A0A087X5R3_POEFO Loading...

Small integral membrane protein 13

AlphaFold DB , UniProt , Accession A0A087X5R3, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 86 aa.

						>A0A087X5R3_POEFO|A0A087X5R3
MWQSLGLTLLVIVATLLCVLLFMLFGWYVVWQLFLSKFKFLRELVGDAGTPQAETRPSEPEHPAGAPTRTRNRTARQRVSFPESNL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63.7	Low	87	Confident	204 Å²	204	123.2 Å²	123.2	100%	1.005	65%	0.645	S	S	*	*				0	-40.6	0	-69	-179.5	145.5	0	0	113.3	Q3 S4 L5	M1-Q3 PolarHBondContact O-N 2.9Å; M1-S4 PolarHBondContact O-N 3.42Å; M1-L5 PolarHBondContact O-N 2.72Å
2	W	79.9	Confident	87.8	Confident	226 Å²	226	120.2 Å²	120.2	86%	0.856	63%	0.629	S	S	*	*	H	α-helix	trans	-61.5	-37.2	179.4	-151.4	-39.7	0	0	0	114.3	S4 L5 G6	W2-S4 PolarHBondContact O-N 2.75Å; W2-L5 WeakPolarHBondContact O-CB 3.44Å; W2-L5 PolarHBondContact O-N 3.06Å; W2-G6 PolarHBondContact O-N 3.28Å
3	Q	79.7	Confident	88.5	Confident	166 Å²	166	116.5 Å²	116.5	78%	0.776	61%	0.614	S	S	*	*	H	α-helix	trans	-64.3	-40.5	-179.9	-67.6	-177.6	-56.4	0	0	113	M1 L5 G6 L7	M1-Q3 PolarHBondContact O-N 2.9Å; Q3-L5 VanDerWaalsContact C-N 3.3Å; Q3-L5 PolarHBondContact O-N 2.7Å; Q3-G6 PolarHBondContact O-N 3.38Å; Q3-L7 PolarHBondContact O-N 3.01Å
4	S	85.5	Confident	89	Confident	75 Å²	75	111.3 Å²	111.3	52%	0.524	60%	0.596	S	S	.	*	H	α-helix	trans	-64.3	-37	176.3	-46.7	0	0	0	0	111.7	M1 W2 T8	M1-S4 PolarHBondContact O-N 3.42Å; W2-S4 PolarHBondContact O-N 2.75Å; S4-T8 WeakPolarHBondContact O-CB 3.15Å; S4-T8 PolarHBondContact O-N 3.07Å; S4-T8 PolarHBondContact O-OG1 2.66Å
5	L	89.2	Confident	89.5	Confident	121 Å²	121	109.1 Å²	109.1	63%	0.634	59%	0.588	S	S	*	*	H	α-helix	trans	-65.3	-44.6	174.4	-70.4	164.6	0	0	0	111.4	M1 W2 Q3 T8 L9	M1-L5 PolarHBondContact O-N 2.72Å; W2-L5 WeakPolarHBondContact O-CB 3.44Å; W2-L5 PolarHBondContact O-N 3.06Å; Q3-L5 VanDerWaalsContact C-N 3.3Å; Q3-L5 PolarHBondContact O-N 2.7Å; L5-T8 PolarHBondContact O-N 3.41Å; L5-L9 WeakPolarHBondContact O-CB 3.19Å; L5-L9 PolarHBondContact O-N 2.68Å
6	G	89.4	Confident	90	Very high	41 Å²	41	109.3 Å²	109.3	42%	0.423	59%	0.588	S	S	.	*	H	α-helix	trans	-64.4	-44.6	178.4	0	0	0	0	0	113.4	W2 Q3 L9 L10	W2-G6 PolarHBondContact O-N 3.28Å; Q3-G6 PolarHBondContact O-N 3.38Å; G6-L9 PolarHBondContact O-N 3.4Å; G6-L10 WeakPolarHBondContact O-CB 2.95Å; G6-L10 PolarHBondContact O-N 3.14Å
7	L	92.6	Very high	90.3	Very high	121 Å²	121	108.1 Å²	108.1	63%	0.634	58%	0.581	S	S	*	*	H	α-helix	trans	-62	-46.3	176.1	-77.9	161.5	0	0	0	111.7	Q3 L9 L10 V11	Q3-L7 PolarHBondContact O-N 3.01Å; L7-L9 PolarHBondContact O-N 2.96Å; L7-L10 PolarHBondContact O-N 3.33Å; L7-V11 WeakPolarHBondContact O-CG2 3.16Å; L7-V11 PolarHBondContact O-N 2.82Å
8	T	92.8	Very high	90.6	Very high	82 Å²	82	106.8 Å²	106.8	50%	0.503	58%	0.58	S	S	.	*	H	α-helix	trans	-64.5	-42.2	179	-51.7	0	0	0	0	111	S4 L5 V11 I12	S4-T8 WeakPolarHBondContact O-CB 3.15Å; S4-T8 PolarHBondContact O-N 3.07Å; S4-T8 PolarHBondContact O-OG1 2.66Å; L5-T8 PolarHBondContact O-N 3.41Å; T8-V11 PolarHBondContact O-N 3.03Å; T8-I12 HydrophobicContact CG2-CD1 3.94Å; T8-I12 WeakPolarHBondContact O-CB 3.16Å; T8-I12 WeakPolarHBondContact O-CD1 3.39Å; T8-I12 WeakPolarHBondContact O-CG1 3.13Å; T8-I12 PolarHBondContact O-N 3.45Å
9	L	94.5	Very high	90.9	Very high	113 Å²	113	106.1 Å²	106.1	59%	0.592	58%	0.58	S	S	*	*	H	α-helix	trans	-66.4	-39.4	179	-159.6	146	0	0	0	111.4	L5 G6 L7 I12 V13	L5-L9 WeakPolarHBondContact O-CB 3.19Å; L5-L9 PolarHBondContact O-N 2.68Å; G6-L9 PolarHBondContact O-N 3.4Å; L7-L9 PolarHBondContact O-N 2.96Å; L9-I12 PolarHBondContact O-N 2.83Å; L9-V13 HydrophobicContact CD2-CG2 4.07Å; L9-V13 WeakPolarHBondContact O-CB 3.27Å; L9-V13 VanDerWaalsContact O-CG2 3.23Å; L9-V13 WeakPolarHBondContact O-CG2 3.32Å; L9-V13 PolarHBondContact O-N 3.39Å
10	L	95.1	Very high	91.2	Very high	119 Å²	119	105.7 Å²	105.7	62%	0.623	58%	0.576	S	S	*	*	H	α-helix	trans	-64.6	-42.8	174.2	-168.9	150.2	0	0	0	111.6	G6 L7 V13 A14	G6-L10 WeakPolarHBondContact O-CB 2.95Å; G6-L10 PolarHBondContact O-N 3.14Å; L7-L10 PolarHBondContact O-N 3.33Å; L10-V13 PolarHBondContact O-N 2.97Å; L10-A14 VanDerWaalsContact O-CB 3.24Å; L10-A14 WeakPolarHBondContact O-CB 2.84Å; L10-A14 PolarHBondContact O-N 3.2Å
11	V	94.9	Very high	91.3	Very high	87 Å²	87	105.6 Å²	105.6	53%	0.527	58%	0.575	S	S	.	*	H	α-helix	trans	-61.4	-45.5	174.6	166.9	0	0	0	0	110.8	L7 T8 V13 A14 T15	L7-V11 WeakPolarHBondContact O-CG2 3.16Å; L7-V11 PolarHBondContact O-N 2.82Å; T8-V11 PolarHBondContact O-N 3.03Å; V11-V13 PolarHBondContact O-N 3.37Å; V11-A14 PolarHBondContact O-N 2.64Å; V11-T15 WeakPolarHBondContact O-CB 3.28Å; V11-T15 PolarHBondContact O-N 3.34Å; V11-T15 PolarHBondContact O-OG1 2.67Å
12	I	95.8	Very high	92.8	Very high	87 Å²	87	104 Å²	104	45%	0.446	56%	0.562	S	S	.	*	H	α-helix	trans	-58.4	-50.7	176.7	-71.2	164.7	0	0	0	110	T8 L9 A14 T15 L16	T8-I12 HydrophobicContact CG2-CD1 3.94Å; T8-I12 WeakPolarHBondContact O-CB 3.16Å; T8-I12 WeakPolarHBondContact O-CD1 3.39Å; T8-I12 WeakPolarHBondContact O-CG1 3.13Å; T8-I12 PolarHBondContact O-N 3.45Å; L9-I12 PolarHBondContact O-N 2.83Å; I12-A14 PolarHBondContact O-N 2.72Å; I12-T15 PolarHBondContact O-N 3.43Å; I12-L16 HydrophobicContact CG2-CD1 3.48Å; I12-L16 VanDerWaalsContact CG2-CD1 3.48Å; I12-L16 WeakPolarHBondContact O-CB 3.38Å; I12-L16 WeakPolarHBondContact O-CD1 3.29Å; I12-L16 PolarHBondContact O-N 2.64Å
13	V	97	Very high	93.6	Very high	72 Å²	72	98.8 Å²	98.8	44%	0.436	55%	0.549	S	S	.	.	H	α-helix	trans	-61.3	-45	179.7	170.9	0	0	0	0	111.5	L9 L10 V11 T15 L16 L17	L9-V13 HydrophobicContact CD2-CG2 4.07Å; L9-V13 WeakPolarHBondContact O-CB 3.27Å; L9-V13 VanDerWaalsContact O-CG2 3.23Å; L9-V13 WeakPolarHBondContact O-CG2 3.32Å; L9-V13 PolarHBondContact O-N 3.39Å; L10-V13 PolarHBondContact O-N 2.97Å; V11-V13 PolarHBondContact O-N 3.37Å; V13-T15 VanDerWaalsContact C-N 3.34Å; V13-T15 PolarHBondContact O-N 2.75Å; V13-L16 PolarHBondContact O-N 2.82Å; V13-L17 HydrophobicContact CG1-CD1 4.04Å; V13-L17 WeakPolarHBondContact O-CB 3.31Å; V13-L17 PolarHBondContact O-N 3.32Å
14	A	96.3	Very high	94.2	Very high	44 Å²	44	94.1 Å²	94.1	36%	0.364	53%	0.529	S	S	.	.	H	α-helix	trans	-61.8	-43.1	177	0	0	0	0	0	111.5	L10 V11 I12 L17 C18	L10-A14 VanDerWaalsContact O-CB 3.24Å; L10-A14 WeakPolarHBondContact O-CB 2.84Å; L10-A14 PolarHBondContact O-N 3.2Å; V11-A14 PolarHBondContact O-N 2.64Å; I12-A14 PolarHBondContact O-N 2.72Å; A14-L17 PolarHBondContact O-N 3.02Å; A14-C18 WeakPolarHBondContact O-CB 3.05Å; A14-C18 PolarHBondContact O-N 3.24Å; A14-C18 PolarHBondContact O-SG 3.39Å; A14-C18 VanDerWaalsContact O-SG 3.42Å
15	T	96.2	Very high	94.5	Very high	78 Å²	78	97.6 Å²	97.6	48%	0.479	54%	0.535	S	S	.	.	H	α-helix	trans	-65.9	-43.6	178.1	-47.2	0	0	0	0	110.8	V11 I12 V13 L17 C18 V19	V11-T15 WeakPolarHBondContact O-CB 3.28Å; V11-T15 PolarHBondContact O-N 3.34Å; V11-T15 PolarHBondContact O-OG1 2.67Å; I12-T15 PolarHBondContact O-N 3.43Å; V13-T15 VanDerWaalsContact C-N 3.34Å; V13-T15 PolarHBondContact O-N 2.75Å; T15-L17 PolarHBondContact O-N 3.42Å; T15-C18 PolarHBondContact O-N 2.65Å; T15-V19 VanDerWaalsContact O-CG2 3.31Å; T15-V19 WeakPolarHBondContact O-CG2 2.94Å; T15-V19 PolarHBondContact O-N 2.75Å
16	L	96.7	Very high	94.5	Very high	112 Å²	112	93.7 Å²	93.7	59%	0.586	52%	0.524	S	S	*	.	H	α-helix	trans	-59.6	-44.8	174.1	-99.6	122.6	0	0	0	111.6	I12 V13 V19 L20	I12-L16 HydrophobicContact CG2-CD1 3.48Å; I12-L16 VanDerWaalsContact CG2-CD1 3.48Å; I12-L16 WeakPolarHBondContact O-CB 3.38Å; I12-L16 WeakPolarHBondContact O-CD1 3.29Å; I12-L16 PolarHBondContact O-N 2.64Å; V13-L16 PolarHBondContact O-N 2.82Å; L16-V19 PolarHBondContact O-N 3.43Å; L16-L20 WeakPolarHBondContact O-CB 3.33Å; L16-L20 PolarHBondContact O-N 3.49Å
17	L	96.2	Very high	94.6	Very high	90 Å²	90	99.3 Å²	99.3	47%	0.471	53%	0.533	S	S	.	.	H	α-helix	trans	-61.4	-45.2	175	-94.3	157.4	0	0	0	111.5	V13 A14 T15 V19 L20 L21	V13-L17 HydrophobicContact CG1-CD1 4.04Å; V13-L17 WeakPolarHBondContact O-CB 3.31Å; V13-L17 PolarHBondContact O-N 3.32Å; A14-L17 PolarHBondContact O-N 3.02Å; T15-L17 PolarHBondContact O-N 3.42Å; L17-V19 PolarHBondContact O-N 2.66Å; L17-L20 PolarHBondContact O-N 3.39Å; L17-L21 VanDerWaalsContact O-CB 3.26Å; L17-L21 WeakPolarHBondContact O-CB 3.21Å; L17-L21 WeakPolarHBondContact O-CG 3.33Å; L17-L21 PolarHBondContact O-N 3.45Å
18	C	95.9	Very high	94.4	Very high	84 Å²	84	99.2 Å²	99.2	57%	0.568	53%	0.525	S	S	*	.	H	α-helix	trans	-60	-46.4	175.9	-77.9	0	0	0	0	111.8	A14 T15 L21 F22	A14-C18 WeakPolarHBondContact O-CB 3.05Å; A14-C18 PolarHBondContact O-N 3.24Å; A14-C18 PolarHBondContact O-SG 3.39Å; A14-C18 VanDerWaalsContact O-SG 3.42Å; T15-C18 PolarHBondContact O-N 2.65Å; C18-L21 PolarHBondContact O-N 2.82Å; C18-F22 VanDerWaalsContact O-CB 3.25Å; C18-F22 WeakPolarHBondContact O-CB 3.2Å; C18-F22 PolarHBondContact O-N 2.8Å
19	V	95.9	Very high	94.2	Very high	94 Å²	94	98.4 Å²	98.4	57%	0.57	52%	0.52	S	S	*	.	H	α-helix	trans	-65.4	-43	177.8	173.2	0	0	0	0	110.9	T15 L16 L17 F22 M23	T15-V19 VanDerWaalsContact O-CG2 3.31Å; T15-V19 WeakPolarHBondContact O-CG2 2.94Å; T15-V19 PolarHBondContact O-N 2.75Å; L16-V19 PolarHBondContact O-N 3.43Å; L17-V19 PolarHBondContact O-N 2.66Å; V19-F22 PolarHBondContact O-N 2.72Å; V19-M23 VanDerWaalsContact O-CB 3.24Å; V19-M23 WeakPolarHBondContact O-CB 3.35Å; V19-M23 PolarHBondContact O-N 2.87Å
20	L	96.1	Very high	93.8	Very high	98 Å²	98	97 Å²	97	51%	0.513	52%	0.516	S	S	.	.	H	α-helix	trans	-63.1	-45.8	178.5	-173.9	68.8	0	0	0	110.8	L16 L17 M23 L24	L16-L20 WeakPolarHBondContact O-CB 3.33Å; L16-L20 PolarHBondContact O-N 3.49Å; L17-L20 PolarHBondContact O-N 3.39Å; L20-M23 PolarHBondContact O-N 3.38Å; L20-L24 HydrophobicContact CD1-CD1 4.23Å; L20-L24 HydrophobicContact CG-CD1 4.49Å; L20-L24 VanDerWaalsContact O-CB 3.31Å; L20-L24 WeakPolarHBondContact O-CB 3.33Å; L20-L24 PolarHBondContact O-N 3.5Å
21	L	94.9	Very high	93.3	Very high	104 Å²	104	97.8 Å²	97.8	55%	0.545	51%	0.51	S	S	.	.	H	α-helix	trans	-62.6	-44.3	175	-74.6	173.9	0	0	0	111.1	L17 C18 L24 F25	L17-L21 VanDerWaalsContact O-CB 3.26Å; L17-L21 WeakPolarHBondContact O-CB 3.21Å; L17-L21 WeakPolarHBondContact O-CG 3.33Å; L17-L21 PolarHBondContact O-N 3.45Å; C18-L21 PolarHBondContact O-N 2.82Å; L21-L24 PolarHBondContact O-N 3.49Å; L21-F25 VanDerWaalsContact O-CB 3.3Å; L21-F25 WeakPolarHBondContact O-CB 3.3Å; L21-F25 PolarHBondContact O-N 3.26Å
22	F	95.1	Very high	92.6	Very high	169 Å²	169	99.2 Å²	99.2	74%	0.741	51%	0.511	S	S	*	.	H	α-helix	trans	-67.6	-39.6	179.7	-160.6	-90.8	0	0	0	111.9	C18 V19 F25 G26	C18-F22 VanDerWaalsContact O-CB 3.25Å; C18-F22 WeakPolarHBondContact O-CB 3.2Å; C18-F22 PolarHBondContact O-N 2.8Å; V19-F22 PolarHBondContact O-N 2.72Å; F22-F25 PolarHBondContact O-N 3.5Å; F22-G26 PolarHBondContact O-N 2.75Å
23	M	94.9	Very high	91.9	Very high	118 Å²	118	100 Å²	100	58%	0.581	52%	0.516	S	S	*	.	H	α-helix	trans	-64.3	-47.3	173.8	-170.2	-158.1	163.2	0	0	110.2	V19 L20 W27	V19-M23 VanDerWaalsContact O-CB 3.24Å; V19-M23 WeakPolarHBondContact O-CB 3.35Å; V19-M23 PolarHBondContact O-N 2.87Å; L20-M23 PolarHBondContact O-N 3.38Å; M23-W27 WeakPolarHBondContact O-CA 3.27Å; M23-W27 WeakPolarHBondContact O-CB 3.06Å; M23-W27 PolarHBondContact O-N 2.82Å
24	L	92.4	Very high	90.8	Very high	67 Å²	67	102.9 Å²	102.9	35%	0.351	52%	0.523	S	S	.	.	H	α-helix	trans	-60.3	-45.9	173.8	-106.4	64.5	0	0	0	110.5	L20 L21 W27 Y28	L20-L24 HydrophobicContact CD1-CD1 4.23Å; L20-L24 HydrophobicContact CG-CD1 4.49Å; L20-L24 VanDerWaalsContact O-CB 3.31Å; L20-L24 WeakPolarHBondContact O-CB 3.33Å; L20-L24 PolarHBondContact O-N 3.5Å; L21-L24 PolarHBondContact O-N 3.49Å; L24-W27 PolarHBondContact O-N 3.39Å; L24-Y28 HydrophobicContact CB-CD2 3.84Å; L24-Y28 HydrophobicContact CB-CE2 3.94Å; L24-Y28 HydrophobicContact CD2-CD2 4.39Å; L24-Y28 HydrophobicContact CD2-CE2 3.66Å; L24-Y28 HydrophobicContact CG-CD2 3.92Å; L24-Y28 HydrophobicContact CG-CE2 3.5Å; L24-Y28 VanDerWaalsContact CG-CE2 3.5Å; L24-Y28 WeakPolarHBondContact O-CA 3.29Å; L24-Y28 WeakPolarHBondContact O-CB 3.3Å; L24-Y28 WeakPolarHBondContact O-CD2 2.84Å; L24-Y28 PolarHBondContact O-N 2.77Å
25	F	92.6	Very high	89.5	Confident	149 Å²	149	105.1 Å²	105.1	65%	0.654	53%	0.528	S	S	*	.	H	α-helix	trans	-64.1	-47.8	-179.3	-126.4	-96.1	0	0	0	111.1	L21 F22 W27 Y28 V29	L21-F25 VanDerWaalsContact O-CB 3.3Å; L21-F25 WeakPolarHBondContact O-CB 3.3Å; L21-F25 PolarHBondContact O-N 3.26Å; F22-F25 PolarHBondContact O-N 3.5Å; F25-W27 VanDerWaalsContact C-N 3.35Å; F25-W27 PolarHBondContact O-N 3.47Å; F25-Y28 PolarHBondContact O-N 3.31Å; F25-V29 HydrophobicContact CD1-CG2 4.08Å; F25-V29 WeakPolarHBondContact O-CB 3.5Å; F25-V29 WeakPolarHBondContact O-CG2 3.3Å; F25-V29 PolarHBondContact O-N 2.84Å
26	G	89.6	Confident	88.2	Confident	39 Å²	39	104.2 Å²	104.2	40%	0.402	53%	0.525	S	S	.	.	H	α-helix	trans	-61.6	-43.9	176.1	0	0	0	0	0	111.9	F22 V30	F22-G26 PolarHBondContact O-N 2.75Å; G26-V30 VanDerWaalsContact O-CG2 3.28Å; G26-V30 WeakPolarHBondContact O-CG2 2.99Å; G26-V30 PolarHBondContact O-N 2.78Å
27	W	90.3	Very high	86.6	Confident	159 Å²	159	106.7 Å²	106.7	60%	0.602	53%	0.531	S	S	*	.	H	α-helix	trans	-65.3	-46.2	176.3	-178.5	-94.8	0	0	0	112.4	M23 L24 F25 V30 W31	M23-W27 WeakPolarHBondContact O-CA 3.27Å; M23-W27 WeakPolarHBondContact O-CB 3.06Å; M23-W27 PolarHBondContact O-N 2.82Å; L24-W27 PolarHBondContact O-N 3.39Å; F25-W27 VanDerWaalsContact C-N 3.35Å; F25-W27 PolarHBondContact O-N 3.47Å; W27-V30 PolarHBondContact O-N 3.36Å; W27-W31 AromaticContact CD1-CE3 3.85Å; W27-W31 AromaticContact NE1-CE3 3.46Å; W27-W31 AromaticContact NE1-CZ3 3.89Å; W27-W31 WeakPolarHBondContact O-CB 3.1Å; W27-W31 PolarHBondContact O-N 2.8Å
28	Y	89.4	Confident	84.9	Confident	119 Å²	119	107.6 Å²	107.6	47%	0.467	53%	0.531	S	S	.	.	H	α-helix	trans	-69.3	-33.7	178.1	-84	-64.6	0	0	0	111.5	L24 F25 W31 Q32	L24-Y28 HydrophobicContact CB-CD2 3.84Å; L24-Y28 HydrophobicContact CB-CE2 3.94Å; L24-Y28 HydrophobicContact CD2-CD2 4.39Å; L24-Y28 HydrophobicContact CD2-CE2 3.66Å; L24-Y28 HydrophobicContact CG-CD2 3.92Å; L24-Y28 HydrophobicContact CG-CE2 3.5Å; L24-Y28 VanDerWaalsContact CG-CE2 3.5Å; L24-Y28 WeakPolarHBondContact O-CA 3.29Å; L24-Y28 WeakPolarHBondContact O-CB 3.3Å; L24-Y28 WeakPolarHBondContact O-CD2 2.84Å; L24-Y28 PolarHBondContact O-N 2.77Å; F25-Y28 PolarHBondContact O-N 3.31Å; Y28-W31 HydrophobicContact CD1-CE3 4.21Å; Y28-W31 HydrophobicContact CE1-CE3 4.17Å; Y28-W31 HydrophobicContact CE1-CZ3 4.31Å; Y28-W31 CarbonylContact O-C 3.58Å; Y28-W31 PolarHBondContact O-N 3.42Å; Y28-Q32 WeakPolarHBondContact O-CA 3.4Å; Y28-Q32 WeakPolarHBondContact O-CB 3Å; Y28-Q32 WeakPolarHBondContact O-CG 3.25Å; Y28-Q32 PolarHBondContact O-N 3.26Å
29	V	88	Confident	83.3	Confident	65 Å²	65	108.3 Å²	108.3	39%	0.394	53%	0.525	S	S	.	.	H	α-helix	trans	-70.7	-41.8	174.7	168.3	0	0	0	0	109.5	F25 Q32 L33	F25-V29 HydrophobicContact CD1-CG2 4.08Å; F25-V29 WeakPolarHBondContact O-CB 3.5Å; F25-V29 WeakPolarHBondContact O-CG2 3.3Å; F25-V29 PolarHBondContact O-N 2.84Å; V29-Q32 PolarHBondContact O-N 3.47Å; V29-L33 HydrophobicContact CG1-CD1 3.7Å; V29-L33 HydrophobicContact CG1-CG 4.15Å; V29-L33 WeakPolarHBondContact O-CB 3.18Å; V29-L33 WeakPolarHBondContact O-CG 3.01Å; V29-L33 PolarHBondContact O-N 2.83Å
30	V	86.9	Confident	81.5	Confident	84 Å²	84	111.5 Å²	111.5	51%	0.509	53%	0.531	S	S	.	.	H	α-helix	trans	-63.1	-46.7	171.7	172.8	0	0	0	0	110.2	G26 W27 Q32 L33 F34	G26-V30 VanDerWaalsContact O-CG2 3.28Å; G26-V30 WeakPolarHBondContact O-CG2 2.99Å; G26-V30 PolarHBondContact O-N 2.78Å; W27-V30 PolarHBondContact O-N 3.36Å; V30-Q32 PolarHBondContact O-N 3.42Å; V30-L33 PolarHBondContact O-N 3.48Å; V30-F34 HydrophobicContact CG1-CD2 3.93Å; V30-F34 HydrophobicContact CG1-CE2 4.2Å; V30-F34 VanDerWaalsContact O-CB 3.31Å; V30-F34 WeakPolarHBondContact O-CB 3.1Å; V30-F34 WeakPolarHBondContact O-CD2 3.3Å; V30-F34 PolarHBondContact O-N 2.87Å
31	W	84	Confident	80.1	Confident	134 Å²	134	110.8 Å²	110.8	51%	0.508	53%	0.527	S	S	.	.	H	α-helix	trans	-63	-39.7	177.3	-167.9	-1.3	0	0	0	111.8	W27 Y28 L35	W27-W31 AromaticContact CD1-CE3 3.85Å; W27-W31 AromaticContact NE1-CE3 3.46Å; W27-W31 AromaticContact NE1-CZ3 3.89Å; W27-W31 WeakPolarHBondContact O-CB 3.1Å; W27-W31 PolarHBondContact O-N 2.8Å; Y28-W31 HydrophobicContact CD1-CE3 4.21Å; Y28-W31 HydrophobicContact CE1-CE3 4.17Å; Y28-W31 HydrophobicContact CE1-CZ3 4.31Å; Y28-W31 CarbonylContact O-C 3.58Å; Y28-W31 PolarHBondContact O-N 3.42Å; W31-L35 VanDerWaalsContact CD1-CD1 3.4Å; W31-L35 HydrophobicContact CG-CD1 4.36Å; W31-L35 VanDerWaalsContact O-CB 3.3Å; W31-L35 WeakPolarHBondContact O-CB 3.31Å; W31-L35 PolarHBondContact O-N 2.62Å
32	Q	79.9	Confident	78.8	Confident	117 Å²	117	115.3 Å²	115.3	55%	0.547	54%	0.537	S	S	.	.	H	α-helix	trans	-71.3	-43.4	176	-85.8	-74.7	-2.1	0	0	111.1	Y28 V29 V30 F34 L35 S36	Y28-Q32 WeakPolarHBondContact O-CA 3.4Å; Y28-Q32 WeakPolarHBondContact O-CB 3Å; Y28-Q32 WeakPolarHBondContact O-CG 3.25Å; Y28-Q32 PolarHBondContact O-N 3.26Å; V29-Q32 PolarHBondContact O-N 3.47Å; V30-Q32 PolarHBondContact O-N 3.42Å; Q32-F34 VanDerWaalsContact C-N 3.26Å; Q32-F34 PolarHBondContact O-N 3.37Å; Q32-L35 CarbonylContact O-C 3.55Å; Q32-L35 PolarHBondContact O-N 2.84Å; Q32-S36 VanDerWaalsContact O-CA 3.29Å; Q32-S36 WeakPolarHBondContact O-CA 3.31Å; Q32-S36 WeakPolarHBondContact O-CB 3.18Å; Q32-S36 PolarHBondContact O-N 3.48Å
33	L	80.9	Confident	77.3	Confident	105 Å²	105	112 Å²	112	55%	0.55	52%	0.524	S	S	.	.	H	α-helix	trans	-65.7	-35.4	176.2	-73.1	172.3	0	0	0	110.5	V29 V30 K37	V29-L33 HydrophobicContact CG1-CD1 3.7Å; V29-L33 HydrophobicContact CG1-CG 4.15Å; V29-L33 WeakPolarHBondContact O-CB 3.18Å; V29-L33 WeakPolarHBondContact O-CG 3.01Å; V29-L33 PolarHBondContact O-N 2.83Å; V30-L33 PolarHBondContact O-N 3.48Å; L33-K37 WeakPolarHBondContact O-CB 3.22Å; L33-K37 WeakPolarHBondContact O-CG 3.26Å; L33-K37 PolarHBondContact O-N 3.35Å
34	F	74.8	Confident	75.9	Confident	131 Å²	131	112.2 Å²	112.2	58%	0.575	53%	0.527	S	S	*	.	H	α-helix	trans	-63.8	-59.5	168.3	-96.1	-94.8	0	0	0	110.8	V30 Q32 S36 K37 F38	V30-F34 HydrophobicContact CG1-CD2 3.93Å; V30-F34 HydrophobicContact CG1-CE2 4.2Å; V30-F34 VanDerWaalsContact O-CB 3.31Å; V30-F34 WeakPolarHBondContact O-CB 3.1Å; V30-F34 WeakPolarHBondContact O-CD2 3.3Å; V30-F34 PolarHBondContact O-N 2.87Å; Q32-F34 VanDerWaalsContact C-N 3.26Å; Q32-F34 PolarHBondContact O-N 3.37Å; F34-S36 PolarHBondContact O-N 3.37Å; F34-K37 PolarHBondContact O-N 2.86Å; F34-F38 HydrophobicContact CD1-CD2 4.35Å; F34-F38 HydrophobicContact CD1-CE2 4.02Å; F34-F38 WeakPolarHBondContact O-CB 3.34Å; F34-F38 WeakPolarHBondContact O-CD2 3.41Å; F34-F38 PolarHBondContact O-N 3.49Å
35	L	70.1	Confident	74.4	Confident	92 Å²	92	113.7 Å²	113.7	48%	0.482	54%	0.539	S	S	.	.	H	α-helix	trans	-63.2	-23.9	179.9	-87.2	167.4	0	0	0	114.4	W31 Q32 F38 K39	W31-L35 VanDerWaalsContact CD1-CD1 3.4Å; W31-L35 HydrophobicContact CG-CD1 4.36Å; W31-L35 VanDerWaalsContact O-CB 3.3Å; W31-L35 WeakPolarHBondContact O-CB 3.31Å; W31-L35 PolarHBondContact O-N 2.62Å; Q32-L35 CarbonylContact O-C 3.55Å; Q32-L35 PolarHBondContact O-N 2.84Å; L35-F38 CarbonylContact O-C 3.18Å; L35-K39 VanDerWaalsContact O-CA 3.3Å; L35-K39 WeakPolarHBondContact O-CA 3.16Å; L35-K39 VanDerWaalsContact O-CB 3.27Å; L35-K39 WeakPolarHBondContact O-CB 3.24Å; L35-K39 PolarHBondContact O-N 2.86Å
36	S	67.9	Low	72.8	Confident	59 Å²	59	108.6 Å²	108.6	41%	0.413	53%	0.528	S	S	.	.	H	α-helix	trans	-87.5	-35.6	-179.7	-163.9	0	0	0	0	110.5	Q32 F34 F38 K39 F40	Q32-S36 VanDerWaalsContact O-CA 3.29Å; Q32-S36 WeakPolarHBondContact O-CA 3.31Å; Q32-S36 WeakPolarHBondContact O-CB 3.18Å; Q32-S36 PolarHBondContact O-N 3.48Å; F34-S36 PolarHBondContact O-N 3.37Å; S36-F38 VanDerWaalsContact C-N 3.32Å; S36-K39 VanDerWaalsContact O-CB 3.29Å; S36-K39 WeakPolarHBondContact O-CB 3.48Å; S36-K39 PolarHBondContact O-N 2.82Å; S36-F40 PolarHBondContact O-N 3.31Å
37	K	63.6	Low	71.1	Confident	164 Å²	164	112.8 Å²	112.8	71%	0.713	54%	0.541	S	S	*	.	H	α-helix	trans	-67.1	-34	162.5	-73.1	-74	170.1	71.3	0	111.9	L33 F34 K39 F40	L33-K37 WeakPolarHBondContact O-CB 3.22Å; L33-K37 WeakPolarHBondContact O-CG 3.26Å; L33-K37 PolarHBondContact O-N 3.35Å; F34-K37 PolarHBondContact O-N 2.86Å; K37-K39 VanDerWaalsContact C-N 3.33Å; K37-F40 WeakPolarHBondContact O-CB 3.24Å
38	F	60.1	Low	69.3	Low	109 Å²	109	108.9 Å²	108.9	48%	0.478	54%	0.543	S	S	.	.	T	Hydrogen-bonded Turn	trans	-81.8	-4.4	167.4	-79.9	-87.2	0	0	0	113.1	F34 L35 S36 F40 L41 R42	F34-F38 HydrophobicContact CD1-CD2 4.35Å; F34-F38 HydrophobicContact CD1-CE2 4.02Å; F34-F38 WeakPolarHBondContact O-CB 3.34Å; F34-F38 WeakPolarHBondContact O-CD2 3.41Å; F34-F38 PolarHBondContact O-N 3.49Å; L35-F38 CarbonylContact O-C 3.18Å; S36-F38 VanDerWaalsContact C-N 3.32Å; F38-F40 VanDerWaalsContact C-N 3.31Å; F38-L41 VanDerWaalsContact C-N 3.32Å; F38-L41 HydrophobicContact CB-CB 4.28Å; F38-L41 HydrophobicContact CD1-CB 3.73Å; F38-L41 HydrophobicContact CD1-CD2 3.48Å; F38-L41 VanDerWaalsContact CD1-CD2 3.48Å; F38-L41 HydrophobicContact CD1-CG 4.16Å; F38-L41 HydrophobicContact CE1-CD2 3.52Å; F38-L41 HydrophobicContact CG-CB 4.36Å; F38-L41 CarbonylContact O-C 3.58Å; F38-L41 WeakPolarHBondContact O-CA 3.41Å; F38-L41 WeakPolarHBondContact O-CB 3.5Å; F38-L41 PolarHBondContact O-N 2.95Å; F38-R42 VanDerWaalsContact O-CB 3.3Å; F38-R42 WeakPolarHBondContact O-CB 3.34Å; F38-R42 PolarHBondContact O-N 3.34Å
39	K	62.8	Low	67.4	Low	98 Å²	98	106 Å²	106	43%	0.426	55%	0.549	S	S	.	.	H	α-helix	trans	-77.3	-30.4	172	-161.3	-173.9	89.1	58.2	0	108.7	L35 S36 K37 L41 R42 E43	L35-K39 VanDerWaalsContact O-CA 3.3Å; L35-K39 WeakPolarHBondContact O-CA 3.16Å; L35-K39 VanDerWaalsContact O-CB 3.27Å; L35-K39 WeakPolarHBondContact O-CB 3.24Å; L35-K39 PolarHBondContact O-N 2.86Å; S36-K39 VanDerWaalsContact O-CB 3.29Å; S36-K39 WeakPolarHBondContact O-CB 3.48Å; S36-K39 PolarHBondContact O-N 2.82Å; K37-K39 VanDerWaalsContact C-N 3.33Å; K39-L41 VanDerWaalsContact C-N 3.34Å; K39-R42 CarbonylContact O-C 3.32Å; K39-R42 PolarHBondContact O-N 2.7Å; K39-E43 VanDerWaalsContact NZ-CD 3.28Å; K39-E43 IonicContact NZ-OE1 3.03Å; K39-E43 PolarHBondContact NZ-OE1 3.43Å; K39-E43 IonicContact NZ-OE2 2.82Å; K39-E43 PolarHBondContact NZ-OE2 2.92Å; K39-E43 VanDerWaalsContact O-CB 3.27Å; K39-E43 WeakPolarHBondContact O-CB 3.34Å; K39-E43 PolarHBondContact O-N 3.06Å; K39-E43 VanDerWaalsContact O-OE2 3.11Å
40	F	57.1	Low	65.4	Low	161 Å²	161	106.6 Å²	106.6	71%	0.706	55%	0.553	S	S	*	*	H	α-helix	trans	-63.2	-35.2	159.2	-113.9	-85.5	0	0	0	112.8	S36 K37 F38 L44	S36-F40 PolarHBondContact O-N 3.31Å; K37-F40 WeakPolarHBondContact O-CB 3.24Å; F38-F40 VanDerWaalsContact C-N 3.31Å; F40-L44 WeakPolarHBondContact O-CB 3.37Å; F40-L44 PolarHBondContact O-N 3.47Å
41	L	67.3	Low	63.6	Low	83 Å²	83	108.3 Å²	108.3	44%	0.435	57%	0.566	S	S	.	*	H	α-helix	trans	-78.9	-23.9	174	-132.3	84.6	0	0	0	112.9	F38 K39 V45	F38-L41 VanDerWaalsContact C-N 3.32Å; F38-L41 HydrophobicContact CB-CB 4.28Å; F38-L41 HydrophobicContact CD1-CB 3.73Å; F38-L41 HydrophobicContact CD1-CD2 3.48Å; F38-L41 VanDerWaalsContact CD1-CD2 3.48Å; F38-L41 HydrophobicContact CD1-CG 4.16Å; F38-L41 HydrophobicContact CE1-CD2 3.52Å; F38-L41 HydrophobicContact CG-CB 4.36Å; F38-L41 CarbonylContact O-C 3.58Å; F38-L41 WeakPolarHBondContact O-CA 3.41Å; F38-L41 WeakPolarHBondContact O-CB 3.5Å; F38-L41 PolarHBondContact O-N 2.95Å; K39-L41 VanDerWaalsContact C-N 3.34Å; L41-V45 HydrophobicContact CG-CG2 4.43Å; L41-V45 WeakPolarHBondContact O-CA 3.33Å; L41-V45 WeakPolarHBondContact O-CB 3.23Å; L41-V45 WeakPolarHBondContact O-CG2 3.45Å; L41-V45 PolarHBondContact O-N 2.99Å
42	R	67	Low	62	Low	199 Å²	199	110.7 Å²	110.7	75%	0.751	58%	0.583	S	S	*	*	H	α-helix	trans	-89.4	-23.5	175.5	-179.7	172.9	139.9	147.8	-3.8	110.9	F38 K39 G46	F38-R42 VanDerWaalsContact O-CB 3.3Å; F38-R42 WeakPolarHBondContact O-CB 3.34Å; F38-R42 PolarHBondContact O-N 3.34Å; K39-R42 CarbonylContact O-C 3.32Å; K39-R42 PolarHBondContact O-N 2.7Å; R42-G46 WeakPolarHBondContact O-CA 3.21Å; R42-G46 PolarHBondContact O-N 3.38Å
43	E	64.4	Low	60.5	Low	101 Å²	101	109.2 Å²	109.2	47%	0.472	59%	0.591	S	S	.	*	H	α-helix	trans	-69.9	-49.7	155.5	-93.4	147.5	164.3	0	0	108.7	K39 V45 G46 D47	K39-E43 VanDerWaalsContact NZ-CD 3.28Å; K39-E43 IonicContact NZ-OE1 3.03Å; K39-E43 PolarHBondContact NZ-OE1 3.43Å; K39-E43 IonicContact NZ-OE2 2.82Å; K39-E43 PolarHBondContact NZ-OE2 2.92Å; K39-E43 VanDerWaalsContact O-CB 3.27Å; K39-E43 WeakPolarHBondContact O-CB 3.34Å; K39-E43 PolarHBondContact O-N 3.06Å; K39-E43 VanDerWaalsContact O-OE2 3.11Å; E43-V45 PolarHBondContact O-N 3.37Å; E43-G46 PolarHBondContact O-N 2.91Å; E43-D47 VanDerWaalsContact O-CA 3.32Å; E43-D47 WeakPolarHBondContact O-CA 3.46Å; E43-D47 WeakPolarHBondContact O-CB 3.48Å; E43-D47 PolarHBondContact O-N 3.5Å
44	L	64.1	Low	58.9	Low	122 Å²	122	113.3 Å²	113.3	64%	0.639	61%	0.607	S	S	*	*	H	α-helix	trans	-69.1	-35	-179.6	-153.8	74.7	0	0	0	114	F40 A48	F40-L44 WeakPolarHBondContact O-CB 3.37Å; F40-L44 PolarHBondContact O-N 3.47Å; L44-A48 WeakPolarHBondContact O-CB 3.19Å; L44-A48 PolarHBondContact O-N 3.46Å
45	V	61.8	Low	57.5	Low	98 Å²	98	113.4 Å²	113.4	59%	0.594	62%	0.619	S	S	*	*	H	α-helix	trans	-84.5	-31.3	174.7	170.9	0	0	0	0	111.3	L41 E43 G49	L41-V45 HydrophobicContact CG-CG2 4.43Å; L41-V45 WeakPolarHBondContact O-CA 3.33Å; L41-V45 WeakPolarHBondContact O-CB 3.23Å; L41-V45 WeakPolarHBondContact O-CG2 3.45Å; L41-V45 PolarHBondContact O-N 2.99Å; E43-V45 PolarHBondContact O-N 3.37Å; V45-G49 PolarHBondContact O-N 2.89Å
46	G	58.1	Low	55.8	Low	42 Å²	42	120.4 Å²	120.4	43%	0.433	64%	0.639	S	S	.	*	H	α-helix	trans	-80.5	-31.5	176.3	0	0	0	0	0	113.4	R42 E43 G49	R42-G46 WeakPolarHBondContact O-CA 3.21Å; R42-G46 PolarHBondContact O-N 3.38Å; E43-G46 PolarHBondContact O-N 2.91Å; G46-G49 PolarHBondContact O-N 3.25Å
47	D	53.9	Low	54.9	Low	126 Å²	126	122.7 Å²	122.7	67%	0.674	65%	0.652	S	S	*	*	H	α-helix	trans	-80.5	-31.5	170.7	-152.7	41.1	0	0	0	110	E43 G49 T50	E43-D47 VanDerWaalsContact O-CA 3.32Å; E43-D47 WeakPolarHBondContact O-CA 3.46Å; E43-D47 WeakPolarHBondContact O-CB 3.48Å; E43-D47 PolarHBondContact O-N 3.5Å; D47-G49 PolarHBondContact O-N 3.42Å; D47-T50 CarbonylContact O-C 3.57Å; D47-T50 PolarHBondContact O-N 3.45Å; D47-T50 VanDerWaalsContact O-N 3.14Å
48	A	52.8	Low	53.8	Low	77 Å²	77	120.4 Å²	120.4	64%	0.636	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.5	-11	163.8	0	0	0	0	0	114	L44 T50	L44-A48 WeakPolarHBondContact O-CB 3.19Å; L44-A48 PolarHBondContact O-N 3.46Å; A48-T50 VanDerWaalsContact C-N 3.28Å
49	G	49.9	Very low	53	Low	58 Å²	58	123.8 Å²	123.8	60%	0.598	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.2	-9	168.8	0	0	0	0	0	113.6	V45 G46 D47	V45-G49 PolarHBondContact O-N 2.89Å; G46-G49 PolarHBondContact O-N 3.25Å; D47-G49 PolarHBondContact O-N 3.42Å
50	T	46.6	Very low	52	Low	78 Å²	78	124.7 Å²	124.7	48%	0.479	69%	0.69	S	S	.	*			trans	-127.5	83.3	174.2	-51.3	0	0	0	0	110.8	D47 A48 Q52 A53	D47-T50 CarbonylContact O-C 3.57Å; D47-T50 PolarHBondContact O-N 3.45Å; D47-T50 VanDerWaalsContact O-N 3.14Å; A48-T50 VanDerWaalsContact C-N 3.28Å; T50-Q52 PolarHBondContact O-N 3.43Å; T50-A53 HydrophobicContact CG2-CB 4.16Å
51	P	48.9	Very low	51.2	Low	121 Å²	121	125.7 Å²	125.7	79%	0.786	70%	0.697	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.6	57	155.8	33	-33.1	0	0	0	110
52	Q	49	Very low	49.9	Very low	184 Å²	184	129.9 Å²	129.9	86%	0.86	71%	0.714	S	S	*	*	T	Hydrogen-bonded Turn	trans	-170.7	36	171.7	-133.9	-173.3	92.4	0	0	119.7	T50	T50-Q52 PolarHBondContact O-N 3.43Å
53	A	48.7	Very low	48.8	Very low	86 Å²	86	126.1 Å²	126.1	71%	0.711	72%	0.715	S	S	*	*	S	Bend	trans	-124.9	2.7	170	0	0	0	0	0	115.5	T50	T50-A53 HydrophobicContact CG2-CB 4.16Å
54	E	47.4	Very low	47.9	Very low	191 Å²	191	125.4 Å²	125.4	89%	0.893	73%	0.727	S	S	*	*	S	Bend	trans	-135.4	69.7	168.1	-91.3	-167.4	86.4	0	0	110.8
55	T	45.6	Very low	46.5	Very low	133 Å²	133	123.1 Å²	123.1	82%	0.816	73%	0.732	S	S	*	*			trans	-149.8	81.9	138.5	-41.4	0	0	0	0	108.8
56	R	35	Very low	45.3	Very low	238 Å²	238	123 Å²	123	90%	0.898	74%	0.742	S	S	*	*				-152.2	117.7	123.1	-114.1	-174.8	162	-173.8	-6.8	110
57	P	47.9	Very low	45.3	Very low	107 Å²	107	126.7 Å²	126.7	70%	0.695	76%	0.758	S	S	*	*			trans	-69.1	159.8	177.9	31.2	-34.2	0	0	0	110.3
58	S	41	Very low	44.8	Very low	116 Å²	116	127.3 Å²	127.3	81%	0.811	77%	0.766	S	S	*	*			trans	107	107	169.3	-53.3	0	0	0	0	114.9
59	E	43.1	Very low	44.7	Very low	180 Å²	180	133.7 Å²	133.7	84%	0.841	77%	0.774	S	S	*	*			trans	2.2	139.7	131.7	-130.1	149.2	77.3	0	0	114.9
60	P	41.3	Very low	44.8	Very low	118 Å²	118	136.1 Å²	136.1	77%	0.766	78%	0.777	S	S	*	*				-151.8	-179.1	52	36.6	-12.5	0	0	0	116.7
61	E	42.3	Very low	44.6	Very low	181 Å²	181	142.9 Å²	142.9	85%	0.846	79%	0.794	S	S	*	*			trans	-53.3	158.4	176.4	-56.6	173.3	95.6	0	0	115.1
62	H	39.9	Very low	44.1	Very low	172 Å²	172	143.3 Å²	143.3	80%	0.796	79%	0.79	S	S	*	*			trans	-30.1	150.4	171.9	-129.3	-16.9	0	0	0	115.9	A64	H62-A64 PolarHBondContact CE1-N 3.41Å; H62-A64 PolarHBondContact ND1-N 3.01Å
63	P	44	Very low	44.2	Very low	119 Å²	119	145.4 Å²	145.4	77%	0.773	79%	0.79	S	S	*	*				-142.4	158.9	65.5	30.5	-8.6	0	0	0	116.1
64	A	45	Very low	44.3	Very low	87 Å²	87	147 Å²	147	72%	0.719	79%	0.791	S	S	*	*			trans	23.2	129.2	144.5	0	0	0	0	0	120.6	H62	H62-A64 PolarHBondContact CE1-N 3.41Å; H62-A64 PolarHBondContact ND1-N 3.01Å
65	G	33.3	Very low	44.4	Very low	73 Å²	73	142.1 Å²	142.1	75%	0.753	78%	0.783	S	S	*	*			trans	125.2	98.5	132.9	0	0	0	0	0	116.4
66	A	38.1	Very low	44.7	Very low	96 Å²	96	147.2 Å²	147.2	79%	0.793	79%	0.787	S	S	*	*			trans	76	148.5	140.5	0	0	0	0	0	119.6
67	P	57.3	Low	45.6	Very low	119 Å²	119	145.3 Å²	145.3	77%	0.773	79%	0.789	S	S	*	*			trans	-99.6	131.3	-157.5	35.3	-24.4	0	0	0	111
68	T	42.7	Very low	45.8	Very low	139 Å²	139	151 Å²	151	85%	0.853	80%	0.796	S	S	*	*			trans	-110.5	74.8	171.2	-34.5	0	0	0	0	110.5	T70	T68-T70 PolarHBondContact O-N 3.28Å
69	R	51.3	Low	45.9	Very low	212 Å²	212	151 Å²	151	80%	0.8	79%	0.791	S	S	*	*			trans	-51.1	126.5	154.5	174.5	-177.9	168.6	147.9	-1.7	108.5
70	T	53.4	Low	46.1	Very low	108 Å²	108	146 Å²	146	66%	0.663	78%	0.776	S	S	*	*			trans	59.5	135.2	158.3	57.8	0	0	0	0	117.1	T68	T68-T70 PolarHBondContact O-N 3.28Å
71	R	41.7	Very low	46.3	Very low	220 Å²	220	149.2 Å²	149.2	83%	0.83	78%	0.778	S	S	*	*				157.7	95.6	129.2	-165.6	154.2	-172.4	148.1	-2.3	107.6
72	N	39	Very low	46.9	Very low	131 Å²	131	145.9 Å²	145.9	70%	0.701	77%	0.772	S	S	*	*				67.3	112.8	107.3	-53.9	-1.8	0	0	0	112.7
73	R	49.4	Very low	47.3	Very low	228 Å²	228	146 Å²	146	86%	0.86	77%	0.773	S	S	*	*				61.7	134.7	118.8	-154.1	177	175.1	116.5	-3.2	116.9
74	T	50.6	Low	47.6	Very low	119 Å²	119	144.2 Å²	144.2	73%	0.73	76%	0.763	S	S	*	*			trans	80.7	124.1	151.3	21.2	0	0	0	0	118.5
75	A	49.9	Very low	47.6	Very low	88 Å²	88	147 Å²	147	73%	0.727	77%	0.766	S	S	*	*			trans	72	82.8	133	0	0	0	0	0	116.5
76	R	52.8	Low	48	Very low	241 Å²	241	155.3 Å²	155.3	91%	0.909	79%	0.792	S	S	*	*			trans	174.8	111	137.8	-106.3	169.8	174.7	-140.3	0.4	110.8
77	Q	53.5	Low	48.5	Very low	197 Å²	197	158.3 Å²	158.3	92%	0.921	79%	0.792	S	S	*	*			trans	-176	52.4	137.6	-105.4	173.3	-20.7	0	0	107.6
78	R	51.7	Low	48	Very low	228 Å²	228	160.3 Å²	160.3	86%	0.86	79%	0.793	S	S	*	*				-20.1	139.7	112.8	-141.1	-178	-156.2	-112.1	3.7	114.7
79	V	43.8	Very low	48.3	Very low	115 Å²	115	161.5 Å²	161.5	70%	0.697	79%	0.79	S	S	*	*			trans	94.7	84.7	162.2	-168.9	0	0	0	0	112.9
80	S	47.5	Very low	48.1	Very low	75 Å²	75	158.5 Å²	158.5	52%	0.524	79%	0.789	S	S	.	*				73.5	131.8	108.1	66.6	0	0	0	0	112.6
81	F	44.4	Very low	47.8	Very low	186 Å²	186	161.7 Å²	161.7	82%	0.816	80%	0.797	S	S	*	*				-169.7	-162	65.3	-73.6	-88	0	0	0	108.4
82	P	55.2	Low	48.2	Very low	111 Å²	111	157.8 Å²	157.8	72%	0.721	80%	0.795	S	S	*	*				-118.8	-179	-84.9	36.5	-18.6	0	0	0	112.6
83	E	49.3	Very low	48.9	Very low	174 Å²	174	159.7 Å²	159.7	81%	0.813	80%	0.801	S	S	*	*			trans	91.8	121	146.9	-130	-174.8	92.6	0	0	121.7
84	S	49	Very low	48.8	Very low	81 Å²	81	154.5 Å²	154.5	57%	0.566	80%	0.797	S	S	*	*			trans	78.7	130.5	138.6	64.6	0	0	0	0	123.5
85	N	45.5	Very low	48.7	Very low	147 Å²	147	157.4 Å²	157.4	79%	0.786	80%	0.802	S	S	*	*			trans	96.6	91.2	154.1	-49.5	-59	0	0	0	117.2
86	L	41.5	Very low	48.6	Very low	246 Å²	246	163.7 Å²	163.7	100%	1.288	81%	0.809	S	S	*	*				-179.9	0	83.8	-150.1	91.4	0	0	0	110.2

Retrieved 86 of 86 residues in 174.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).