Å; S26-A29 PolarHBondContact O-N 3.35Å; S26-R30 WeakPolarHBondContact O-CB 3.39Å; S26-R30 PolarHBondContact O-N 2.9Å
27	V	98.1	Very high	97.9	Very high	45 Å²	45	63.7 Å²	63.7	27%	0.273	33%	0.327	S	S	.	.	H	α-helix	trans	-61.5	-49.4	173.6	171.2	0	0	0	0	110.6	V23 S24 A29 R30 Q31 L94	V23-V27 HydrophobicContact CG1-CG2 4.32Å; V23-V27 WeakPolarHBondContact O-CG2 3.32Å; V23-V27 PolarHBondContact O-N 3.27Å; S24-V27 PolarHBondContact O-N 3.4Å; V27-A29 VanDerWaalsContact C-N 3.33Å; V27-A29 PolarHBondContact O-N 3.29Å; V27-R30 PolarHBondContact O-N 3.42Å; V27-Q31 HydrophobicContact CG1-CG 4.42Å; V27-Q31 WeakPolarHBondContact O-CG 3.4Å; V27-Q31 PolarHBondContact O-N 3.47Å; V27-L94 HydrophobicContact CG2-CD1 4.3Å; V27-L94 HydrophobicContact CG2-CD2 3.81Å
28	S	98.1	Very high	98	Very high	67 Å²	67	63.2 Å²	63.2	47%	0.469	33%	0.329	S	S	.	.	H	α-helix	trans	-62.1	-39.6	178.9	-61.1	0	0	0	0	112.6	S24 K25 K32	S24-S28 PolarHBondContact O-N 2.89Å; S24-S28 PolarHBondContact O-OG 3.14Å; K25-S28 PolarHBondContact O-N 3.4Å; S28-K32 PolarHBondContact O-N 3.34Å; S28-K32 VanDerWaalsContact O-N 3.16Å
29	A	98	Very high	98.1	Very high	27 Å²	27	64.6 Å²	64.6	22%	0.223	34%	0.336	C	S	.	.	H	α-helix	trans	-64.7	-43.8	175.8	0	0	0	0	0	112	K25 S26 V27 K32 L33 Y90	K25-A29 WeakPolarHBondContact O-CB 3.49Å; K25-A29 PolarHBondContact O-N 3.44Å; S26-A29 PolarHBondContact O-N 3.35Å; V27-A29 VanDerWaalsContact C-N 3.33Å; V27-A29 PolarHBondContact O-N 3.29Å; A29-K32 PolarHBondContact O-N 3.12Å; A29-L33 WeakPolarHBondContact O-CG 3.47Å; A29-L33 PolarHBondContact O-N 2.97Å; A29-L33 VanDerWaalsContact O-N 3.13Å; A29-Y90 HydrophobicContact CB-CD1 4.46Å; A29-Y90 HydrophobicContact CB-CE1 3.81Å; A29-Y90 HydrophobicContact CB-CE2 3.94Å
30	R	98.2	Very high	98.1	Very high	67 Å²	67	65.4 Å²	65.4	25%	0.253	34%	0.34	S	S	.	.	H	α-helix	trans	-63	-45.6	177.4	-164.1	-168.2	79	-160.9	1.2	111.9	S26 V27 K32 L33 E34 I87	S26-R30 WeakPolarHBondContact O-CB 3.39Å; S26-R30 PolarHBondContact O-N 2.9Å; V27-R30 PolarHBondContact O-N 3.42Å; R30-K32 VanDerWaalsContact C-N 3.29Å; R30-K32 PolarHBondContact O-N 2.79Å; R30-L33 WeakPolarHBondContact O-CB 3.3Å; R30-L33 PolarHBondContact O-N 3.02Å; R30-L33 VanDerWaalsContact O-N 3.08Å; R30-E34 IonicContact CZ-OE1 3.67Å; R30-E34 IonicContact NE-OE1 2.79Å; R30-E34 PolarHBondContact NE-OE1 3.47Å; R30-E34 IonicContact NH2-OE1 2.65Å; R30-E34 PolarHBondContact NH2-OE1 3.03Å; R30-E34 WeakPolarHBondContact O-CG 3.43Å; R30-E34 PolarHBondContact O-N 2.96Å; R30-I87 HydrophobicContact CG-CG2 4.39Å
31	Q	98.2	Very high	98.1	Very high	101 Å²	101	64.7 Å²	64.7	47%	0.472	34%	0.339	S	S	.	.	H	α-helix	trans	-58.2	-42	177	-75.8	174.4	-23.9	0	0	111.9	V27 L33 E34 T35	V27-Q31 HydrophobicContact CG1-CG 4.42Å; V27-Q31 WeakPolarHBondContact O-CG 3.4Å; V27-Q31 PolarHBondContact O-N 3.47Å; Q31-L33 VanDerWaalsContact C-N 3.33Å; Q31-L33 PolarHBondContact O-N 3.41Å; Q31-E34 WeakPolarHBondContact O-CB 3.45Å; Q31-E34 PolarHBondContact O-N 3.38Å; Q31-T35 PolarHBondContact O-N 2.96Å; Q31-T35 PolarHBondContact O-OG1 3.21Å
32	K	98.3	Very high	98.1	Very high	138 Å²	138	64 Å²	64	60%	0.6	34%	0.339	S	S	*	.	H	α-helix	trans	-61.7	-41.3	175.4	-175.8	175.8	179.4	177.8	0	112	S28 A29 R30 T35 Q36	S28-K32 PolarHBondContact O-N 3.34Å; S28-K32 VanDerWaalsContact O-N 3.16Å; A29-K32 PolarHBondContact O-N 3.12Å; R30-K32 VanDerWaalsContact C-N 3.29Å; R30-K32 PolarHBondContact O-N 2.79Å; K32-T35 PolarHBondContact O-N 2.76Å; K32-Q36 WeakPolarHBondContact O-CG 3.5Å; K32-Q36 PolarHBondContact O-N 2.91Å
33	L	98.6	Very high	98.1	Very high	19 Å²	19	65.5 Å²	65.5	10%	0.099	35%	0.35	C	S	.	.	H	α-helix	trans	-67	-37.7	176.4	-70.9	166.9	0	0	0	111.9	A29 R30 Q31 Q36 M37 I83 E86 I87 Y90	A29-L33 WeakPolarHBondContact O-CG 3.47Å; A29-L33 PolarHBondContact O-N 2.97Å; A29-L33 VanDerWaalsContact O-N 3.13Å; R30-L33 WeakPolarHBondContact O-CB 3.3Å; R30-L33 PolarHBondContact O-N 3.02Å; R30-L33 VanDerWaalsContact O-N 3.08Å; Q31-L33 VanDerWaalsContact C-N 3.33Å; Q31-L33 PolarHBondContact O-N 3.41Å; L33-Q36 PolarHBondContact O-N 3.33Å; L33-M37 WeakPolarHBondContact O-CB 3.36Å; L33-M37 PolarHBondContact O-N 3.28Å; L33-I83 HydrophobicContact CB-CG2 4.1Å; L33-I83 HydrophobicContact CD2-CG2 4.11Å; L33-I83 WeakPolarHBondContact O-CG2 3.38Å; L33-E86 HydrophobicContact CD1-CB 3.71Å; L33-E86 HydrophobicContact CD2-CB 4.39Å; L33-I87 HydrophobicContact CB-CD1 4.21Å; L33-I87 HydrophobicContact CB-CG1 3.73Å; L33-I87 HydrophobicContact CD1-CG1 4.4Å; L33-Y90 HydrophobicContact CD1-CD2 3.65Å; L33-Y90 HydrophobicContact CD1-CE2 3.68Å
34	E	98.1	Very high	98.1	Very high	77 Å²	77	67.6 Å²	67.6	36%	0.36	36%	0.356	S	S	.	.	H	α-helix	trans	-61.1	-43	174.5	-72.4	167.5	-171.5	0	0	111.4	R30 Q31 M37 A38 I87	R30-E34 IonicContact CZ-OE1 3.67Å; R30-E34 IonicContact NE-OE1 2.79Å; R30-E34 PolarHBondContact NE-OE1 3.47Å; R30-E34 IonicContact NH2-OE1 2.65Å; R30-E34 PolarHBondContact NH2-OE1 3.03Å; R30-E34 WeakPolarHBondContact O-CG 3.43Å; R30-E34 PolarHBondContact O-N 2.96Å; Q31-E34 WeakPolarHBondContact O-CB 3.45Å; Q31-E34 PolarHBondContact O-N 3.38Å; E34-M37 WeakPolarHBondContact O-CB 3.4Å; E34-M37 PolarHBondContact O-N 3.45Å; E34-A38 PolarHBondContact O-N 3.29Å; E34-I87 HydrophobicContact CG-CD1 4.21Å
35	T	98.3	Very high	98.2	Very high	80 Å²	80	70.1 Å²	70.1	49%	0.491	36%	0.36	S	S	.	.	H	α-helix	trans	-61.4	-47.8	173.4	-54.2	0	0	0	0	111.5	Q31 K32 M37 A38 E39	Q31-T35 PolarHBondContact O-N 2.96Å; Q31-T35 PolarHBondContact O-OG1 3.21Å; K32-T35 PolarHBondContact O-N 2.76Å; T35-M37 VanDerWaalsContact C-N 3.28Å; T35-M37 PolarHBondContact O-N 3.26Å; T35-A38 PolarHBondContact O-N 2.91Å; T35-E39 WeakPolarHBondContact O-CG 3.27Å; T35-E39 PolarHBondContact O-N 3.31Å
36	Q	98.4	Very high	98.1	Very high	71 Å²	71	69.4 Å²	69.4	33%	0.332	36%	0.359	S	S	.	.	H	α-helix	trans	-62	-36.6	177.5	-71.1	-179.7	-27.5	0	0	112.2	K32 L33 N40 I83	K32-Q36 WeakPolarHBondContact O-CG 3.5Å; K32-Q36 PolarHBondContact O-N 2.91Å; L33-Q36 PolarHBondContact O-N 3.33Å; Q36-N40 WeakPolarHBondContact O-CB 2.97Å; Q36-N40 PolarHBondContact O-N 2.99Å; Q36-N40 PolarHBondContact O-ND2 3.42Å; Q36-I83 HydrophobicContact CB-CD1 4.06Å
37	M	98.2	Very high	98.1	Very high	26 Å²	26	70 Å²	70	13%	0.128	36%	0.361	C	S	.	.	H	α-helix	trans	-61.1	-49.7	175.6	-176.6	64.3	83.8	0	0	110.7	L33 E34 T35 E39 N40 N41 L80 I83 N84 I87	L33-M37 WeakPolarHBondContact O-CB 3.36Å; L33-M37 PolarHBondContact O-N 3.28Å; E34-M37 WeakPolarHBondContact O-CB 3.4Å; E34-M37 PolarHBondContact O-N 3.45Å; T35-M37 VanDerWaalsContact C-N 3.28Å; T35-M37 PolarHBondContact O-N 3.26Å; M37-E39 PolarHBondContact O-N 3.03Å; M37-N40 PolarHBondContact O-N 3.24Å; M37-N41 WeakPolarHBondContact O-CB 3.44Å; M37-N41 PolarHBondContact O-N 3.28Å; M37-N41 PolarHBondContact O-ND2 3.47Å; M37-L80 HydrophobicContact SD-CB 4.48Å; M37-L80 HydrophobicContact SD-CD2 3.36Å; M37-L80 WeakPolarHBondContact SD-CD2 3.41Å; M37-I83 HydrophobicContact CB-CG2 3.94Å; M37-I83 HydrophobicContact CE-CB 3.81Å; M37-I83 HydrophobicContact CE-CG2 3.62Å; M37-I83 HydrophobicContact SD-CB 4.49Å; M37-I83 HydrophobicContact SD-CG2 4.31Å; M37-N84 VanDerWaalsContact CE-CA 3.42Å; M37-N84 HydrophobicContact CE-CB 3.53Å; M37-I87 HydrophobicContact CB-CD1 4.34Å; M37-I87 HydrophobicContact CE-CD1 4.07Å
38	A	98.1	Very high	98	Very high	54 Å²	54	71.7 Å²	71.7	45%	0.446	37%	0.368	S	S	.	.	H	α-helix	trans	-59.5	-47.2	179	0	0	0	0	0	111.6	E34 T35 N40 N41 I42	E34-A38 PolarHBondContact O-N 3.29Å; T35-A38 PolarHBondContact O-N 2.91Å; A38-N40 PolarHBondContact O-N 3.1Å; A38-N41 PolarHBondContact O-N 2.72Å; A38-I42 WeakPolarHBondContact O-CG1 3.38Å; A38-I42 PolarHBondContact O-N 3.36Å; A38-I42 VanDerWaalsContact O-N 3.1Å
39	E	98.2	Very high	98	Very high	111 Å²	111	75 Å²	75	52%	0.519	38%	0.38	S	S	.	.	H	α-helix	trans	-59.5	-43.7	177	-70	172	-177.3	0	0	112.3	T35 M37 I42 V43	T35-E39 WeakPolarHBondContact O-CG 3.27Å; T35-E39 PolarHBondContact O-N 3.31Å; M37-E39 PolarHBondContact O-N 3.03Å; E39-I42 PolarHBondContact O-N 3.32Å; E39-V43 WeakPolarHBondContact O-CG2 3.42Å; E39-V43 PolarHBondContact O-N 3Å; E39-V43 VanDerWaalsContact O-N 3.12Å
40	N	98.2	Very high	97.9	Very high	18 Å²	18	76.1 Å²	76.1	10%	0.096	38%	0.382	C	S	.	.	H	α-helix	trans	-73.5	-28.1	-179.7	-77.7	-93.6	0	0	0	112.7	Q36 M37 A38 V43 K44 R79 L80	Q36-N40 WeakPolarHBondContact O-CB 2.97Å; Q36-N40 PolarHBondContact O-N 2.99Å; Q36-N40 PolarHBondContact O-ND2 3.42Å; M37-N40 PolarHBondContact O-N 3.24Å; A38-N40 PolarHBondContact O-N 3.1Å; N40-V43 PolarHBondContact O-N 3.39Å; N40-K44 WeakPolarHBondContact O-CB 3.33Å; N40-K44 PolarHBondContact O-N 3.27Å; N40-R79 WeakPolarHBondContact OD1-CD 3.44Å; N40-L80 HydrophobicContact CB-CD2 3.53Å; N40-L80 HydrophobicContact CB-CG 4.08Å
41	N	98.3	Very high	97.7	Very high	62 Å²	62	76.9 Å²	76.9	33%	0.332	39%	0.391	S	S	.	.	H	α-helix	trans	-65.8	-42.9	172	-79.5	-33.7	0	0	0	111	M37 A38 V43 K44 E45 L80	M37-N41 WeakPolarHBondContact O-CB 3.44Å; M37-N41 PolarHBondContact O-N 3.28Å; M37-N41 PolarHBondContact O-ND2 3.47Å; A38-N41 PolarHBondContact O-N 2.72Å; N41-V43 VanDerWaalsContact C-N 3.33Å; N41-V43 PolarHBondContact O-N 3.36Å; N41-K44 WeakPolarHBondContact O-CB 3.32Å; N41-K44 PolarHBondContact O-N 2.79Å; N41-K44 VanDerWaalsContact O-N 3.14Å; N41-E45 WeakPolarHBondContact O-CG 3.38Å; N41-E45 PolarHBondContact O-N 3.28Å; N41-L80 VanDerWaalsContact OD1-CD2 3.32Å; N41-L80 WeakPolarHBondContact OD1-CD2 3.47Å
42	I	98.3	Very high	97.4	Very high	98 Å²	98	78.1 Å²	78.1	50%	0.503	41%	0.411	S	S	.	.	H	α-helix	trans	-58.7	-47.3	173.9	-65	164.7	0	0	0	110.1	A38 E39 K44 E45 E46	A38-I42 WeakPolarHBondContact O-CG1 3.38Å; A38-I42 PolarHBondContact O-N 3.36Å; A38-I42 VanDerWaalsContact O-N 3.1Å; E39-I42 PolarHBondContact O-N 3.32Å; I42-K44 VanDerWaalsContact C-N 3.29Å; I42-K44 PolarHBondContact O-N 3.06Å; I42-E45 PolarHBondContact O-N 3.04Å; I42-E46 HydrophobicContact CG2-CG 4.49Å; I42-E46 WeakPolarHBondContact O-CG 3.42Å; I42-E46 PolarHBondContact O-N 3.36Å
43	V	97.7	Very high	97.2	Very high	66 Å²	66	76 Å²	76	40%	0.4	41%	0.414	S	S	.	.	H	α-helix	trans	-60.3	-39.9	177.1	175.7	0	0	0	0	111.7	E39 N40 N41 E46 L47 V76	E39-V43 WeakPolarHBondContact O-CG2 3.42Å; E39-V43 PolarHBondContact O-N 3Å; E39-V43 VanDerWaalsContact O-N 3.12Å; N40-V43 PolarHBondContact O-N 3.39Å; N41-V43 VanDerWaalsContact C-N 3.33Å; N41-V43 PolarHBondContact O-N 3.36Å; V43-E46 PolarHBondContact O-N 3.02Å; V43-L47 HydrophobicContact CG1-CD1 4.1Å; V43-L47 HydrophobicContact CG1-CG 4.34Å; V43-L47 WeakPolarHBondContact O-CB 3.44Å; V43-L47 VanDerWaalsContact O-CG 3.3Å; V43-L47 WeakPolarHBondContact O-CG 3.37Å; V43-L47 PolarHBondContact O-N 3.03Å; V43-V76 HydrophobicContact CG1-CG1 4.49Å; V43-V76 HydrophobicContact CG1-CG2 3.9Å
44	K	98.1	Very high	97.1	Very high	80 Å²	80	78.4 Å²	78.4	35%	0.348	43%	0.426	S	S	.	.	H	α-helix	trans	-62.1	-47.4	176.5	-174.4	-169	170.2	-63.6	0	111	N40 N41 I42 E46 L47 D48 V76 L80	N40-K44 WeakPolarHBondContact O-CB 3.33Å; N40-K44 PolarHBondContact O-N 3.27Å; N41-K44 WeakPolarHBondContact O-CB 3.32Å; N41-K44 PolarHBondContact O-N 2.79Å; N41-K44 VanDerWaalsContact O-N 3.14Å; I42-K44 VanDerWaalsContact C-N 3.29Å; I42-K44 PolarHBondContact O-N 3.06Å; K44-E46 VanDerWaalsContact C-N 3.34Å; K44-E46 PolarHBondContact O-N 3.47Å; K44-L47 PolarHBondContact O-N 3.18Å; K44-D48 IonicContact NZ-OD2 3.45Å; K44-D48 PolarHBondContact NZ-OD2 2.87Å; K44-D48 WeakPolarHBondContact O-CB 3.37Å; K44-D48 VanDerWaalsContact O-CG 3.23Å; K44-D48 PolarHBondContact O-N 3.38Å; K44-V76 HydrophobicContact CB-CG1 3.84Å; K44-L80 HydrophobicContact CB-CD1 4.06Å; K44-L80 HydrophobicContact CD-CD1 3.68Å; K44-L80 HydrophobicContact CG-CD1 4.33Å
45	E	98.1	Very high	97.1	Very high	125 Å²	125	78.4 Å²	78.4	58%	0.584	43%	0.432	S	S	*	.	H	α-helix	trans	-58.3	-46.1	178	-72.2	171	-168.7	0	0	111.1	N41 I42 L47 D48 L49	N41-E45 WeakPolarHBondContact O-CG 3.38Å; N41-E45 PolarHBondContact O-N 3.28Å; I42-E45 PolarHBondContact O-N 3.04Å; E45-L47 PolarHBondContact O-N 3.5Å; E45-D48 PolarHBondContact O-N 3.36Å; E45-L49 PolarHBondContact O-N 2.86Å
46	E	97.7	Very high	97	Very high	120 Å²	120	75.7 Å²	75.7	56%	0.561	42%	0.415	S	S	*	.	H	α-helix	trans	-62.3	-43.3	176	-68	-65.5	156.5	0	0	112.3	I42 V43 K44 D48 L49	I42-E46 HydrophobicContact CG2-CG 4.49Å; I42-E46 WeakPolarHBondContact O-CG 3.42Å; I42-E46 PolarHBondContact O-N 3.36Å; V43-E46 PolarHBondContact O-N 3.02Å; K44-E46 VanDerWaalsContact C-N 3.34Å; K44-E46 PolarHBondContact O-N 3.47Å; E46-D48 VanDerWaalsContact C-N 3.29Å; E46-D48 PolarHBondContact O-N 2.99Å; E46-L49 PolarHBondContact O-N 3.11Å
47	L	97.1	Very high	96.9	Very high	17 Å²	17	77.9 Å²	77.9	9%	0.089	42%	0.424	C	S	.	.	H	α-helix	trans	-64.2	-34.2	176.7	-74.9	176.3	0	0	0	112.3	V43 K44 E45 L49 L50 V56 L69 A72 K73 V76	V43-L47 HydrophobicContact CG1-CD1 4.1Å; V43-L47 HydrophobicContact CG1-CG 4.34Å; V43-L47 WeakPolarHBondContact O-CB 3.44Å; V43-L47 VanDerWaalsContact O-CG 3.3Å; V43-L47 WeakPolarHBondContact O-CG 3.37Å; V43-L47 PolarHBondContact O-N 3.03Å; K44-L47 PolarHBondContact O-N 3.18Å; E45-L47 PolarHBondContact O-N 3.5Å; L47-L49 PolarHBondContact O-N 2.73Å; L47-L50 HydrophobicContact CD2-CD1 3.92Å; L47-L50 WeakPolarHBondContact O-CB 3.24Å; L47-L50 PolarHBondContact O-N 2.93Å; L47-V56 HydrophobicContact CD2-CG2 4.39Å; L47-L69 HydrophobicContact CD2-CD1 4.12Å; L47-A72 HydrophobicContact CD1-CB 4.28Å; L47-A72 HydrophobicContact CD2-CB 4.29Å; L47-K73 HydrophobicContact CB-CG 4.06Å; L47-K73 HydrophobicContact CD1-CG 4.44Å; L47-K73 WeakPolarHBondContact O-CE 3.32Å; L47-K73 PolarHBondContact O-NZ 2.9Å; L47-V76 HydrophobicContact CD1-CB 4.27Å; L47-V76 HydrophobicContact CD1-CG2 3.7Å
48	D	96.6	Very high	96.8	Very high	81 Å²	81	81.1 Å²	81.1	43%	0.433	44%	0.437	S	S	.	.	H	α-helix	trans	-68.8	-22.2	179.5	-73.4	-20	0	0	0	112.5	K44 E45 E46 L50	K44-D48 IonicContact NZ-OD2 3.45Å; K44-D48 PolarHBondContact NZ-OD2 2.87Å; K44-D48 WeakPolarHBondContact O-CB 3.37Å; K44-D48 VanDerWaalsContact O-CG 3.23Å; K44-D48 PolarHBondContact O-N 3.38Å; E45-D48 PolarHBondContact O-N 3.36Å; E46-D48 VanDerWaalsContact C-N 3.29Å; E46-D48 PolarHBondContact O-N 2.99Å; D48-L50 VanDerWaalsContact C-N 3.32Å
49	L	97.2	Very high	96.7	Very high	136 Å²	136	84.3 Å²	84.3	71%	0.712	45%	0.446	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77.7	-15.6	173.2	-61.8	175.9	0	0	0	113.6	E45 E46 L47	E45-L49 PolarHBondContact O-N 2.86Å; E46-L49 PolarHBondContact O-N 3.11Å; L47-L49 PolarHBondContact O-N 2.73Å
50	L	96.8	Very high	96.6	Very high	51 Å²	51	83.2 Å²	83.2	27%	0.267	44%	0.443	S	S	.	.			trans	-82.8	145.2	-177.3	-54.4	-177.3	0	0	0	112.1	L47 D48 N54 V56 L69	L47-L50 HydrophobicContact CD2-CD1 3.92Å; L47-L50 WeakPolarHBondContact O-CB 3.24Å; L47-L50 PolarHBondContact O-N 2.93Å; D48-L50 VanDerWaalsContact C-N 3.32Å; L50-N54 WeakPolarHBondContact CA-OD1 3.43Å; L50-N54 HydrophobicContact CB-CB 4.17Å; L50-N54 HydrophobicContact CD2-CB 4.16Å; L50-V56 HydrophobicContact CD1-CG2 3.68Å; L50-L69 HydrophobicContact CB-CD1 3.91Å; L50-L69 HydrophobicContact CB-CD2 4Å; L50-L69 HydrophobicContact CD1-CD1 3.92Å
51	D	94.3	Very high	96.5	Very high	84 Å²	84	85.4 Å²	85.4	45%	0.449	47%	0.47	S	S	.	.			trans	-117	-178.6	172.5	69.1	48.3	0	0	0	111.9	S53 N54	D51-S53 PolarHBondContact O-N 3.08Å; D51-S53 VanDerWaalsContact O-N 3.12Å; D51-S53 WeakPolarHBondContact OD1-CA 3.42Å; D51-S53 WeakPolarHBondContact OD1-CB 3.35Å; D51-S53 PolarHBondContact OD1-N 2.88Å; D51-S53 PolarHBondContact OD1-OG 3.45Å; D51-N54 PolarHBondContact N-OD1 3.25Å; D51-N54 WeakPolarHBondContact O-CB 3.49Å; D51-N54 PolarHBondContact O-N 3.44Å; D51-N54 PolarHBondContact O-OD1 3.26Å
52	S	91.1	Very high	96.4	Very high	127 Å²	127	88.7 Å²	88.7	89%	0.888	50%	0.495	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.5	-14.1	-176.3	55.7	0	0	0	0	114.8
53	S	94.8	Very high	96.4	Very high	93 Å²	93	87.9 Å²	87.9	65%	0.65	49%	0.494	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.6	-20.8	174.9	75.5	0	0	0	0	112.5	D51	D51-S53 PolarHBondContact O-N 3.08Å; D51-S53 VanDerWaalsContact O-N 3.12Å; D51-S53 WeakPolarHBondContact OD1-CA 3.42Å; D51-S53 WeakPolarHBondContact OD1-CB 3.35Å; D51-S53 PolarHBondContact OD1-N 2.88Å; D51-S53 PolarHBondContact OD1-OG 3.45Å
54	N	96.6	Very high	96.4	Very high	69 Å²	69	90.3 Å²	90.3	37%	0.369	50%	0.504	S	S	.	.	S	Bend	trans	-78.7	148.5	178.9	-57.3	111.4	0	0	0	111.4	L50 D51	L50-N54 WeakPolarHBondContact CA-OD1 3.43Å; L50-N54 HydrophobicContact CB-CB 4.17Å; L50-N54 HydrophobicContact CD2-CB 4.16Å; D51-N54 PolarHBondContact N-OD1 3.25Å; D51-N54 WeakPolarHBondContact O-CB 3.49Å; D51-N54 PolarHBondContact O-N 3.44Å; D51-N54 PolarHBondContact O-OD1 3.26Å
55	T	96.4	Very high	96.4	Very high	77 Å²	77	89.5 Å²	89.5	47%	0.472	51%	0.506	S	S	.	.			trans	-113.1	122.3	173.9	-60.3	0	0	0	0	110	F57 K66	T55-F57 HydrophobicContact CG2-CD2 4.15Å; T55-F57 HydrophobicContact CG2-CE1 4.41Å; T55-F57 HydrophobicContact CG2-CE2 3.44Å; T55-F57 VanDerWaalsContact CG2-CE2 3.44Å; T55-F57 HydrophobicContact CG2-CZ 3.59Å; T55-K66 HydrophobicContact CG2-CD 4.14Å; T55-K66 HydrophobicContact CG2-CG 4.08Å
56	V	96.7	Very high	96.4	Very high	24 Å²	24	90.7 Å²	90.7	15%	0.145	51%	0.509	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.7	139.5	178	-178.2	0	0	0	0	110.1	L47 L50 Q67 L69 A72	L47-V56 HydrophobicContact CD2-CG2 4.39Å; L50-V56 HydrophobicContact CD1-CG2 3.68Å; V56-Q67 HydrophobicContact CG1-CB 4.36Å; V56-Q67 PolarHBondContact O-N 3.13Å; V56-L69 HydrophobicContact CG2-CD1 3.8Å; V56-A72 HydrophobicContact CG1-CB 4.2Å
57	F	96.9	Very high	96.3	Very high	116 Å²	116	86.6 Å²	86.6	51%	0.509	49%	0.49	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.9	138	173.3	-65.1	-89.4	0	0	0	110.5	T55 L64 V65 K66	T55-F57 HydrophobicContact CG2-CD2 4.15Å; T55-F57 HydrophobicContact CG2-CE1 4.41Å; T55-F57 HydrophobicContact CG2-CE2 3.44Å; T55-F57 VanDerWaalsContact CG2-CE2 3.44Å; T55-F57 HydrophobicContact CG2-CZ 3.59Å; F57-L64 HydrophobicContact CB-CB 4.19Å; F57-L64 HydrophobicContact CB-CD2 4.3Å; F57-L64 HydrophobicContact CD1-CB 4.34Å; F57-V65 CarbonylContact C-O 3.54Å; F57-V65 WeakPolarHBondContact CA-O 3.42Å; F57-K66 HydrophobicContact CD1-CB 4.17Å; F57-K66 HydrophobicContact CE1-CB 3.96Å
58	K	96.6	Very high	96.3	Very high	95 Å²	95	89.8 Å²	89.8	41%	0.413	51%	0.507	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.7	130.7	173.6	-177	177.8	-179.5	177.5	0	110	I60 V65 Q67	K58-I60 HydrophobicContact CD-CD1 4.47Å; K58-I60 HydrophobicContact CD-CG1 4.44Å; K58-I60 HydrophobicContact CG-CG1 4.23Å; K58-V65 PolarHBondContact N-O 3.16Å; K58-V65 PolarHBondContact O-N 3.36Å; K58-Q67 HydrophobicContact CB-CB 4.17Å; K58-Q67 HydrophobicContact CB-CG 4.48Å
59	L	96.3	Very high	96.3	Very high	120 Å²	120	87 Å²	87	63%	0.628	49%	0.492	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-76.6	122.8	172.3	-176.6	66.4	0	0	0	110.4	G61 L64	L59-G61 WeakPolarHBondContact CD1-O 3.49Å; L59-L64 HydrophobicContact CB-CD2 4.06Å; L59-L64 HydrophobicContact CD1-CD2 4.03Å
60	I	94.7	Very high	96.2	Very high	88 Å²	88	86.1 Å²	86.1	45%	0.451	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	105.9	174.8	-57.3	-178.2	0	0	0	107.6	K58 V63 V65	K58-I60 HydrophobicContact CD-CD1 4.47Å; K58-I60 HydrophobicContact CD-CG1 4.44Å; K58-I60 HydrophobicContact CG-CG1 4.23Å; I60-V63 PolarHBondContact N-O 3.44Å; I60-V63 WeakPolarHBondContact O-CG2 3.45Å; I60-V63 PolarHBondContact O-N 3.35Å; I60-V63 VanDerWaalsContact O-N 3.09Å; I60-V65 HydrophobicContact CD1-CB 4.35Å; I60-V65 HydrophobicContact CD1-CG2 4.03Å; I60-V65 HydrophobicContact CG1-CG2 4.45Å
61	G	96.2	Very high	96.2	Very high	64 Å²	64	89.1 Å²	89.1	66%	0.66	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.4	-126.1	-172.9	0	0	0	0	0	110.8	L59	L59-G61 WeakPolarHBondContact CD1-O 3.49Å
62	P	96.9	Very high	96.4	Very high	132 Å²	132	85.7 Å²	85.7	86%	0.857	48%	0.484	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.3	4	177.6	35.5	-34	0	0	0	114.4
63	V	97.8	Very high	96.7	Very high	81 Å²	81	82.5 Å²	82.5	49%	0.491	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.1	149.7	-172.6	-59.9	0	0	0	0	113.8	I60 V65	I60-V63 PolarHBondContact N-O 3.44Å; I60-V63 WeakPolarHBondContact O-CG2 3.45Å; I60-V63 PolarHBondContact O-N 3.35Å; I60-V63 VanDerWaalsContact O-N 3.09Å; V63-V65 HydrophobicContact CG2-CG2 4.25Å
64	L	98.2	Very high	96.8	Very high	116 Å²	116	81 Å²	81	61%	0.607	45%	0.447	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.8	123.6	171.2	-69.9	176.6	0	0	0	109.9	F57 L59	F57-L64 HydrophobicContact CB-CB 4.19Å; F57-L64 HydrophobicContact CB-CD2 4.3Å; F57-L64 HydrophobicContact CD1-CB 4.34Å; L59-L64 HydrophobicContact CB-CD2 4.06Å; L59-L64 HydrophobicContact CD1-CD2 4.03Å
65	V	97.7	Very high	96.8	Very high	63 Å²	63	81.2 Å²	81.2	38%	0.382	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.1	129.5	178.8	-177.6	0	0	0	0	108.7	F57 K58 I60 V63 Q67	F57-V65 CarbonylContact C-O 3.54Å; F57-V65 WeakPolarHBondContact CA-O 3.42Å; K58-V65 PolarHBondContact N-O 3.16Å; K58-V65 PolarHBondContact O-N 3.36Å; I60-V65 HydrophobicContact CD1-CB 4.35Å; I60-V65 HydrophobicContact CD1-CG2 4.03Å; I60-V65 HydrophobicContact CG1-CG2 4.45Å; V63-V65 HydrophobicContact CG2-CG2 4.25Å; V65-Q67 PolarHBondContact O-N 3.21Å
66	K	97.5	Very high	96.9	Very high	150 Å²	150	78.3 Å²	78.3	65%	0.652	43%	0.433	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-59.4	128.2	174.9	-174.7	176.8	176.2	175.9	0	108.6	T55 F57	T55-K66 HydrophobicContact CG2-CD 4.14Å; T55-K66 HydrophobicContact CG2-CG 4.08Å; F57-K66 HydrophobicContact CD1-CB 4.17Å; F57-K66 HydrophobicContact CE1-CB 3.96Å
67	Q	96.8	Very high	97	Very high	34 Å²	34	79 Å²	79	16%	0.159	44%	0.441	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	136.4	-176.2	-176.2	62	60.2	0	0	108.1	V56 K58 V65 E71 A72	V56-Q67 HydrophobicContact CG1-CB 4.36Å; V56-Q67 PolarHBondContact O-N 3.13Å; K58-Q67 HydrophobicContact CB-CB 4.17Å; K58-Q67 HydrophobicContact CB-CG 4.48Å; V65-Q67 PolarHBondContact O-N 3.21Å; Q67-E71 PolarHBondContact NE2-OE2 3.05Å; Q67-A72 HydrophobicContact CG-CB 4.01Å
68	D	96.8	Very high	97	Very high	84 Å²	84	80 Å²	80	45%	0.449	45%	0.446	S	S	.	.			trans	-63.6	140.1	171.3	178.1	-94.3	0	0	0	110.5	D70 E71 A72	D68-D70 WeakPolarHBondContact OD1-CA 3.46Å; D68-D70 WeakPolarHBondContact OD1-CB 3.23Å; D68-D70 PolarHBondContact OD1-N 3.04Å; D68-E71 HydrophobicContact CB-CB 4.05Å; D68-E71 HydrophobicContact CB-CG 3.93Å; D68-E71 PolarHBondContact O-N 2.93Å; D68-E71 PolarHBondContact OD1-N 2.96Å; D68-E71 VanDerWaalsContact OD1-N 3.07Å; D68-A72 WeakPolarHBondContact O-CB 3.33Å; D68-A72 PolarHBondContact O-N 3.38Å
69	L	96.3	Very high	97.1	Very high	24 Å²	24	82.6 Å²	82.6	13%	0.126	45%	0.453	C	S	.	.	H	α-helix	trans	-65.4	-41.2	-174.6	177.2	60.2	0	0	0	111.6	L47 L50 V56 A72 K73	L47-L69 HydrophobicContact CD2-CD1 4.12Å; L50-L69 HydrophobicContact CB-CD1 3.91Å; L50-L69 HydrophobicContact CB-CD2 4Å; L50-L69 HydrophobicContact CD1-CD1 3.92Å; V56-L69 HydrophobicContact CG2-CD1 3.8Å; L69-A72 WeakPolarHBondContact O-CB 3.45Å; L69-A72 PolarHBondContact O-N 3.46Å; L69-K73 HydrophobicContact CG-CD 4.45Å; L69-K73 WeakPolarHBondContact O-CG 3.49Å; L69-K73 PolarHBondContact O-N 3.41Å
70	D	96.1	Very high	97.2	Very high	116 Å²	116	77.7 Å²	77.7	62%	0.62	43%	0.427	S	S	*	.	H	α-helix	trans	-69.9	-38.9	-179.8	-67.5	-28.8	0	0	0	110.5	D68 A72 K73 A74	D68-D70 WeakPolarHBondContact OD1-CA 3.46Å; D68-D70 WeakPolarHBondContact OD1-CB 3.23Å; D68-D70 PolarHBondContact OD1-N 3.04Å; D70-A72 VanDerWaalsContact C-N 3.34Å; D70-A72 PolarHBondContact O-N 2.89Å; D70-K73 PolarHBondContact O-N 3.34Å; D70-A74 WeakPolarHBondContact O-CB 3.39Å; D70-A74 PolarHBondContact O-N 3.28Å
71	E	96.2	Very high	97.4	Very high	115 Å²	115	78.9 Å²	78.9	54%	0.537	43%	0.431	S	S	.	.	H	α-helix	trans	-63	-38.3	172	-69.8	-174.5	176.5	0	0	112.7	Q67 D68 T75	Q67-E71 PolarHBondContact NE2-OE2 3.05Å; D68-E71 HydrophobicContact CB-CB 4.05Å; D68-E71 HydrophobicContact CB-CG 3.93Å; D68-E71 PolarHBondContact O-N 2.93Å; D68-E71 PolarHBondContact OD1-N 2.96Å; D68-E71 VanDerWaalsContact OD1-N 3.07Å; E71-T75 WeakPolarHBondContact O-CB 3.33Å; E71-T75 PolarHBondContact O-N 3.36Å; E71-T75 PolarHBondContact O-OG1 3.42Å
72	A	97.4	Very high	97.5	Very high	11 Å²	11	83.1 Å²	83.1	9%	0.091	43%	0.428	C	S	.	.	H	α-helix	trans	-63.3	-47.7	175.2	0	0	0	0	0	111	L47 V56 Q67 D68 L69 D70 T75 V76	L47-A72 HydrophobicContact CD1-CB 4.28Å; L47-A72 HydrophobicContact CD2-CB 4.29Å; V56-A72 HydrophobicContact CG1-CB 4.2Å; Q67-A72 HydrophobicContact CG-CB 4.01Å; D68-A72 WeakPolarHBondContact O-CB 3.33Å; D68-A72 PolarHBondContact O-N 3.38Å; L69-A72 WeakPolarHBondContact O-CB 3.45Å; L69-A72 PolarHBondContact O-N 3.46Å; D70-A72 VanDerWaalsContact C-N 3.34Å; D70-A72 PolarHBondContact O-N 2.89Å; A72-T75 PolarHBondContact O-N 3.44Å; A72-V76 WeakPolarHBondContact O-CG2 3.44Å; A72-V76 PolarHBondContact O-N 2.9Å
73	K	97.4	Very high	97.6	Very high	60 Å²	60	77.1 Å²	77.1	26%	0.261	39%	0.388	S	S	.	.	H	α-helix	trans	-58.9	-47.9	175.6	-74.8	177.8	176	178.3	0	111.6	L47 L69 D70 T75 V76 A77	L47-K73 HydrophobicContact CB-CG 4.06Å; L47-K73 HydrophobicContact CD1-CG 4.44Å; L47-K73 WeakPolarHBondContact O-CE 3.32Å; L47-K73 PolarHBondContact O-NZ 2.9Å; L69-K73 HydrophobicContact CG-CD 4.45Å; L69-K73 WeakPolarHBondContact O-CG 3.49Å; L69-K73 PolarHBondContact O-N 3.41Å; D70-K73 PolarHBondContact O-N 3.34Å; K73-T75 VanDerWaalsContact C-N 3.32Å; K73-T75 PolarHBondContact O-N 3.41Å; K73-V76 PolarHBondContact O-N 3.16Å; K73-A77 WeakPolarHBondContact O-CB 3.45Å; K73-A77 PolarHBondContact O-N 3.11Å
74	A	97.6	Very high	97.6	Very high	61 Å²	61	76.9 Å²	76.9	50%	0.504	39%	0.385	S	S	.	.	H	α-helix	trans	-61.4	-40.2	178.4	0	0	0	0	0	112.3	D70 A77 K78	D70-A74 WeakPolarHBondContact O-CB 3.39Å; D70-A74 PolarHBondContact O-N 3.28Å; A74-A77 PolarHBondContact O-N 3.48Å; A74-K78 WeakPolarHBondContact O-CB 3.36Å; A74-K78 PolarHBondContact O-N 2.77Å
75	T	97.1	Very high	97.6	Very high	74 Å²	74	73 Å²	73	45%	0.454	37%	0.372	S	S	.	.	H	α-helix	trans	-63.2	-45.6	177.5	-61.9	0	0	0	0	111.7	E71 A72 K73 K78 R79	E71-T75 WeakPolarHBondContact O-CB 3.33Å; E71-T75 PolarHBondContact O-N 3.36Å; E71-T75 PolarHBondContact O-OG1 3.42Å; A72-T75 PolarHBondContact O-N 3.44Å; K73-T75 VanDerWaalsContact C-N 3.32Å; K73-T75 PolarHBondContact O-N 3.41Å; T75-K78 PolarHBondContact O-N 3.01Å; T75-R79 WeakPolarHBondContact O-CB 3.41Å; T75-R79 PolarHBondContact O-N 3.05Å
76	V	97.9	Very high	97.7	Very high	17 Å²	17	71.6 Å²	71.6	10%	0.103	36%	0.362	C	S	.	.	H	α-helix	trans	-67	-43.6	178.9	175.4	0	0	0	0	110.7	V43 K44 L47 A72 K73 K78 R79 L80	V43-V76 HydrophobicContact CG1-CG1 4.49Å; V43-V76 HydrophobicContact CG1-CG2 3.9Å; K44-V76 HydrophobicContact CB-CG1 3.84Å; L47-V76 HydrophobicContact CD1-CB 4.27Å; L47-V76 HydrophobicContact CD1-CG2 3.7Å; A72-V76 WeakPolarHBondContact O-CG2 3.44Å; A72-V76 PolarHBondContact O-N 2.9Å; K73-V76 PolarHBondContact O-N 3.16Å; V76-K78 PolarHBondContact O-N 3.4Å; V76-R79 PolarHBondContact O-N 3.01Å; V76-L80 HydrophobicContact CG1-CD1 4.1Å; V76-L80 HydrophobicContact CG1-CG 4.49Å; V76-L80 WeakPolarHBondContact O-CG 3.41Å; V76-L80 PolarHBondContact O-N 2.92Å
77	A	98.1	Very high	97.7	Very high	38 Å²	38	65.3 Å²	65.3	31%	0.314	34%	0.335	S	S	.	.	H	α-helix	trans	-57.7	-47.3	175	0	0	0	0	0	112	K73 A74 R79 L80 E81	K73-A77 WeakPolarHBondContact O-CB 3.45Å; K73-A77 PolarHBondContact O-N 3.11Å; A74-A77 PolarHBondContact O-N 3.48Å; A77-R79 VanDerWaalsContact C-N 3.29Å; A77-R79 PolarHBondContact O-N 3.03Å; A77-L80 PolarHBondContact O-N 3.37Å; A77-L80 VanDerWaalsContact O-N 3.17Å; A77-E81 WeakPolarHBondContact O-CG 3.43Å; A77-E81 PolarHBondContact O-N 2.9Å
78	K	98.4	Very high	97.8	Very high	137 Å²	137	68.8 Å²	68.8	60%	0.596	35%	0.351	S	S	*	.	H	α-helix	trans	-61.4	-38.3	177.8	-163.2	76.4	-161.1	154.6	0	112.4	A74 T75 V76 E81 Y82	A74-K78 WeakPolarHBondContact O-CB 3.36Å; A74-K78 PolarHBondContact O-N 2.77Å; T75-K78 PolarHBondContact O-N 3.01Å; V76-K78 PolarHBondContact O-N 3.4Å; K78-E81 IonicContact NZ-OE2 3.36Å; K78-E81 PolarHBondContact NZ-OE2 3.1Å; K78-Y82 PolarHBondContact O-N 3.38Å; K78-Y82 VanDerWaalsContact O-N 3.14Å
79	R	98.3	Very high	97.8	Very high	150 Å²	150	70.6 Å²	70.6	57%	0.566	35%	0.351	S	S	*	.	H	α-helix	trans	-65.8	-43.5	175.6	174.6	170.5	-90.7	176.8	-7.5	111.4	N40 T75 V76 A77 Y82 I83	N40-R79 WeakPolarHBondContact OD1-CD 3.44Å; T75-R79 WeakPolarHBondContact O-CB 3.41Å; T75-R79 PolarHBondContact O-N 3.05Å; V76-R79 PolarHBondContact O-N 3.01Å; A77-R79 VanDerWaalsContact C-N 3.29Å; A77-R79 PolarHBondContact O-N 3.03Å; R79-Y82 PolarHBondContact O-N 3.31Å; R79-I83 HydrophobicContact CG-CD1 3.67Å; R79-I83 HydrophobicContact CG-CG1 4.28Å; R79-I83 VanDerWaalsContact O-CG1 3.27Å; R79-I83 WeakPolarHBondContact O-CG1 3.37Å; R79-I83 PolarHBondContact O-N 3.08Å
80	L	98.6	Very high	97.9	Very high	17 Å²	17	71.6 Å²	71.6	9%	0.089	35%	0.354	C	S	.	.	H	α-helix	trans	-61.2	-44.3	176.4	-70.9	168.1	0	0	0	111.7	M37 N40 N41 K44 V76 A77 Y82 I83 N84	M37-L80 HydrophobicContact SD-CB 4.48Å; M37-L80 HydrophobicContact SD-CD2 3.36Å; M37-L80 WeakPolarHBondContact SD-CD2 3.41Å; N40-L80 HydrophobicContact CB-CD2 3.53Å; N40-L80 HydrophobicContact CB-CG 4.08Å; N41-L80 VanDerWaalsContact OD1-CD2 3.32Å; N41-L80 WeakPolarHBondContact OD1-CD2 3.47Å; K44-L80 HydrophobicContact CB-CD1 4.06Å; K44-L80 HydrophobicContact CD-CD1 3.68Å; K44-L80 HydrophobicContact CG-CD1 4.33Å; V76-L80 HydrophobicContact CG1-CD1 4.1Å; V76-L80 HydrophobicContact CG1-CG 4.49Å; V76-L80 WeakPolarHBondContact O-CG 3.41Å; V76-L80 PolarHBondContact O-N 2.92Å; A77-L80 PolarHBondContact O-N 3.37Å; A77-L80 VanDerWaalsContact O-N 3.17Å; L80-Y82 VanDerWaalsContact C-N 3.33Å; L80-Y82 PolarHBondContact O-N 3.42Å; L80-I83 PolarHBondContact O-N 3.23Å; L80-N84 WeakPolarHBondContact O-CB 3.4Å; L80-N84 PolarHBondContact O-N 3.05Å
81	E	98.5	Very high	98	Very high	113 Å²	113	69.9 Å²	69.9	53%	0.528	34%	0.342	S	S	.	.	H	α-helix	trans	-54.7	-48.8	174	-73.3	174.6	-173.4	0	0	111.8	A77 K78 N84 G85	A77-E81 WeakPolarHBondContact O-CG 3.43Å; A77-E81 PolarHBondContact O-N 2.9Å; K78-E81 IonicContact NZ-OE2 3.36Å; K78-E81 PolarHBondContact NZ-OE2 3.1Å; E81-N84 PolarHBondContact O-N 2.93Å; E81-G85 PolarHBondContact O-N 3.4Å
82	Y	98.4	Very high	98.1	Very high	152 Å²	152	68.1 Å²	68.1	60%	0.596	34%	0.34	S	S	*	.	H	α-helix	trans	-62.8	-49	179.9	175.5	-92	0	0	0	112.1	K78 R79 L80 N84 G85 E86	K78-Y82 PolarHBondContact O-N 3.38Å; K78-Y82 VanDerWaalsContact O-N 3.14Å; R79-Y82 PolarHBondContact O-N 3.31Å; L80-Y82 VanDerWaalsContact C-N 3.33Å; L80-Y82 PolarHBondContact O-N 3.42Å; Y82-N84 VanDerWaalsContact C-N 3.26Å; Y82-N84 PolarHBondContact O-N 3.02Å; Y82-G85 PolarHBondContact O-N 3.34Å; Y82-E86 HydrophobicContact CD1-CG 4.32Å; Y82-E86 HydrophobicContact CE1-CG 3.74Å; Y82-E86 HydrophobicContact CE2-CG 4.21Å; Y82-E86 PolarHBondContact O-N 3.34Å
83	I	98.4	Very high	98.1	Very high	6 Å²	6	70 Å²	70	3%	0.031	35%	0.347	C	S	.	.	H	α-helix	trans	-60.8	-40.6	180	-64.4	167.9	0	0	0	109.8	L33 Q36 M37 R79 L80 E86 I87	L33-I83 HydrophobicContact CB-CG2 4.1Å; L33-I83 HydrophobicContact CD2-CG2 4.11Å; L33-I83 WeakPolarHBondContact O-CG2 3.38Å; Q36-I83 HydrophobicContact CB-CD1 4.06Å; M37-I83 HydrophobicContact CB-CG2 3.94Å; M37-I83 HydrophobicContact CE-CB 3.81Å; M37-I83 HydrophobicContact CE-CG2 3.62Å; M37-I83 HydrophobicContact SD-CB 4.49Å; M37-I83 HydrophobicContact SD-CG2 4.31Å; R79-I83 HydrophobicContact CG-CD1 3.67Å; R79-I83 HydrophobicContact CG-CG1 4.28Å; R79-I83 VanDerWaalsContact O-CG1 3.27Å; R79-I83 WeakPolarHBondContact O-CG1 3.37Å; R79-I83 PolarHBondContact O-N 3.08Å; L80-I83 PolarHBondContact O-N 3.23Å; I83-E86 PolarHBondContact O-N 3.31Å; I83-I87 HydrophobicContact CG2-CD1 4.04Å; I83-I87 HydrophobicContact CG2-CG1 4.45Å; I83-I87 WeakPolarHBondContact O-CG1 3.47Å; I83-I87 PolarHBondContact O-N 3Å
84	N	98.4	Very high	98.1	Very high	77 Å²	77	68.2 Å²	68.2	41%	0.412	34%	0.341	S	S	.	.	H	α-helix	trans	-64.7	-44	-179.8	-168.6	60	0	0	0	111.3	M37 L80 E81 Y82 E86 I87 Q88	M37-N84 VanDerWaalsContact CE-CA 3.42Å; M37-N84 HydrophobicContact CE-CB 3.53Å; L80-N84 WeakPolarHBondContact O-CB 3.4Å; L80-N84 PolarHBondContact O-N 3.05Å; E81-N84 PolarHBondContact O-N 2.93Å; Y82-N84 VanDerWaalsContact C-N 3.26Å; Y82-N84 PolarHBondContact O-N 3.02Å; N84-E86 VanDerWaalsContact C-N 3.32Å; N84-E86 PolarHBondContact O-N 3.1Å; N84-I87 PolarHBondContact O-N 3.25Å; N84-Q88 WeakPolarHBondContact O-CG 3.45Å; N84-Q88 PolarHBondContact O-N 2.8Å
85	G	98.5	Very high	98.2	Very high	33 Å²	33	71.6 Å²	71.6	34%	0.34	34%	0.344	S	S	.	.	H	α-helix	trans	-60.1	-41.6	174.3	0	0	0	0	0	112.5	E81 Y82 Q88 R89	E81-G85 PolarHBondContact O-N 3.4Å; Y82-G85 PolarHBondContact O-N 3.34Å; G85-Q88 PolarHBondContact O-N 3.42Å; G85-R89 PolarHBondContact O-N 2.79Å
86	E	98.4	Very high	98.2	Very high	35 Å²	35	71.9 Å²	71.9	16%	0.164	34%	0.343	C	S	.	.	H	α-helix	trans	-67.2	-38.8	176.8	-77.1	-67	96.4	0	0	112.8	L33 Y82 I83 N84 R89 Y90	L33-E86 HydrophobicContact CD1-CB 3.71Å; L33-E86 HydrophobicContact CD2-CB 4.39Å; Y82-E86 HydrophobicContact CD1-CG 4.32Å; Y82-E86 HydrophobicContact CE1-CG 3.74Å; Y82-E86 HydrophobicContact CE2-CG 4.21Å; Y82-E86 PolarHBondContact O-N 3.34Å; I83-E86 PolarHBondContact O-N 3.31Å; N84-E86 VanDerWaalsContact C-N 3.32Å; N84-E86 PolarHBondContact O-N 3.1Å; E86-R89 WeakPolarHBondContact O-CB 3.39Å; E86-R89 PolarHBondContact O-N 3.19Å; E86-R89 IonicContact OE1-CZ 2.77Å; E86-R89 IonicContact OE1-NE 2.88Å; E86-R89 PolarHBondContact OE1-NE 3.44Å; E86-R89 IonicContact OE1-NH2 3.36Å; E86-R89 IonicContact OE2-CZ 2.84Å; E86-R89 IonicContact OE2-NE 3.63Å; E86-R89 PolarHBondContact OE2-NE 3.11Å; E86-R89 IonicContact OE2-NH2 2.62Å; E86-R89 PolarHBondContact OE2-NH2 3.36Å; E86-Y90 VanDerWaalsContact O-CD2 3.24Å; E86-Y90 WeakPolarHBondContact O-CD2 3.38Å; E86-Y90 PolarHBondContact O-N 3.44Å
87	I	98.3	Very high	98.2	Very high	18 Å²	18	73.3 Å²	73.3	9%	0.092	35%	0.347	C	S	.	.	H	α-helix	trans	-59.1	-49.6	173.1	-71.9	171.7	0	0	0	110	R30 L33 E34 M37 I83 N84 R89 Y90 E91	R30-I87 HydrophobicContact CG-CG2 4.39Å; L33-I87 HydrophobicContact CB-CD1 4.21Å; L33-I87 HydrophobicContact CB-CG1 3.73Å; L33-I87 HydrophobicContact CD1-CG1 4.4Å; E34-I87 HydrophobicContact CG-CD1 4.21Å; M37-I87 HydrophobicContact CB-CD1 4.34Å; M37-I87 HydrophobicContact CE-CD1 4.07Å; I83-I87 HydrophobicContact CG2-CD1 4.04Å; I83-I87 HydrophobicContact CG2-CG1 4.45Å; I83-I87 WeakPolarHBondContact O-CG1 3.47Å; I83-I87 PolarHBondContact O-N 3Å; N84-I87 PolarHBondContact O-N 3.25Å; I87-R89 VanDerWaalsContact C-N 3.28Å; I87-R89 PolarHBondContact O-N 2.99Å; I87-Y90 PolarHBondContact O-N 3.42Å; I87-Y90 VanDerWaalsContact O-N 3.11Å; I87-E91 HydrophobicContact CG2-CG 4.43Å; I87-E91 WeakPolarHBondContact O-CG 3.23Å; I87-E91 PolarHBondContact O-N 2.92Å
88	Q	98.3	Very high	98.1	Very high	107 Å²	107	77.3 Å²	77.3	50%	0.5	36%	0.359	S	S	.	.	H	α-helix	trans	-60.2	-37.1	177.9	-71.3	-178.4	-18	0	0	112.6	N84 G85 E91 T92	N84-Q88 WeakPolarHBondContact O-CG 3.45Å; N84-Q88 PolarHBondContact O-N 2.8Å; G85-Q88 PolarHBondContact O-N 3.42Å; Q88-E91 PolarHBondContact O-N 3.39Å; Q88-T92 PolarHBondContact O-N 2.88Å; Q88-T92 PolarHBondContact O-OG1 3.08Å
89	R	98.3	Very high	98	Very high	121 Å²	121	76.8 Å²	76.8	46%	0.457	36%	0.357	S	S	.	.	H	α-helix	trans	-61.6	-46.9	173.8	-172.8	176.7	71	92.2	1.5	111.3	G85 E86 I87 T92 L93	G85-R89 PolarHBondContact O-N 2.79Å; E86-R89 WeakPolarHBondContact O-CB 3.39Å; E86-R89 PolarHBondContact O-N 3.19Å; E86-R89 IonicContact OE1-CZ 2.77Å; E86-R89 IonicContact OE1-NE 2.88Å; E86-R89 PolarHBondContact OE1-NE 3.44Å; E86-R89 IonicContact OE1-NH2 3.36Å; E86-R89 IonicContact OE2-CZ 2.84Å; E86-R89 IonicContact OE2-NE 3.63Å; E86-R89 PolarHBondContact OE2-NE 3.11Å; E86-R89 IonicContact OE2-NH2 2.62Å; E86-R89 PolarHBondContact OE2-NH2 3.36Å; I87-R89 VanDerWaalsContact C-N 3.28Å; I87-R89 PolarHBondContact O-N 2.99Å; R89-T92 PolarHBondContact O-N 2.98Å; R89-L93 WeakPolarHBondContact O-CB 3.34Å; R89-L93 PolarHBondContact O-N 2.87Å
90	Y	98.3	Very high	98	Very high	45 Å²	45	73.9 Å²	73.9	18%	0.176	35%	0.348	C	S	.	.	H	α-helix	trans	-67.1	-36	176.9	-81.4	-66.4	0	0	0	113	A29 L33 E86 I87 T92 L93 L94	A29-Y90 HydrophobicContact CB-CD1 4.46Å; A29-Y90 HydrophobicContact CB-CE1 3.81Å; A29-Y90 HydrophobicContact CB-CE2 3.94Å; L33-Y90 HydrophobicContact CD1-CD2 3.65Å; L33-Y90 HydrophobicContact CD1-CE2 3.68Å; E86-Y90 VanDerWaalsContact O-CD2 3.24Å; E86-Y90 WeakPolarHBondContact O-CD2 3.38Å; E86-Y90 PolarHBondContact O-N 3.44Å; I87-Y90 PolarHBondContact O-N 3.42Å; I87-Y90 VanDerWaalsContact O-N 3.11Å; Y90-T92 VanDerWaalsContact C-N 3.33Å; Y90-T92 PolarHBondContact O-N 3.42Å; Y90-L93 HydrophobicContact CD1-CD2 4.28Å; Y90-L93 HydrophobicContact CE1-CD2 4.49Å; Y90-L93 PolarHBondContact O-N 3.14Å; Y90-L94 WeakPolarHBondContact O-CB 3.38Å; Y90-L94 VanDerWaalsContact O-CG 3.23Å; Y90-L94 WeakPolarHBondContact O-CG 3.45Å; Y90-L94 PolarHBondContact O-N 3.13Å
91	E	97.2	Very high	97.9	Very high	81 Å²	81	73.7 Å²	73.7	38%	0.379	35%	0.348	S	S	.	.	H	α-helix	trans	-61.6	-42.5	173.7	-73.5	-175.3	162.4	0	0	112.1	I87 Q88 L94 K95	I87-E91 HydrophobicContact CG2-CG 4.43Å; I87-E91 WeakPolarHBondContact O-CG 3.23Å; I87-E91 PolarHBondContact O-N 2.92Å; Q88-E91 PolarHBondContact O-N 3.39Å; E91-L94 PolarHBondContact O-N 3.3Å; E91-K95 WeakPolarHBondContact O-CG 3.18Å; E91-K95 PolarHBondContact O-N 3.23Å
92	T	98.1	Very high	97.8	Very high	78 Å²	78	71 Å²	71	48%	0.479	34%	0.335	S	S	.	.	H	α-helix	trans	-63.4	-47.5	175.8	-57.1	0	0	0	0	110.6	Q88 R89 Y90 L94 K95 D96	Q88-T92 PolarHBondContact O-N 2.88Å; Q88-T92 PolarHBondContact O-OG1 3.08Å; R89-T92 PolarHBondContact O-N 2.98Å; Y90-T92 VanDerWaalsContact C-N 3.33Å; Y90-T92 PolarHBondContact O-N 3.42Å; T92-L94 VanDerWaalsContact C-N 3.33Å; T92-L94 PolarHBondContact O-N 2.88Å; T92-K95 WeakPolarHBondContact O-CB 3.38Å; T92-K95 PolarHBondContact O-N 2.93Å; T92-D96 PolarHBondContact O-N 3.39Å
93	L	97.7	Very high	97.7	Very high	49 Å²	49	69.8 Å²	69.8	26%	0.257	34%	0.335	S	S	.	.	H	α-helix	trans	-59.9	-42.3	178.3	-171.7	66.9	0	0	0	112.3	R89 Y90 D96 Y97	R89-L93 WeakPolarHBondContact O-CB 3.34Å; R89-L93 PolarHBondContact O-N 2.87Å; Y90-L93 HydrophobicContact CD1-CD2 4.28Å; Y90-L93 HydrophobicContact CE1-CD2 4.49Å; Y90-L93 PolarHBondContact O-N 3.14Å; L93-D96 PolarHBondContact O-N 3.09Å; L93-Y97 HydrophobicContact CD1-CE1 4.08Å; L93-Y97 HydrophobicContact CD1-CE2 3.95Å; L93-Y97 HydrophobicContact CD2-CE2 3.7Å; L93-Y97 HydrophobicContact CG-CD2 4.03Å; L93-Y97 HydrophobicContact CG-CE1 4.44Å; L93-Y97 HydrophobicContact CG-CE2 3.44Å; L93-Y97 VanDerWaalsContact CG-CE2 3.44Å; L93-Y97 WeakPolarHBondContact O-CD2 3.49Å; L93-Y97 PolarHBondContact O-N 3.03Å
94	L	98.2	Very high	97.6	Very high	23 Å²	23	69.9 Å²	69.9	12%	0.12	34%	0.336	C	S	.	.	H	α-helix	trans	-65.4	-39.1	177.1	-76.1	167.7	0	0	0	112.1	V23 V27 Y90 E91 T92 D96 Y97 H98	V23-L94 HydrophobicContact CG1-CD2 4.18Å; V27-L94 HydrophobicContact CG2-CD1 4.3Å; V27-L94 HydrophobicContact CG2-CD2 3.81Å; Y90-L94 WeakPolarHBondContact O-CB 3.38Å; Y90-L94 VanDerWaalsContact O-CG 3.23Å; Y90-L94 WeakPolarHBondContact O-CG 3.45Å; Y90-L94 PolarHBondContact O-N 3.13Å; E91-L94 PolarHBondContact O-N 3.3Å; T92-L94 VanDerWaalsContact C-N 3.33Å; T92-L94 PolarHBondContact O-N 2.88Å; L94-D96 VanDerWaalsContact C-N 3.31Å; L94-D96 PolarHBondContact O-N 3.49Å; L94-Y97 PolarHBondContact O-N 3.47Å; L94-H98 WeakPolarHBondContact O-CB 3.15Å; L94-H98 PolarHBondContact O-N 3.17Å
95	K	98.1	Very high	97.5	Very high	132 Å²	132	72.2 Å²	72.2	57%	0.574	34%	0.339	S	S	*	.	H	α-helix	trans	-61	-42.1	173.4	-74.6	171.5	-175.2	172.4	0	111.2	E91 T92 H98 K99	E91-K95 WeakPolarHBondContact O-CG 3.18Å; E91-K95 PolarHBondContact O-N 3.23Å; T92-K95 WeakPolarHBondContact O-CB 3.38Å; T92-K95 PolarHBondContact O-N 2.93Å; K95-H98 PolarHBondContact O-N 3.44Å; K95-K99 WeakPolarHBondContact O-CG 3.34Å; K95-K99 PolarHBondContact O-N 2.65Å
96	D	97.9	Very high	97.4	Very high	80 Å²	80	76.9 Å²	76.9	43%	0.428	35%	0.351	S	S	.	.	H	α-helix	trans	-69	-41.2	178.9	-68.2	-20.7	0	0	0	111.9	T92 L93 L94 H98 K99 K100	T92-D96 PolarHBondContact O-N 3.39Å; L93-D96 PolarHBondContact O-N 3.09Å; L94-D96 VanDerWaalsContact C-N 3.31Å; L94-D96 PolarHBondContact O-N 3.49Å; D96-H98 VanDerWaalsContact C-N 3.33Å; D96-H98 PolarHBondContact O-N 2.9Å; D96-K99 PolarHBondContact O-N 3.41Å; D96-K100 WeakPolarHBondContact O-CB 3.39Å; D96-K100 PolarHBondContact O-N 3.37Å
97	Y	98	Very high	97.3	Very high	47 Å²	47	78.4 Å²	78.4	18%	0.184	36%	0.363	C	S	.	.	H	α-helix	trans	-63.6	-37.1	172.9	-68	-29.8	0	0	0	113	T19 D22 V23 L93 L94 K100 S101	T19-Y97 HydrophobicContact CG2-CD1 4.49Å; D22-Y97 HydrophobicContact CB-CD2 4.42Å; D22-Y97 HydrophobicContact CB-CE1 4.33Å; D22-Y97 HydrophobicContact CB-CE2 3.78Å; V23-Y97 HydrophobicContact CG2-CD2 4.09Å; V23-Y97 HydrophobicContact CG2-CG 4.15Å; L93-Y97 HydrophobicContact CD1-CE1 4.08Å; L93-Y97 HydrophobicContact CD1-CE2 3.95Å; L93-Y97 HydrophobicContact CD2-CE2 3.7Å; L93-Y97 HydrophobicContact CG-CD2 4.03Å; L93-Y97 HydrophobicContact CG-CE1 4.44Å; L93-Y97 HydrophobicContact CG-CE2 3.44Å; L93-Y97 VanDerWaalsContact CG-CE2 3.44Å; L93-Y97 WeakPolarHBondContact O-CD2 3.49Å; L93-Y97 PolarHBondContact O-N 3.03Å; L94-Y97 PolarHBondContact O-N 3.47Å; Y97-K100 PolarHBondContact O-N 2.88Å; Y97-S101 VanDerWaalsContact O-CB 3.23Å; Y97-S101 WeakPolarHBondContact O-CB 3.36Å; Y97-S101 PolarHBondContact O-N 3.1Å
98	H	95.6	Very high	97.2	Very high	123 Å²	123	78.4 Å²	78.4	57%	0.569	36%	0.363	S	S	*	.	H	α-helix	trans	-62.8	-48	174.9	-171.8	-68.1	0	0	0	111	L94 K95 D96 K100 S101 E102	L94-H98 WeakPolarHBondContact O-CB 3.15Å; L94-H98 PolarHBondContact O-N 3.17Å; K95-H98 PolarHBondContact O-N 3.44Å; D96-H98 VanDerWaalsContact C-N 3.33Å; D96-H98 PolarHBondContact O-N 2.9Å; H98-K100 VanDerWaalsContact C-N 3.32Å; H98-K100 PolarHBondContact O-N 2.95Å; H98-S101 PolarHBondContact O-N 3.31Å; H98-E102 WeakPolarHBondContact O-CG 3.41Å; H98-E102 PolarHBondContact O-N 3.44Å
99	K	97.5	Very high	97.1	Very high	126 Å²	126	76.3 Å²	76.3	55%	0.548	36%	0.358	S	S	.	.	H	α-helix	trans	-58.4	-45.1	175.6	-70.6	172.3	-175.8	171.1	0	111.7	K95 D96 E102 Q103	K95-K99 WeakPolarHBondContact O-CG 3.34Å; K95-K99 PolarHBondContact O-N 2.65Å; D96-K99 PolarHBondContact O-N 3.41Å; K99-E102 PolarHBondContact O-N 3.5Å; K99-Q103 WeakPolarHBondContact O-CG 3.22Å; K99-Q103 PolarHBondContact O-N 2.84Å; K99-Q103 VanDerWaalsContact O-N 3.1Å
100	K	97.3	Very high	97	Very high	89 Å²	89	73.2 Å²	73.2	39%	0.387	36%	0.355	S	S	.	.	H	α-helix	trans	-61.4	-46.1	177	-174.4	-177.6	177.7	-166.5	0	111.1	T19 D96 Y97 H98 E102 Q103 Q104	T19-K100 HydrophobicContact CG2-CD 4.28Å; T19-K100 WeakPolarHBondContact OG1-CE 3.44Å; T19-K100 PolarHBondContact OG1-NZ 3.43Å; D96-K100 WeakPolarHBondContact O-CB 3.39Å; D96-K100 PolarHBondContact O-N 3.37Å; Y97-K100 PolarHBondContact O-N 2.88Å; H98-K100 VanDerWaalsContact C-N 3.32Å; H98-K100 PolarHBondContact O-N 2.95Å; K100-E102 VanDerWaalsContact C-N 3.34Å; K100-E102 PolarHBondContact O-N 2.98Å; K100-Q103 PolarHBondContact O-N 2.94Å; K100-Q104 HydrophobicContact CG-CG 4.38Å; K100-Q104 WeakPolarHBondContact O-CB 3.45Å; K100-Q104 WeakPolarHBondContact O-CG 3.21Å; K100-Q104 PolarHBondContact O-N 3.01Å
101	S	95.9	Very high	96.8	Very high	12 Å²	12	72.2 Å²	72.2	8%	0.084	35%	0.352	C	S	.	.	H	α-helix	trans	-60.3	-43.2	-180	-168.9	0	0	0	0	111.6	Y16 Q20 Y97 H98 Q104 R105	Y16-S101 WeakPolarHBondContact CE2-OG 3.4Å; Q20-S101 PolarHBondContact OE1-OG 3.12Å; Y97-S101 VanDerWaalsContact O-CB 3.23Å; Y97-S101 WeakPolarHBondContact O-CB 3.36Å; Y97-S101 PolarHBondContact O-N 3.1Å; H98-S101 PolarHBondContact O-N 3.31Å; S101-Q104 PolarHBondContact O-N 3.3Å; S101-R105 WeakPolarHBondContact O-CB 3.44Å; S101-R105 PolarHBondContact O-N 2.76Å
102	E	96.3	Very high	96.6	Very high	56 Å²	56	73 Å²	73	26%	0.262	36%	0.356	S	S	.	.	H	α-helix	trans	-61.8	-47.6	175.5	-72.1	-60.9	126.2	0	0	112.5	H98 K99 K100 Q104 R105 E106	H98-E102 WeakPolarHBondContact O-CG 3.41Å; H98-E102 PolarHBondContact O-N 3.44Å; K99-E102 PolarHBondContact O-N 3.5Å; K100-E102 VanDerWaalsContact C-N 3.34Å; K100-E102 PolarHBondContact O-N 2.98Å; E102-Q104 VanDerWaalsContact C-N 3.33Å; E102-Q104 PolarHBondContact O-N 2.92Å; E102-R105 WeakPolarHBondContact O-CB 3.34Å; E102-R105 PolarHBondContact O-N 2.95Å; E102-R105 IonicContact OE1-CZ 3.61Å; E102-R105 IonicContact OE1-NE 3.65Å; E102-R105 IonicContact OE1-NH1 3.97Å; E102-R105 IonicContact OE1-NH2 2.72Å; E102-R105 IonicContact OE2-CZ 3.94Å; E102-R105 IonicContact OE2-NE 3.52Å; E102-R105 IonicContact OE2-NH1 3.63Å; E102-R105 IonicContact OE2-NH2 3.2Å; E102-R105 PolarHBondContact OE2-NH2 3.38Å; E102-E106 PolarHBondContact O-N 2.97Å
103	Q	96.7	Very high	96.4	Very high	127 Å²	127	74 Å²	74	59%	0.593	36%	0.355	S	S	*	.	H	α-helix	trans	-60	-42.9	176.1	-71.1	173.4	-11.6	0	0	112.1	K99 K100 R105 E106 V107	K99-Q103 WeakPolarHBondContact O-CG 3.22Å; K99-Q103 PolarHBondContact O-N 2.84Å; K99-Q103 VanDerWaalsContact O-N 3.1Å; K100-Q103 PolarHBondContact O-N 2.94Å; Q103-R105 VanDerWaalsContact C-N 3.31Å; Q103-R105 PolarHBondContact O-N 3.24Å; Q103-E106 PolarHBondContact O-N 3.35Å; Q103-V107 WeakPolarHBondContact O-CG2 3.43Å; Q103-V107 PolarHBondContact O-N 3.35Å; Q103-V107 VanDerWaalsContact O-N 3.09Å
104	Q	96.5	Very high	96.1	Very high	9 Å²	9	74.7 Å²	74.7	4%	0.042	36%	0.359	C	S	.	.	H	α-helix	trans	-64.8	-38	177.8	-69.5	-175.4	-62.2	0	0	111.6	E12 Y16 T19 K100 S101 E102 V107 L108	E12-Q104 WeakPolarHBondContact OE1-CG 3.39Å; E12-Q104 PolarHBondContact OE1-NE2 3.41Å; E12-Q104 VanDerWaalsContact OE1-NE2 3.08Å; Y16-Q104 HydrophobicContact CD2-CB 3.86Å; T19-Q104 PolarHBondContact OG1-OE1 3.22Å; K100-Q104 HydrophobicContact CG-CG 4.38Å; K100-Q104 WeakPolarHBondContact O-CB 3.45Å; K100-Q104 WeakPolarHBondContact O-CG 3.21Å; K100-Q104 PolarHBondContact O-N 3.01Å; S101-Q104 PolarHBondContact O-N 3.3Å; E102-Q104 VanDerWaalsContact C-N 3.33Å; E102-Q104 PolarHBondContact O-N 2.92Å; Q104-V107 PolarHBondContact O-N 3.32Å; Q104-L108 WeakPolarHBondContact O-CB 3.37Å; Q104-L108 VanDerWaalsContact O-CG 3.22Å; Q104-L108 WeakPolarHBondContact O-CG 3.35Å; Q104-L108 PolarHBondContact O-N 2.92Å
105	R	95.6	Very high	95.8	Very high	126 Å²	126	74.7 Å²	74.7	48%	0.475	36%	0.359	S	S	.	.	H	α-helix	trans	-62.4	-45.4	175.6	-170.5	-179.6	71	173.9	2.4	111.5	S101 E102 Q103 V107 L108 T109	S101-R105 WeakPolarHBondContact O-CB 3.44Å; S101-R105 PolarHBondContact O-N 2.76Å; E102-R105 WeakPolarHBondContact O-CB 3.34Å; E102-R105 PolarHBondContact O-N 2.95Å; E102-R105 IonicContact OE1-CZ 3.61Å; E102-R105 IonicContact OE1-NE 3.65Å; E102-R105 IonicContact OE1-NH1 3.97Å; E102-R105 IonicContact OE1-NH2 2.72Å; E102-R105 IonicContact OE2-CZ 3.94Å; E102-R105 IonicContact OE2-NE 3.52Å; E102-R105 IonicContact OE2-NH1 3.63Å; E102-R105 IonicContact OE2-NH2 3.2Å; E102-R105 PolarHBondContact OE2-NH2 3.38Å; Q103-R105 VanDerWaalsContact C-N 3.31Å; Q103-R105 PolarHBondContact O-N 3.24Å; R105-V107 PolarHBondContact O-N 3.48Å; R105-L108 PolarHBondContact O-N 3.25Å; R105-T109 PolarHBondContact O-N 3.41Å; R105-T109 PolarHBondContact O-OG1 2.97Å; R105-T109 VanDerWaalsContact O-OG1 3.1Å
106	E	96.8	Very high	95.4	Very high	130 Å²	130	73.8 Å²	73.8	61%	0.607	36%	0.357	S	S	*	.	H	α-helix	trans	-59.4	-46.4	176.1	-70.5	175	-177.1	0	0	111.8	E102 Q103 L108 T109 S110	E102-E106 PolarHBondContact O-N 2.97Å; Q103-E106 PolarHBondContact O-N 3.35Å; E106-L108 PolarHBondContact O-N 3.1Å; E106-T109 PolarHBondContact O-N 3.05Å; E106-S110 PolarHBondContact O-N 2.9Å
107	V	96.4	Very high	95	Very high	67 Å²	67	77.2 Å²	77.2	41%	0.406	37%	0.368	S	S	.	.	H	α-helix	trans	-62.5	-43.1	177.1	174.6	0	0	0	0	111.2	E12 Q103 Q104 R105 S110 L111	E12-V107 HydrophobicContact CG-CB 4.47Å; E12-V107 HydrophobicContact CG-CG1 4.02Å; Q103-V107 WeakPolarHBondContact O-CG2 3.43Å; Q103-V107 PolarHBondContact O-N 3.35Å; Q103-V107 VanDerWaalsContact O-N 3.09Å; Q104-V107 PolarHBondContact O-N 3.32Å; R105-V107 PolarHBondContact O-N 3.48Å; V107-S110 PolarHBondContact O-N 3.35Å; V107-L111 HydrophobicContact CG1-CD1 3.84Å; V107-L111 HydrophobicContact CG1-CG 4.29Å; V107-L111 WeakPolarHBondContact O-CB 3.26Å; V107-L111 VanDerWaalsContact O-CG 3.31Å; V107-L111 WeakPolarHBondContact O-CG 3.39Å; V107-L111 PolarHBondContact O-N 2.9Å
108	L	96.3	Very high	94.4	Very high	18 Å²	18	77.1 Å²	77.1	9%	0.094	38%	0.377	C	S	.	.	H	α-helix	trans	-60.7	-45.5	176.5	-77.4	171.3	0	0	0	111.7	L9 E12 V13 Y16 Q104 R105 E106 L111 Q112	L9-L108 HydrophobicContact CD1-CD2 3.75Å; E12-L108 HydrophobicContact CB-CD2 3.79Å; E12-L108 HydrophobicContact CB-CG 4.36Å; E12-L108 HydrophobicContact CG-CD2 4.07Å; E12-L108 HydrophobicContact CG-CG 4.07Å; V13-L108 HydrophobicContact CG2-CD2 3.57Å; Y16-L108 HydrophobicContact CD1-CD1 4.5Å; Y16-L108 HydrophobicContact CD2-CD1 4.33Å; Y16-L108 HydrophobicContact CG-CD1 4.02Å; Q104-L108 WeakPolarHBondContact O-CB 3.37Å; Q104-L108 VanDerWaalsContact O-CG 3.22Å; Q104-L108 WeakPolarHBondContact O-CG 3.35Å; Q104-L108 PolarHBondContact O-N 2.92Å; R105-L108 PolarHBondContact O-N 3.25Å; E106-L108 PolarHBondContact O-N 3.1Å; L108-L111 PolarHBondContact O-N 3.36Å; L108-Q112 WeakPolarHBondContact O-CB 3.38Å; L108-Q112 VanDerWaalsContact O-CG 3.26Å; L108-Q112 WeakPolarHBondContact O-CG 3.31Å; L108-Q112 PolarHBondContact O-N 3.4Å
109	T	95.8	Very high	93.8	Very high	63 Å²	63	76.2 Å²	76.2	39%	0.387	37%	0.373	S	S	.	.	H	α-helix	trans	-61.1	-45	176.8	-61.5	0	0	0	0	111.4	R105 E106 Q112 Q113	R105-T109 PolarHBondContact O-N 3.41Å; R105-T109 PolarHBondContact O-OG1 2.97Å; R105-T109 VanDerWaalsContact O-OG1 3.1Å; E106-T109 PolarHBondContact O-N 3.05Å; T109-Q112 PolarHBondContact O-N 3.28Å; T109-Q113 WeakPolarHBondContact O-CG 3.43Å; T109-Q113 PolarHBondContact O-N 2.92Å
110	S	95.9	Very high	92.5	Very high	57 Å²	57	73 Å²	73	40%	0.399	38%	0.375	S	S	.	.	H	α-helix	trans	-61.9	-45.7	176.6	-173.5	0	0	0	0	112	E106 V107 Q112 Q113 D114	E106-S110 PolarHBondContact O-N 2.9Å; V107-S110 PolarHBondContact O-N 3.35Å; S110-Q112 VanDerWaalsContact C-N 3.31Å; S110-Q112 PolarHBondContact O-N 3.33Å; S110-Q113 PolarHBondContact O-N 3.34Å; S110-D114 PolarHBondContact O-N 3.4Å
111	L	95.2	Very high	90.7	Very high	24 Å²	24	74.2 Å²	74.2	13%	0.126	39%	0.386	C	S	.	.	H	α-helix	trans	-64	-36	178.8	-73.5	172	0	0	0	112.3	I5 K8 L9 E12 V107 L108 L115	I5-L111 HydrophobicContact CG2-CD2 4.34Å; K8-L111 HydrophobicContact CB-CD1 4.27Å; K8-L111 HydrophobicContact CB-CD2 4.23Å; L9-L111 HydrophobicContact CD1-CB 3.89Å; E12-L111 HydrophobicContact CB-CD1 4.38Å; V107-L111 HydrophobicContact CG1-CD1 3.84Å; V107-L111 HydrophobicContact CG1-CG 4.29Å; V107-L111 WeakPolarHBondContact O-CB 3.26Å; V107-L111 VanDerWaalsContact O-CG 3.31Å; V107-L111 WeakPolarHBondContact O-CG 3.39Å; V107-L111 PolarHBondContact O-N 2.9Å; L108-L111 PolarHBondContact O-N 3.36Å; L111-L115 WeakPolarHBondContact O-CB 3.44Å; L111-L115 PolarHBondContact O-N 3.2Å
112	Q	92.2	Very high	88.5	Confident	97 Å²	97	79.3 Å²	79.3	45%	0.453	42%	0.417	S	S	.	.	H	α-helix	trans	-65.4	-43.7	174.6	-75.6	173.9	-8.4	0	0	111.7	L9 L108 T109 S110 L115 Q116	L9-Q112 HydrophobicContact CD1-CG 3.89Å; L9-Q112 HydrophobicContact CD2-CG 4.44Å; L108-Q112 WeakPolarHBondContact O-CB 3.38Å; L108-Q112 VanDerWaalsContact O-CG 3.26Å; L108-Q112 WeakPolarHBondContact O-CG 3.31Å; L108-Q112 PolarHBondContact O-N 3.4Å; T109-Q112 PolarHBondContact O-N 3.28Å; S110-Q112 VanDerWaalsContact C-N 3.31Å; S110-Q112 PolarHBondContact O-N 3.33Å; Q112-L115 PolarHBondContact O-N 3.46Å; Q112-Q116 WeakPolarHBondContact O-CG 3.26Å; Q112-Q116 PolarHBondContact O-N 3.08Å; Q112-Q116 VanDerWaalsContact O-N 3.08Å
113	Q	93.7	Very high	86.4	Confident	98 Å²	98	82.5 Å²	82.5	46%	0.458	44%	0.442	S	S	.	.	H	α-helix	trans	-63.3	-43.1	175.9	-70.8	176.2	1.7	0	0	111.9	T109 S110 L115 Q116 K117	T109-Q113 WeakPolarHBondContact O-CG 3.43Å; T109-Q113 PolarHBondContact O-N 2.92Å; S110-Q113 PolarHBondContact O-N 3.34Å; Q113-L115 VanDerWaalsContact C-N 3.34Å; Q113-Q116 PolarHBondContact O-N 3.4Å; Q113-K117 WeakPolarHBondContact O-CG 3.45Å; Q113-K117 PolarHBondContact O-N 2.9Å; Q113-K117 VanDerWaalsContact O-N 3.1Å
114	D	91.7	Very high	84	Confident	64 Å²	64	79.6 Å²	79.6	34%	0.342	45%	0.446	S	S	.	.	H	α-helix	trans	-66.7	-36.8	178.6	-71.1	-18.3	0	0	0	112.1	I5 S110 K117 A118	I5-D114 HydrophobicContact CD1-CB 4.3Å; S110-D114 PolarHBondContact O-N 3.4Å; D114-K117 PolarHBondContact O-N 3.26Å; D114-A118 VanDerWaalsContact O-CB 3.26Å; D114-A118 WeakPolarHBondContact O-CB 3.38Å; D114-A118 PolarHBondContact O-N 3.45Å
115	L	91.9	Very high	81.5	Confident	23 Å²	23	89.2 Å²	89.2	12%	0.12	49%	0.488	C	S	.	.	H	α-helix	trans	-64.4	-43.6	174.9	-173.4	62.5	0	0	0	111.6	A2 I5 L9 L111 Q112 Q113 K117 A118 Q119	A2-L115 HydrophobicContact CB-CD1 4.37Å; I5-L115 HydrophobicContact CB-CD1 4.33Å; I5-L115 HydrophobicContact CG2-CB 3.84Å; I5-L115 HydrophobicContact CG2-CD1 4.14Å; L9-L115 HydrophobicContact CD2-CD2 4.05Å; L111-L115 WeakPolarHBondContact O-CB 3.44Å; L111-L115 PolarHBondContact O-N 3.2Å; Q112-L115 PolarHBondContact O-N 3.46Å; Q113-L115 VanDerWaalsContact C-N 3.34Å; L115-K117 PolarHBondContact O-N 3.36Å; L115-A118 PolarHBondContact O-N 3.35Å; L115-Q119 HydrophobicContact CD1-CG 4.28Å; L115-Q119 WeakPolarHBondContact O-CB 3.41Å; L115-Q119 WeakPolarHBondContact O-CG 3.36Å; L115-Q119 PolarHBondContact O-N 3.36Å
116	Q	89.9	Confident	78.7	Confident	113 Å²	113	93.4 Å²	93.4	53%	0.528	53%	0.527	S	S	.	.	H	α-helix	trans	-59.3	-46.1	176.4	-74.1	174.6	9.3	0	0	111.6	Q112 Q113 Q119 G120 L121	Q112-Q116 WeakPolarHBondContact O-CG 3.26Å; Q112-Q116 PolarHBondContact O-N 3.08Å; Q112-Q116 VanDerWaalsContact O-N 3.08Å; Q113-Q116 PolarHBondContact O-N 3.4Å; Q116-Q119 PolarHBondContact O-N 3.1Å; Q116-G120 PolarHBondContact O-N 2.98Å; Q116-L121 PolarHBondContact O-N 3.26Å
117	K	89.5	Confident	77.8	Confident	152 Å²	152	91.6 Å²	91.6	66%	0.661	52%	0.523	S	S	*	.	H	α-helix	trans	-61.2	-44.8	175.3	-68.3	170.7	-171.9	166.8	0	111.7	Q113 D114 L115 Q119 G120	Q113-K117 WeakPolarHBondContact O-CG 3.45Å; Q113-K117 PolarHBondContact O-N 2.9Å; Q113-K117 VanDerWaalsContact O-N 3.1Å; D114-K117 PolarHBondContact O-N 3.26Å; L115-K117 PolarHBondContact O-N 3.36Å; K117-Q119 VanDerWaalsContact C-N 3.27Å; K117-Q119 PolarHBondContact O-N 3.49Å; K117-G120 PolarHBondContact O-N 3.37Å
118	A	85.8	Confident	76.8	Confident	45 Å²	45	92.8 Å²	92.8	37%	0.372	53%	0.529	S	S	.	.	H	α-helix	trans	-69	-22.3	-178.7	0	0	0	0	0	113.8	A2 I5 D114 L115	A2-A118 HydrophobicContact CB-CB 4.33Å; I5-A118 HydrophobicContact CD1-CB 4.04Å; D114-A118 VanDerWaalsContact O-CB 3.26Å; D114-A118 WeakPolarHBondContact O-CB 3.38Å; D114-A118 PolarHBondContact O-N 3.45Å; L115-A118 PolarHBondContact O-N 3.35Å
119	Q	83.6	Confident	75.7	Confident	105 Å²	105	97 Å²	97	49%	0.491	55%	0.553	S	S	.	*	T	Hydrogen-bonded Turn	trans	-91.2	0.6	176.8	-72	179.8	-19	0	0	113.5	L115 Q116 K117 L121	L115-Q119 HydrophobicContact CD1-CG 4.28Å; L115-Q119 WeakPolarHBondContact O-CB 3.41Å; L115-Q119 WeakPolarHBondContact O-CG 3.36Å; L115-Q119 PolarHBondContact O-N 3.36Å; Q116-Q119 PolarHBondContact O-N 3.1Å; K117-Q119 VanDerWaalsContact C-N 3.27Å; K117-Q119 PolarHBondContact O-N 3.49Å; Q119-L121 HydrophobicContact CB-CD1 4.36Å; Q119-L121 PolarHBondContact O-N 3.26Å
120	G	68.7	Low	74.5	Confident	58 Å²	58	99 Å²	99	60%	0.598	56%	0.563	S	S	*	*	T	Hydrogen-bonded Turn	trans	69.3	13.6	179.4	0	0	0	0	0	114.2	Q116 K117 T122	Q116-G120 PolarHBondContact O-N 2.98Å; K117-G120 PolarHBondContact O-N 3.37Å; G120-T122 PolarHBondContact O-N 2.92Å
121	L	60.1	Low	73.2	Confident	115 Å²	115	101.6 Å²	101.6	60%	0.602	57%	0.573	S	S	*	*			trans	-75.3	76.3	169.5	-75.3	159.4	0	0	0	108.3	Q116 Q119	Q116-L121 PolarHBondContact O-N 3.26Å; Q119-L121 HydrophobicContact CB-CD1 4.36Å; Q119-L121 PolarHBondContact O-N 3.26Å
122	T	50.1	Low	71.7	Confident	119 Å²	119	106.8 Å²	106.8	73%	0.73	60%	0.603	S	S	*	*	P	Polyproline II helix	trans	-60.2	136.1	160.8	37.6	0	0	0	0	108.4	G120 G124	G120-T122 PolarHBondContact O-N 2.92Å; T122-G124 PolarHBondContact O-N 3.06Å
123	P	51.2	Low	70.2	Confident	122 Å²	122	107.5 Å²	107.5	79%	0.792	61%	0.614	S	S	*	*	P	Polyproline II helix	trans	-55.5	121.9	164.5	-0.5	9.9	0	0	0	106.4	K125	P123-K125 PolarHBondContact O-N 3.12Å; P123-K125 VanDerWaalsContact O-N 3.12Å
124	G	47.6	Very low	68.4	Low	66 Å²	66	108.2 Å²	108.2	68%	0.68	63%	0.625	S	S	*	*	P	Polyproline II helix	trans	-49.6	123.6	177.6	0	0	0	0	0	109.1	T122 V126	T122-G124 PolarHBondContact O-N 3.06Å; G124-V126 PolarHBondContact O-N 3.21Å
125	K	43.4	Very low	66.5	Low	211 Å²	211	111.9 Å²	111.9	92%	0.917	65%	0.649	S	S	*	*	P	Polyproline II helix	trans	-56.1	120.4	162.6	-74.3	179.6	173.5	-178.3	0	107.1	P123	P123-K125 PolarHBondContact O-N 3.12Å; P123-K125 VanDerWaalsContact O-N 3.12Å
126	V	35.9	Very low	64.2	Low	214 Å²	214	120 Å²	120	100%	1.297	70%	0.697	S	S	*	*			trans	-107.5	0	150.8	-169.2	0	0	0	0	105.9	G124	G124-V126 PolarHBondContact O-N 3.21Å

Retrieved 126 of 126 residues in 210.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).