A0A087X5W0_POEFO Loading...

TAFA chemokine like family member 3

AlphaFold DB , UniProt , Accession A0A087X5W0, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 131 aa.

						>A0A087X5W0_POEFO|A0A087X5W0
LSQLLLQVLSLKMVWLYVCLWEARLSLANVYHYSLTVHVKAGTCEVIAAHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAMPSCVDASIVAQKWWCQMQPCMEGEECKVLPDLTGWSCSTGNKVKTTKVTR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	L	60.1	Low	74.9	Confident	187 Å²	187	114.4 Å²	114.4	98%	0.979	62%	0.615	S	S	*	*				0	-47.2	0	-133.5	77	0	0	0	112.6	L5	L1-L5 PolarHBondContact O-N 2.91Å; L1-L5 VanDerWaalsContact O-N 3.17Å
2	S	72.4	Confident	75.9	Confident	90 Å²	90	115.9 Å²	115.9	63%	0.629	61%	0.612	S	S	*	*	H	α-helix	trans	-63.5	-44	-177.7	51.5	0	0	0	0	115	L5 L6	S2-L5 WeakPolarHBondContact O-CB 3.41Å; S2-L5 PolarHBondContact O-N 3.19Å; S2-L6 PolarHBondContact O-N 2.98Å
3	Q	73.9	Confident	76.4	Confident	155 Å²	155	117.2 Å²	117.2	72%	0.724	62%	0.615	S	S	*	*	H	α-helix	trans	-67.1	-39.9	179.5	-82.9	174.7	-20.7	0	0	113.6	L5 L6 Q7	Q3-L5 VanDerWaalsContact C-N 3.32Å; Q3-L6 PolarHBondContact O-N 2.7Å; Q3-Q7 WeakPolarHBondContact O-CG 3.48Å; Q3-Q7 PolarHBondContact O-N 3.39Å
4	L	73.8	Confident	77.3	Confident	114 Å²	114	115.2 Å²	115.2	60%	0.597	61%	0.61	S	S	*	*	H	α-helix	trans	-65.7	-37.1	174.9	-72	166.3	0	0	0	111.2	Q7 V8	L4-Q7 PolarHBondContact O-N 2.75Å; L4-V8 WeakPolarHBondContact O-CB 3.03Å; L4-V8 VanDerWaalsContact O-CG2 3.24Å; L4-V8 WeakPolarHBondContact O-CG2 3.44Å; L4-V8 PolarHBondContact O-N 3.47Å
5	L	74.3	Confident	77.8	Confident	114 Å²	114	119.7 Å²	119.7	60%	0.597	62%	0.615	S	S	*	*	H	α-helix	trans	-62.9	-44.1	174.9	-147.5	96.4	0	0	0	111.3	L1 S2 Q3 V8 L9	L1-L5 PolarHBondContact O-N 2.91Å; L1-L5 VanDerWaalsContact O-N 3.17Å; S2-L5 WeakPolarHBondContact O-CB 3.41Å; S2-L5 PolarHBondContact O-N 3.19Å; Q3-L5 VanDerWaalsContact C-N 3.32Å; L5-V8 PolarHBondContact O-N 2.9Å; L5-L9 HydrophobicContact CD2-CD1 4.26Å; L5-L9 WeakPolarHBondContact O-CB 3.24Å; L5-L9 WeakPolarHBondContact O-CG 3.04Å; L5-L9 PolarHBondContact O-N 3.12Å
6	L	74.3	Confident	78.3	Confident	119 Å²	119	117.9 Å²	117.9	62%	0.623	61%	0.607	S	S	*	*	H	α-helix	trans	-62.2	-40.9	176.1	-91.1	143.3	0	0	0	112.7	S2 Q3 L9 S10	S2-L6 PolarHBondContact O-N 2.98Å; Q3-L6 PolarHBondContact O-N 2.7Å; L6-L9 PolarHBondContact O-N 2.95Å; L6-S10 PolarHBondContact O-N 3.17Å; L6-S10 PolarHBondContact O-OG 3.34Å
7	Q	75.4	Confident	78.7	Confident	120 Å²	120	120.1 Å²	120.1	56%	0.561	61%	0.607	S	S	*	*	H	α-helix	trans	-68.3	-39.1	175.9	-72.7	-174.7	-44.1	0	0	112.8	Q3 L4 L9 S10 L11	Q3-Q7 WeakPolarHBondContact O-CG 3.48Å; Q3-Q7 PolarHBondContact O-N 3.39Å; L4-Q7 PolarHBondContact O-N 2.75Å; Q7-L9 VanDerWaalsContact C-N 3.35Å; Q7-S10 PolarHBondContact O-N 2.97Å; Q7-S10 PolarHBondContact O-OG 3.03Å; Q7-L11 VanDerWaalsContact O-CG 3.31Å; Q7-L11 WeakPolarHBondContact O-CG 3.5Å; Q7-L11 PolarHBondContact O-N 3.49Å; Q7-L11 VanDerWaalsContact O-N 3.11Å
8	V	78.4	Confident	79.1	Confident	77 Å²	77	117.4 Å²	117.4	47%	0.467	60%	0.597	S	S	.	*	H	α-helix	trans	-68	-37.9	176	172.6	0	0	0	0	110.9	L4 L5 K12	L4-V8 WeakPolarHBondContact O-CB 3.03Å; L4-V8 VanDerWaalsContact O-CG2 3.24Å; L4-V8 WeakPolarHBondContact O-CG2 3.44Å; L4-V8 PolarHBondContact O-N 3.47Å; L5-V8 PolarHBondContact O-N 2.9Å; V8-K12 HydrophobicContact CG1-CD 4.45Å; V8-K12 WeakPolarHBondContact O-CG 3.31Å; V8-K12 PolarHBondContact O-N 3.11Å; V8-K12 VanDerWaalsContact O-N 3.08Å
9	L	78.8	Confident	79.1	Confident	97 Å²	97	113.9 Å²	113.9	51%	0.508	58%	0.584	S	S	.	*	H	α-helix	trans	-66.7	-42.4	176	-72.2	170.6	0	0	0	111.9	L5 L6 Q7 K12 M13	L5-L9 HydrophobicContact CD2-CD1 4.26Å; L5-L9 WeakPolarHBondContact O-CB 3.24Å; L5-L9 WeakPolarHBondContact O-CG 3.04Å; L5-L9 PolarHBondContact O-N 3.12Å; L6-L9 PolarHBondContact O-N 2.95Å; Q7-L9 VanDerWaalsContact C-N 3.35Å; L9-K12 PolarHBondContact O-N 2.96Å; L9-M13 VanDerWaalsContact O-CG 3.23Å; L9-M13 WeakPolarHBondContact O-CG 3.4Å; L9-M13 PolarHBondContact O-N 2.91Å
10	S	81	Confident	79.1	Confident	62 Å²	62	114 Å²	114	43%	0.434	59%	0.585	S	S	.	*	H	α-helix	trans	-64.7	-42	177.7	66.4	0	0	0	0	112.1	L6 Q7 K12 M13 V14	L6-S10 PolarHBondContact O-N 3.17Å; L6-S10 PolarHBondContact O-OG 3.34Å; Q7-S10 PolarHBondContact O-N 2.97Å; Q7-S10 PolarHBondContact O-OG 3.03Å; S10-K12 PolarHBondContact O-N 2.05Å; S10-M13 PolarHBondContact O-N 2.81Å; S10-V14 WeakPolarHBondContact O-CG2 3.46Å; S10-V14 PolarHBondContact O-N 2.9Å
11	L	82.1	Confident	79	Confident	123 Å²	123	115.2 Å²	115.2	64%	0.644	58%	0.582	S	S	*	*	H	α-helix	trans	-63	-40.5	176	-71.9	171.4	0	0	0	112.3	Q7 V14 W15	Q7-L11 VanDerWaalsContact O-CG 3.31Å; Q7-L11 WeakPolarHBondContact O-CG 3.5Å; Q7-L11 PolarHBondContact O-N 3.49Å; Q7-L11 VanDerWaalsContact O-N 3.11Å; L11-V14 PolarHBondContact O-N 2.96Å; L11-W15 WeakPolarHBondContact O-CB 3.5Å; L11-W15 PolarHBondContact O-N 2.92Å
12	K	86.1	Confident	79.4	Confident	133 Å²	133	111.4 Å²	111.4	58%	0.578	56%	0.559	S	S	*	*	H	α-helix	trans	-63.9	-41.1	174.7	-77	-176	176.9	-170.8	0	112.2	V8 L9 S10 W15 L16	V8-K12 HydrophobicContact CG1-CD 4.45Å; V8-K12 WeakPolarHBondContact O-CG 3.31Å; V8-K12 PolarHBondContact O-N 3.11Å; V8-K12 VanDerWaalsContact O-N 3.08Å; L9-K12 PolarHBondContact O-N 2.96Å; S10-K12 PolarHBondContact O-N 2.05Å; K12-W15 PolarHBondContact O-N 3.14Å; K12-L16 WeakPolarHBondContact O-CB 3.24Å; K12-L16 VanDerWaalsContact O-CG 3.26Å; K12-L16 WeakPolarHBondContact O-CG 3.41Å; K12-L16 PolarHBondContact O-N 2.78Å
13	M	82.4	Confident	79.3	Confident	132 Å²	132	109.4 Å²	109.4	65%	0.65	55%	0.548	S	S	*	.	H	α-helix	trans	-65.9	-41.4	177.9	-69.8	-66.2	-72.6	0	0	111.9	L9 S10 L16 Y17	L9-M13 VanDerWaalsContact O-CG 3.23Å; L9-M13 WeakPolarHBondContact O-CG 3.4Å; L9-M13 PolarHBondContact O-N 2.91Å; S10-M13 PolarHBondContact O-N 2.81Å; M13-L16 PolarHBondContact O-N 3.03Å; M13-Y17 WeakPolarHBondContact O-CB 3.38Å; M13-Y17 PolarHBondContact O-N 3.38Å
14	V	88.6	Confident	79.1	Confident	90 Å²	90	111.3 Å²	111.3	55%	0.545	55%	0.549	S	S	.	.	H	α-helix	trans	-62.8	-44.8	174.6	172.3	0	0	0	0	110.6	S10 L11 Y17 V18	S10-V14 WeakPolarHBondContact O-CG2 3.46Å; S10-V14 PolarHBondContact O-N 2.9Å; L11-V14 PolarHBondContact O-N 2.96Å; V14-Y17 PolarHBondContact O-N 2.87Å; V14-V18 WeakPolarHBondContact O-CG2 3.18Å; V14-V18 PolarHBondContact O-N 2.9Å
15	W	85.4	Confident	78.6	Confident	182 Å²	182	109.8 Å²	109.8	69%	0.689	54%	0.541	S	S	*	.	H	α-helix	trans	-63	-44.2	178.5	-162.3	78.7	0	0	0	112.1	L11 K12 Y17 V18 C19	L11-W15 WeakPolarHBondContact O-CB 3.5Å; L11-W15 PolarHBondContact O-N 2.92Å; K12-W15 PolarHBondContact O-N 3.14Å; W15-Y17 VanDerWaalsContact C-N 3.32Å; W15-Y17 PolarHBondContact O-N 3.44Å; W15-V18 PolarHBondContact O-N 2.92Å; W15-C19 PolarHBondContact O-N 2.93Å; W15-C19 PolarHBondContact O-SG 3.07Å
16	L	86.1	Confident	77.9	Confident	92 Å²	92	107.8 Å²	107.8	48%	0.482	54%	0.536	S	S	.	.	H	α-helix	trans	-59.5	-42.3	173.8	-73.4	170.5	0	0	0	111.9	K12 M13 C19 L20	K12-L16 WeakPolarHBondContact O-CB 3.24Å; K12-L16 VanDerWaalsContact O-CG 3.26Å; K12-L16 WeakPolarHBondContact O-CG 3.41Å; K12-L16 PolarHBondContact O-N 2.78Å; M13-L16 PolarHBondContact O-N 3.03Å; L16-C19 PolarHBondContact O-N 3.27Å; L16-L20 WeakPolarHBondContact O-CB 3.47Å; L16-L20 WeakPolarHBondContact O-CG 3.19Å; L16-L20 PolarHBondContact O-N 3.33Å
17	Y	85	Confident	77.2	Confident	154 Å²	154	106.6 Å²	106.6	60%	0.604	53%	0.53	S	S	*	.	H	α-helix	trans	-63.1	-43.6	178	-171.6	-96	0	0	0	112	M13 V14 W15 L20 W21	M13-Y17 WeakPolarHBondContact O-CB 3.38Å; M13-Y17 PolarHBondContact O-N 3.38Å; V14-Y17 PolarHBondContact O-N 2.87Å; W15-Y17 VanDerWaalsContact C-N 3.32Å; W15-Y17 PolarHBondContact O-N 3.44Å; Y17-L20 PolarHBondContact O-N 2.92Å; Y17-W21 WeakPolarHBondContact O-CB 3.44Å; Y17-W21 PolarHBondContact O-N 3.04Å
18	V	84.9	Confident	76.4	Confident	72 Å²	72	103.8 Å²	103.8	44%	0.436	53%	0.527	S	S	.	.	H	α-helix	trans	-63.6	-46.7	175.7	173.6	0	0	0	0	111	V14 W15 L20 W21 E22	V14-V18 WeakPolarHBondContact O-CG2 3.18Å; V14-V18 PolarHBondContact O-N 2.9Å; W15-V18 PolarHBondContact O-N 2.92Å; V18-L20 VanDerWaalsContact C-N 3.32Å; V18-L20 PolarHBondContact O-N 2.89Å; V18-W21 WeakPolarHBondContact O-CB 3.37Å; V18-W21 PolarHBondContact O-N 2.8Å; V18-W21 VanDerWaalsContact O-N 3.14Å; V18-E22 HydrophobicContact CG1-CG 4.43Å; V18-E22 WeakPolarHBondContact O-CG 3.27Å; V18-E22 PolarHBondContact O-N 3.18Å
19	C	80.4	Confident	75.4	Confident	51 Å²	51	105.3 Å²	105.3	35%	0.345	53%	0.533	S	S	.	.	H	α-helix	trans	-60.6	-40.4	177.4	-68.8	0	0	0	0	112.6	W15 L16 W21 A23	W15-C19 PolarHBondContact O-N 2.93Å; W15-C19 PolarHBondContact O-SG 3.07Å; L16-C19 PolarHBondContact O-N 3.27Å; C19-W21 VanDerWaalsContact C-N 3.33Å; C19-A23 VanDerWaalsContact O-CB 3.27Å; C19-A23 WeakPolarHBondContact O-CB 3.23Å; C19-A23 PolarHBondContact O-N 3.01Å
20	L	78.7	Confident	74.4	Confident	115 Å²	115	104.8 Å²	104.8	60%	0.602	53%	0.533	S	S	*	.	H	α-helix	trans	-66.9	-34.7	176.4	-72.7	170	0	0	0	112.2	L16 Y17 V18 R24	L16-L20 WeakPolarHBondContact O-CB 3.47Å; L16-L20 WeakPolarHBondContact O-CG 3.19Å; L16-L20 PolarHBondContact O-N 3.33Å; Y17-L20 PolarHBondContact O-N 2.92Å; V18-L20 VanDerWaalsContact C-N 3.32Å; V18-L20 PolarHBondContact O-N 2.89Å; L20-R24 PolarHBondContact O-N 3.37Å; L20-R24 VanDerWaalsContact O-N 3.08Å
21	W	76.9	Confident	73.1	Confident	141 Å²	141	109.8 Å²	109.8	53%	0.534	54%	0.544	S	S	.	.	H	α-helix	trans	-68.4	-48.6	176.5	-172.9	-90.3	0	0	0	112.1	Y17 V18 C19 A23 R24 L25	Y17-W21 WeakPolarHBondContact O-CB 3.44Å; Y17-W21 PolarHBondContact O-N 3.04Å; V18-W21 WeakPolarHBondContact O-CB 3.37Å; V18-W21 PolarHBondContact O-N 2.8Å; V18-W21 VanDerWaalsContact O-N 3.14Å; C19-W21 VanDerWaalsContact C-N 3.33Å; W21-A23 VanDerWaalsContact C-N 3.33Å; W21-A23 PolarHBondContact O-N 3.43Å; W21-R24 WeakPolarHBondContact O-CB 3.41Å; W21-R24 PolarHBondContact O-N 3.47Å; W21-R24 VanDerWaalsContact O-N 3.15Å; W21-L25 HydrophobicContact CG-CD1 4.45Å; W21-L25 VanDerWaalsContact NE1-CD1 3.33Å; W21-L25 PolarHBondContact O-N 2.95Å
22	E	68.5	Low	71.6	Confident	107 Å²	107	110.2 Å²	110.2	50%	0.5	54%	0.543	S	S	.	.	H	α-helix	trans	-62.7	-39.1	177	-67.4	-56.3	137.2	0	0	112.1	V18 R24 L25 S26	V18-E22 HydrophobicContact CG1-CG 4.43Å; V18-E22 WeakPolarHBondContact O-CG 3.27Å; V18-E22 PolarHBondContact O-N 3.18Å; E22-R24 PolarHBondContact O-N 2.99Å; E22-L25 PolarHBondContact O-N 3.25Å; E22-S26 WeakPolarHBondContact O-CB 3.39Å; E22-S26 PolarHBondContact O-N 3.38Å; E22-S26 PolarHBondContact O-OG 2.92Å
23	A	69.8	Low	69.9	Low	48 Å²	48	111.8 Å²	111.8	40%	0.397	55%	0.546	S	S	.	.	H	α-helix	trans	-64.1	-38.5	174.2	0	0	0	0	0	112.2	C19 W21 S26 L27	C19-A23 VanDerWaalsContact O-CB 3.27Å; C19-A23 WeakPolarHBondContact O-CB 3.23Å; C19-A23 PolarHBondContact O-N 3.01Å; W21-A23 VanDerWaalsContact C-N 3.33Å; W21-A23 PolarHBondContact O-N 3.43Å; A23-S26 PolarHBondContact O-N 2.96Å; A23-L27 WeakPolarHBondContact O-CB 3.35Å; A23-L27 WeakPolarHBondContact O-CG 3.32Å; A23-L27 PolarHBondContact O-N 2.97Å
24	R	70.6	Confident	68.3	Low	194 Å²	194	108.4 Å²	108.4	73%	0.732	54%	0.535	S	S	*	.	H	α-helix	trans	-64.4	-43.1	174.1	-85.9	-169	-179.3	-119.1	4.1	112.5	L20 W21 E22 S26 L27 A28	L20-R24 PolarHBondContact O-N 3.37Å; L20-R24 VanDerWaalsContact O-N 3.08Å; W21-R24 WeakPolarHBondContact O-CB 3.41Å; W21-R24 PolarHBondContact O-N 3.47Å; W21-R24 VanDerWaalsContact O-N 3.15Å; E22-R24 PolarHBondContact O-N 2.99Å; R24-S26 VanDerWaalsContact C-N 3.31Å; R24-S26 PolarHBondContact O-N 3.44Å; R24-L27 PolarHBondContact O-N 3.35Å; R24-A28 WeakPolarHBondContact O-CB 3.26Å; R24-A28 PolarHBondContact O-N 3.08Å
25	L	62	Low	66.4	Low	82 Å²	82	110.4 Å²	110.4	43%	0.429	54%	0.542	S	S	.	.	H	α-helix	trans	-61.7	-41.8	176.1	-102.1	94.1	0	0	0	111.7	W21 E22 A28 N29	W21-L25 HydrophobicContact CG-CD1 4.45Å; W21-L25 VanDerWaalsContact NE1-CD1 3.33Å; W21-L25 PolarHBondContact O-N 2.95Å; E22-L25 PolarHBondContact O-N 3.25Å; L25-A28 PolarHBondContact O-N 3.47Å; L25-N29 PolarHBondContact O-N 3.3Å; L25-N29 VanDerWaalsContact O-N 3.08Å
26	S	60.6	Low	64.8	Low	72 Å²	72	105.3 Å²	105.3	50%	0.503	53%	0.531	S	S	.	.	H	α-helix	trans	-64.7	-45.8	179.1	-59	0	0	0	0	111.4	E22 A23 R24 N29 V30	E22-S26 WeakPolarHBondContact O-CB 3.39Å; E22-S26 PolarHBondContact O-N 3.38Å; E22-S26 PolarHBondContact O-OG 2.92Å; A23-S26 PolarHBondContact O-N 2.96Å; R24-S26 VanDerWaalsContact C-N 3.31Å; R24-S26 PolarHBondContact O-N 3.44Å; S26-N29 PolarHBondContact O-N 2.92Å; S26-V30 WeakPolarHBondContact O-CG2 3.45Å; S26-V30 PolarHBondContact O-N 2.98Å
27	L	59.7	Low	63.1	Low	95 Å²	95	105.6 Å²	105.6	50%	0.497	54%	0.536	S	S	.	.	H	α-helix	trans	-62.8	-44.3	175.6	-74	167.3	0	0	0	111.6	A23 R24 N29 V30 Y31	A23-L27 WeakPolarHBondContact O-CB 3.35Å; A23-L27 WeakPolarHBondContact O-CG 3.32Å; A23-L27 PolarHBondContact O-N 2.97Å; R24-L27 PolarHBondContact O-N 3.35Å; L27-N29 VanDerWaalsContact C-N 3.31Å; L27-N29 PolarHBondContact O-N 3.41Å; L27-V30 PolarHBondContact O-N 3.29Å; L27-V30 VanDerWaalsContact O-N 3.16Å; L27-Y31 HydrophobicContact CB-CD2 4.29Å; L27-Y31 HydrophobicContact CB-CE2 4.22Å; L27-Y31 HydrophobicContact CD2-CE2 4.32Å; L27-Y31 WeakPolarHBondContact O-CD2 3.27Å; L27-Y31 PolarHBondContact O-N 3.45Å
28	A	59.5	Low	61	Low	60 Å²	60	106.5 Å²	106.5	50%	0.496	55%	0.546	S	S	.	.	H	α-helix	trans	-58.8	-40.6	177.8	0	0	0	0	0	112.5	R24 L25 Y31 H32	R24-A28 WeakPolarHBondContact O-CB 3.26Å; R24-A28 PolarHBondContact O-N 3.08Å; L25-A28 PolarHBondContact O-N 3.47Å; A28-Y31 PolarHBondContact O-N 3.23Å; A28-H32 VanDerWaalsContact O-CB 3.32Å; A28-H32 WeakPolarHBondContact O-CB 3.38Å; A28-H32 PolarHBondContact O-N 2.97Å
29	N	57.4	Low	59.2	Low	109 Å²	109	106.6 Å²	106.6	58%	0.583	55%	0.546	S	S	*	.	H	α-helix	trans	-66	-41.9	174.4	-96.6	-55	0	0	0	112.8	L25 S26 L27 H32 Y33	L25-N29 PolarHBondContact O-N 3.3Å; L25-N29 VanDerWaalsContact O-N 3.08Å; S26-N29 PolarHBondContact O-N 2.92Å; L27-N29 VanDerWaalsContact C-N 3.31Å; L27-N29 PolarHBondContact O-N 3.41Å; N29-H32 PolarHBondContact O-N 3.37Å; N29-Y33 WeakPolarHBondContact O-CB 3.47Å; N29-Y33 PolarHBondContact O-N 3.14Å
30	V	56.8	Low	57.7	Low	86 Å²	86	112.8 Å²	112.8	52%	0.521	57%	0.568	S	S	.	*	H	α-helix	trans	-65.4	-41.4	176.5	173.9	0	0	0	0	111	S26 L27 Y33 S34	S26-V30 WeakPolarHBondContact O-CG2 3.45Å; S26-V30 PolarHBondContact O-N 2.98Å; L27-V30 PolarHBondContact O-N 3.29Å; L27-V30 VanDerWaalsContact O-N 3.16Å; V30-Y33 PolarHBondContact O-N 3.42Å; V30-S34 VanDerWaalsContact O-CB 3.24Å; V30-S34 WeakPolarHBondContact O-CB 3.02Å; V30-S34 PolarHBondContact O-N 2.9Å; V30-S34 PolarHBondContact O-OG 2.86Å
31	Y	52.8	Low	56.6	Low	167 Å²	167	110.6 Å²	110.6	66%	0.655	57%	0.566	S	S	*	*	H	α-helix	trans	-65.7	-39.3	174.6	-78.7	-68.8	0	0	0	111.8	L27 A28 S34 L35	L27-Y31 HydrophobicContact CB-CD2 4.29Å; L27-Y31 HydrophobicContact CB-CE2 4.22Å; L27-Y31 HydrophobicContact CD2-CE2 4.32Å; L27-Y31 WeakPolarHBondContact O-CD2 3.27Å; L27-Y31 PolarHBondContact O-N 3.45Å; A28-Y31 PolarHBondContact O-N 3.23Å; Y31-S34 PolarHBondContact O-N 3.39Å; Y31-L35 VanDerWaalsContact O-CB 3.28Å; Y31-L35 WeakPolarHBondContact O-CB 3.46Å; Y31-L35 PolarHBondContact O-N 3.11Å
32	H	52.3	Low	56.1	Low	133 Å²	133	104.3 Å²	104.3	62%	0.616	55%	0.545	S	S	*	.	H	α-helix	trans	-64.9	-43.5	175.8	-165.4	-101.8	0	0	0	111.8	A28 N29 T36	A28-H32 VanDerWaalsContact O-CB 3.32Å; A28-H32 WeakPolarHBondContact O-CB 3.38Å; A28-H32 PolarHBondContact O-N 2.97Å; N29-H32 PolarHBondContact O-N 3.37Å; H32-T36 WeakPolarHBondContact O-CG2 3.11Å; H32-T36 PolarHBondContact O-N 3.49Å; H32-T36 PolarHBondContact O-OG1 3.14Å
33	Y	49.8	Very low	56.6	Low	166 Å²	166	104.2 Å²	104.2	65%	0.651	55%	0.552	S	S	*	*	H	α-helix	trans	-65.6	-35.7	173.3	174.2	-98.5	0	0	0	112.8	N29 V30 T36 V37	N29-Y33 WeakPolarHBondContact O-CB 3.47Å; N29-Y33 PolarHBondContact O-N 3.14Å; V30-Y33 PolarHBondContact O-N 3.42Å; Y33-T36 PolarHBondContact O-OG1 3.08Å; Y33-V37 VanDerWaalsContact O-CG2 3.31Å; Y33-V37 WeakPolarHBondContact O-CG2 3.43Å
34	S	48.4	Very low	57.4	Low	60 Å²	60	103.5 Å²	103.5	42%	0.42	54%	0.543	S	S	.	.	H	α-helix	trans	-78.8	-32.1	-177.3	-56.9	0	0	0	0	112.5	V30 Y31 V37	V30-S34 VanDerWaalsContact O-CB 3.24Å; V30-S34 WeakPolarHBondContact O-CB 3.02Å; V30-S34 PolarHBondContact O-N 2.9Å; V30-S34 PolarHBondContact O-OG 2.86Å; Y31-S34 PolarHBondContact O-N 3.39Å; S34-V37 PolarHBondContact O-N 3.37Å
35	L	49.5	Very low	58.1	Low	132 Å²	132	99.6 Å²	99.6	69%	0.691	53%	0.534	S	S	*	.	H	α-helix	trans	-73	-32.8	177.3	-169.7	70.1	0	0	0	112.1	Y31 V37 H38	Y31-L35 VanDerWaalsContact O-CB 3.28Å; Y31-L35 WeakPolarHBondContact O-CB 3.46Å; Y31-L35 PolarHBondContact O-N 3.11Å; L35-V37 PolarHBondContact O-N 2.79Å; L35-H38 PolarHBondContact O-N 3.08Å
36	T	51	Low	59.2	Low	76 Å²	76	98.8 Å²	98.8	47%	0.466	53%	0.532	S	S	.	.	H	α-helix	trans	-67.9	-22.7	174.3	50	0	0	0	0	112.9	H32 Y33 H38	H32-T36 WeakPolarHBondContact O-CG2 3.11Å; H32-T36 PolarHBondContact O-N 3.49Å; H32-T36 PolarHBondContact O-OG1 3.14Å; Y33-T36 PolarHBondContact O-OG1 3.08Å; T36-H38 VanDerWaalsContact C-N 3.31Å; T36-H38 PolarHBondContact O-N 3.28Å
37	V	50.3	Low	60.5	Low	97 Å²	97	100 Å²	100	59%	0.588	53%	0.532	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.3	-12.8	178	175.9	0	0	0	0	112.8	Y33 S34 L35	Y33-V37 VanDerWaalsContact O-CG2 3.31Å; Y33-V37 WeakPolarHBondContact O-CG2 3.43Å; S34-V37 PolarHBondContact O-N 3.37Å; L35-V37 PolarHBondContact O-N 2.79Å
38	H	41.9	Very low	61.6	Low	174 Å²	174	97.8 Å²	97.8	81%	0.806	53%	0.527	S	S	*	.	T	Hydrogen-bonded Turn	trans	-119.1	23.7	-177.8	-121.1	73.3	0	0	0	114.8	L35 T36 K40	L35-H38 PolarHBondContact O-N 3.08Å; T36-H38 VanDerWaalsContact C-N 3.31Å; T36-H38 PolarHBondContact O-N 3.28Å; H38-K40 PolarHBondContact O-N 3.38Å
39	V	46.8	Very low	62.8	Low	73 Å²	73	98.3 Å²	98.3	44%	0.442	53%	0.531	S	S	.	.	S	Bend	trans	-80.6	114.6	166	-179	0	0	0	0	107.8	A41 F70	V39-A41 PolarHBondContact O-N 2.98Å; V39-F70 HydrophobicContact CG1-CD2 4.2Å
40	K	48.1	Very low	64.2	Low	182 Å²	182	98.4 Å²	98.4	79%	0.791	53%	0.528	S	S	*	.			trans	-39.4	111.7	172.2	-155.9	170.3	-171.8	172.7	0	108.5	H38 G42 F70	H38-K40 PolarHBondContact O-N 3.38Å; K40-G42 PolarHBondContact O-N 3.03Å; K40-F70 WeakPolarHBondContact O-CD2 3.2Å; K40-F70 WeakPolarHBondContact O-CE2 3.37Å
41	A	56.8	Low	65.3	Low	68 Å²	68	102.2 Å²	102.2	56%	0.562	53%	0.533	S	S	*	.	P	Polyproline II helix	trans	-56.1	135.8	-176.4	0	0	0	0	0	109.3	V39	V39-A41 PolarHBondContact O-N 2.98Å
42	G	65.2	Low	66.6	Low	10 Å²	10	96.7 Å²	96.7	10%	0.103	52%	0.518	C	S	.	.	P	Polyproline II helix	trans	-54.6	154.7	172.1	0	0	0	0	0	111.6	K40 C44 S68 C84	K40-G42 PolarHBondContact O-N 3.03Å; G42-C44 PolarHBondContact O-N 2.85Å; G42-S68 CarbonylContact C-O 3.55Å; G42-S68 WeakPolarHBondContact CA-O 3.39Å; G42-C84 VanDerWaalsContact CA-SG 3.51Å
43	T	79.9	Confident	67.9	Low	105 Å²	105	95.4 Å²	95.4	64%	0.644	52%	0.523	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-80.3	123.8	-176.5	52.5	0	0	0	0	110.2	C67 S68	T43-C67 CarbonylContact O-C 3.53Å; T43-C67 WeakPolarHBondContact O-CA 3.26Å; T43-S68 PolarHBondContact N-O 3.04Å; T43-S68 PolarHBondContact O-N 3.36Å
44	C	86	Confident	69.2	Low	32 Å²	32	92 Å²	92	22%	0.216	52%	0.516	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.5	127.1	170.3	-70.9	0	0	0	0	110.2	G42 V65 K66 C67 P82 S83	G42-C44 PolarHBondContact O-N 2.85Å; C44-V65 HydrophobicContact CB-CG1 4.26Å; C44-K66 CarbonylContact C-O 3.55Å; C44-K66 WeakPolarHBondContact CA-O 3.29Å; C44-C67 HydrophobicContact CB-CB 4.19Å; C44-C67 WeakPolarHBondContact CB-SG 3.36Å; C44-C67 WeakPolarHBondContact SG-CB 3.38Å; C44-C67 CovalentContact SG-SG 2.05Å; C44-C67 PolarHBondContact SG-SG 3.03Å; C44-P82 HydrophobicContact CB-CB 3.91Å; C44-P82 HydrophobicContact CB-CG 4.34Å; C44-S83 VanDerWaalsContact SG-C 3.51Å
45	E	85.1	Confident	70.2	Confident	113 Å²	113	99 Å²	99	53%	0.528	54%	0.539	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	139.7	178.8	61.8	180	-177	0	0	110.9	I47 V65 K66	E45-I47 HydrophobicContact CG-CG2 3.89Å; E45-I47 PolarHBondContact O-N 2.03Å; E45-V65 CarbonylContact O-C 3.56Å; E45-V65 WeakPolarHBondContact O-CA 3.48Å; E45-K66 HydrophobicContact CG-CB 4.02Å; E45-K66 PolarHBondContact N-O 3.32Å; E45-K66 PolarHBondContact O-N 3.43Å
46	V	84.8	Confident	71.4	Confident	64 Å²	64	98.6 Å²	98.6	39%	0.388	54%	0.537	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82	107.9	172.7	-179.1	0	0	0	0	107.5	A48 A49 Q63 T64 V65 P82	V46-A48 WeakPolarHBondContact CG1-O 3.39Å; V46-A49 HydrophobicContact CG1-CB 4.25Å; V46-Q63 HydrophobicContact CG1-CB 4.16Å; V46-Q63 HydrophobicContact CG1-CG 4.36Å; V46-T64 CarbonylContact C-O 3.36Å; V46-V65 HydrophobicContact CG2-CG2 4.24Å; V46-P82 HydrophobicContact CG2-CG 3.99Å
47	I	87.4	Confident	72.1	Confident	99 Å²	99	104.5 Å²	104.5	51%	0.508	56%	0.557	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-88.9	-21.7	-177	59.7	168.3	0	0	0	113	E45 T64 K66	E45-I47 HydrophobicContact CG-CG2 3.89Å; E45-I47 PolarHBondContact O-N 2.03Å; I47-T64 HydrophobicContact CD1-CG2 3.74Å; I47-T64 HydrophobicContact CG1-CG2 3.75Å; I47-T64 WeakPolarHBondContact CG1-O 3.48Å; I47-T64 PolarHBondContact N-O 3.08Å; I47-K66 HydrophobicContact CD1-CB 4.38Å; I47-K66 HydrophobicContact CG2-CB 3.7Å; I47-K66 HydrophobicContact CG2-CD 4.5Å
48	A	84.4	Confident	72.9	Confident	48 Å²	48	104.6 Å²	104.6	40%	0.397	55%	0.553	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-149	145.8	172.4	0	0	0	0	0	109.9	V46 Q63 T64	V46-A48 WeakPolarHBondContact CG1-O 3.39Å; A48-Q63 CarbonylContact O-C 3.55Å; A48-Q63 WeakPolarHBondContact O-CA 3.01Å; A48-T64 PolarHBondContact N-O 3.48Å; A48-T64 PolarHBondContact O-N 3.02Å
49	A	84.6	Confident	74.4	Confident	70 Å²	70	102.5 Å²	102.5	58%	0.579	54%	0.544	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-140.3	128.2	173.3	0	0	0	0	0	109.1	V46 S62 Q63	V46-A49 HydrophobicContact CG1-CB 4.25Å; A49-S62 WeakPolarHBondContact CA-O 3.11Å; A49-Q63 HydrophobicContact CB-CG 4.19Å
50	H	85.3	Confident	75.7	Confident	112 Å²	112	105.1 Å²	105.1	52%	0.519	55%	0.551	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-123.8	137.3	174.7	-166.5	-81.2	0	0	0	109	C52 S62	H50-C52 PolarHBondContact CE1-SG 3.31Å; H50-C52 PolarHBondContact ND1-SG 2.71Å; H50-S62 WeakPolarHBondContact CB-OG 3.38Å; H50-S62 PolarHBondContact N-O 2.93Å; H50-S62 PolarHBondContact O-N 3.41Å; H50-S62 VanDerWaalsContact O-O 3.14Å; H50-S62 PolarHBondContact O-OG 2.99Å
51	R	81.8	Confident	76.8	Confident	166 Å²	166	103.3 Å²	103.3	63%	0.626	54%	0.539	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-117	112.5	176.9	-71.9	-177.9	179.1	173.7	-1.2	107.8
52	C	78.9	Confident	77.9	Confident	50 Å²	50	102.8 Å²	102.8	34%	0.338	53%	0.531	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.5	140.2	172.7	-71.4	0	0	0	0	109.2	H50 E60	H50-C52 PolarHBondContact CE1-SG 3.31Å; H50-C52 PolarHBondContact ND1-SG 2.71Å; C52-E60 HydrophobicContact CB-CB 4.2Å; C52-E60 PolarHBondContact N-O 2.94Å; C52-E60 PolarHBondContact O-N 3.07Å
53	C	79.4	Confident	78.6	Confident	107 Å²	107	105.8 Å²	105.8	72%	0.723	54%	0.543	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-116.2	120.5	167.8	-64.7	0	0	0	0	108.4
54	N	76.8	Confident	78.8	Confident	95 Å²	95	104.6 Å²	104.6	51%	0.508	54%	0.535	S	S	.	.			trans	-84.2	156.8	171.6	-166.7	-5.1	0	0	0	110.4	N56 K57 I58	N54-N56 PolarHBondContact O-N 3.04Å; N54-K57 PolarHBondContact O-N 2.97Å; N54-I58 HydrophobicContact CB-CB 4.48Å; N54-I58 PolarHBondContact N-O 2.85Å; N54-I58 VanDerWaalsContact N-O 3.07Å
55	K	70.4	Confident	78.7	Confident	206 Å²	206	105.7 Å²	105.7	90%	0.896	54%	0.541	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.2	-25.1	177.7	-68.9	-178	179	177	0	113.4	K57	K55-K57 PolarHBondContact O-N 3.33Å
56	N	74.1	Confident	78.8	Confident	123 Å²	123	105.8 Å²	105.8	66%	0.658	54%	0.539	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.2	13.1	175.9	-64.3	-19.2	0	0	0	114.3	N54 I58	N54-N56 PolarHBondContact O-N 3.04Å; N56-I58 HydrophobicContact CB-CD1 4.11Å; N56-I58 HydrophobicContact CB-CG1 4.11Å; N56-I58 PolarHBondContact O-N 3.49Å
57	K	64.9	Low	79	Confident	200 Å²	200	104.4 Å²	104.4	87%	0.87	53%	0.533	S	S	*	.			trans	56.1	25.9	-173.3	-56.8	-177.2	-179.9	179.8	0	113.9	N54 K55 E59	N54-K57 PolarHBondContact O-N 2.97Å; K55-K57 PolarHBondContact O-N 3.33Å; K57-E59 PolarHBondContact O-N 3.42Å
58	I	68	Low	79.1	Confident	100 Å²	100	103.2 Å²	103.2	51%	0.513	53%	0.533	S	S	.	.			trans	-82.9	111.3	170.2	-58.4	173.5	0	0	0	106.2	N54 N56	N54-I58 HydrophobicContact CB-CB 4.48Å; N54-I58 PolarHBondContact N-O 2.85Å; N54-I58 VanDerWaalsContact N-O 3.07Å; N56-I58 HydrophobicContact CB-CD1 4.11Å; N56-I58 HydrophobicContact CB-CG1 4.11Å; N56-I58 PolarHBondContact O-N 3.49Å
59	E	72.6	Confident	79.3	Confident	130 Å²	130	102.8 Å²	102.8	61%	0.607	53%	0.527	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82.3	110.4	172.4	-171.4	-179.5	173	0	0	108.1	K57	K57-E59 PolarHBondContact O-N 3.42Å
60	E	75.1	Confident	79.5	Confident	127 Å²	127	104.4 Å²	104.4	59%	0.593	52%	0.521	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99.8	115.7	175.5	-176.3	175.4	-166.5	0	0	108.8	C52	C52-E60 HydrophobicContact CB-CB 4.2Å; C52-E60 PolarHBondContact N-O 2.94Å; C52-E60 PolarHBondContact O-N 3.07Å
61	R	72.3	Confident	79.8	Confident	145 Å²	145	105.4 Å²	105.4	55%	0.547	54%	0.537	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	103.9	178.8	-174.4	178.3	-177.9	177.4	-1.4	108.8	Q63	R61-Q63 HydrophobicContact CG-CG 4.25Å
62	S	78.2	Confident	80.1	Confident	57 Å²	57	100 Å²	100	40%	0.399	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.3	132.2	171.7	52.8	0	0	0	0	109.6	A49 H50	A49-S62 WeakPolarHBondContact CA-O 3.11Å; H50-S62 WeakPolarHBondContact CB-OG 3.38Å; H50-S62 PolarHBondContact N-O 2.93Å; H50-S62 PolarHBondContact O-N 3.41Å; H50-S62 VanDerWaalsContact O-O 3.14Å; H50-S62 PolarHBondContact O-OG 2.99Å
63	Q	81.4	Confident	80.7	Confident	73 Å²	73	99.9 Å²	99.9	34%	0.341	53%	0.528	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.3	130.7	176.9	-65.5	-173.2	-51.1	0	0	108.2	V46 A48 A49 R61 V65	V46-Q63 HydrophobicContact CG1-CB 4.16Å; V46-Q63 HydrophobicContact CG1-CG 4.36Å; A48-Q63 CarbonylContact O-C 3.55Å; A48-Q63 WeakPolarHBondContact O-CA 3.01Å; A49-Q63 HydrophobicContact CB-CG 4.19Å; R61-Q63 HydrophobicContact CG-CG 4.25Å; Q63-V65 HydrophobicContact CB-CG2 4.5Å
64	T	82.7	Confident	81.2	Confident	79 Å²	79	97.2 Å²	97.2	49%	0.485	51%	0.508	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.8	125.1	168.9	-49.7	0	0	0	0	107.5	V46 I47 A48	V46-T64 CarbonylContact C-O 3.36Å; I47-T64 HydrophobicContact CD1-CG2 3.74Å; I47-T64 HydrophobicContact CG1-CG2 3.75Å; I47-T64 WeakPolarHBondContact CG1-O 3.48Å; I47-T64 PolarHBondContact N-O 3.08Å; A48-T64 PolarHBondContact N-O 3.48Å; A48-T64 PolarHBondContact O-N 3.02Å
65	V	85.1	Confident	81.9	Confident	56 Å²	56	95.7 Å²	95.7	34%	0.339	51%	0.509	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.1	134.6	-174.5	177.6	0	0	0	0	109.1	C44 E45 V46 Q63 P82	C44-V65 HydrophobicContact CB-CG1 4.26Å; E45-V65 CarbonylContact O-C 3.56Å; E45-V65 WeakPolarHBondContact O-CA 3.48Å; V46-V65 HydrophobicContact CG2-CG2 4.24Å; Q63-V65 HydrophobicContact CB-CG2 4.5Å; V65-P82 HydrophobicContact CB-CB 4.28Å; V65-P82 HydrophobicContact CG1-CB 3.37Å; V65-P82 HydrophobicContact CG1-CG 3.92Å; V65-P82 HydrophobicContact CG2-CB 3.95Å; V65-P82 HydrophobicContact CG2-CG 4.1Å
66	K	86.6	Confident	83	Confident	114 Å²	114	86.5 Å²	86.5	50%	0.496	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.3	123.6	168.8	-175	177.4	178	-172.9	0	108.8	C44 E45 I47	C44-K66 CarbonylContact C-O 3.55Å; C44-K66 WeakPolarHBondContact CA-O 3.29Å; E45-K66 HydrophobicContact CG-CB 4.02Å; E45-K66 PolarHBondContact N-O 3.32Å; E45-K66 PolarHBondContact O-N 3.43Å; I47-K66 HydrophobicContact CD1-CB 4.38Å; I47-K66 HydrophobicContact CG2-CB 3.7Å; I47-K66 HydrophobicContact CG2-CD 4.5Å
67	C	88.7	Confident	83.8	Confident	36 Å²	36	82.3 Å²	82.3	24%	0.243	45%	0.451	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.6	140	177.6	-71.3	0	0	0	0	110.8	T43 C44 A75	T43-C67 CarbonylContact O-C 3.53Å; T43-C67 WeakPolarHBondContact O-CA 3.26Å; C44-C67 HydrophobicContact CB-CB 4.19Å; C44-C67 WeakPolarHBondContact CB-SG 3.36Å; C44-C67 WeakPolarHBondContact SG-CB 3.38Å; C44-C67 CovalentContact SG-SG 2.05Å; C44-C67 PolarHBondContact SG-SG 3.03Å; C67-A75 HydrophobicContact CB-CB 3.98Å
68	S	89.3	Confident	85.1	Confident	73 Å²	73	74.9 Å²	74.9	51%	0.51	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.8	88.1	169.9	-61.8	0	0	0	0	108.4	G42 T43	G42-S68 CarbonylContact C-O 3.55Å; G42-S68 WeakPolarHBondContact CA-O 3.39Å; T43-S68 PolarHBondContact N-O 3.04Å; T43-S68 PolarHBondContact O-N 3.36Å
69	C	89.8	Confident	86.2	Confident	40 Å²	40	77.7 Å²	77.7	27%	0.27	43%	0.427	S	S	.	.	P	Polyproline II helix	trans	-93.2	150.5	-177	-58.2	0	0	0	0	112.1	Q73 C84	C69-Q73 HydrophobicContact CB-CB 3.83Å; C69-C84 WeakPolarHBondContact CA-SG 3.4Å; C69-C84 HydrophobicContact CB-CB 3.79Å; C69-C84 WeakPolarHBondContact CB-SG 3.41Å; C69-C84 WeakPolarHBondContact SG-CB 3.42Å; C69-C84 CovalentContact SG-SG 2.04Å; C69-C84 PolarHBondContact SG-SG 3.43Å
70	F	89	Confident	87	Confident	104 Å²	104	74.4 Å²	74.4	46%	0.456	42%	0.422	S	S	.	.	P	Polyproline II helix	trans	-73.2	161.8	175.6	-71.9	-76.9	0	0	0	111.7	V39 K40 G72 Q73	V39-F70 HydrophobicContact CG1-CD2 4.2Å; K40-F70 WeakPolarHBondContact O-CD2 3.2Å; K40-F70 WeakPolarHBondContact O-CE2 3.37Å; F70-G72 PolarHBondContact O-N 2.94Å; F70-Q73 WeakPolarHBondContact O-CB 3.27Å; F70-Q73 PolarHBondContact O-N 3.45Å
71	P	89.8	Confident	87.7	Confident	132 Å²	132	74.6 Å²	74.6	86%	0.857	43%	0.425	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.4	132.6	173.3	-26.3	35.3	0	0	0	111.9	Q73	P71-Q73 VanDerWaalsContact C-N 3.34Å
72	G	88.9	Confident	88.5	Confident	54 Å²	54	68.9 Å²	68.9	56%	0.557	41%	0.406	S	S	*	.	T	Hydrogen-bonded Turn	trans	87.6	-5.3	-174	0	0	0	0	0	114.8	F70 A87	F70-G72 PolarHBondContact O-N 2.94Å; G72-A87 VanDerWaalsContact O-CB 3.31Å; G72-A87 WeakPolarHBondContact O-CB 3.44Å; G72-A87 PolarHBondContact O-N 3.27Å
73	Q	91.3	Very high	89.1	Confident	46 Å²	46	67.1 Å²	67.1	22%	0.215	39%	0.394	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.9	154.7	175	-64.2	-177.8	-25.5	0	0	112.2	C69 F70 P71 C84 V85	C69-Q73 HydrophobicContact CB-CB 3.83Å; F70-Q73 WeakPolarHBondContact O-CB 3.27Å; F70-Q73 PolarHBondContact O-N 3.45Å; P71-Q73 VanDerWaalsContact C-N 3.34Å; Q73-C84 HydrophobicContact CB-CB 4.27Å; Q73-V85 CarbonylContact C-O 3.47Å; Q73-V85 WeakPolarHBondContact CA-O 3.17Å; Q73-V85 WeakPolarHBondContact CB-O 3.43Å
74	V	91.3	Very high	89.6	Confident	52 Å²	52	64.2 Å²	64.2	32%	0.315	38%	0.381	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.7	164	174.9	-62.3	0	0	0	0	110.5	G76 C84 V85 A87 V90	V74-G76 PolarHBondContact O-N 3.49Å; V74-C84 WeakPolarHBondContact O-CA 3.37Å; V74-V85 HydrophobicContact CG2-CG2 4.26Å; V74-V85 PolarHBondContact N-O 3.34Å; V74-V85 PolarHBondContact O-N 2.89Å; V74-A87 HydrophobicContact CG1-CB 3.93Å; V74-V90 HydrophobicContact CG2-CB 4.02Å; V74-V90 HydrophobicContact CG2-CG2 3.54Å
75	A	91.4	Very high	90.1	Very high	62 Å²	62	61 Å²	61	51%	0.512	36%	0.361	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-62	132.3	173.3	0	0	0	0	0	110.4	C67	C67-A75 HydrophobicContact CB-CB 3.98Å
76	G	92.2	Very high	90.5	Very high	13 Å²	13	62 Å²	62	13%	0.134	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.7	-161.7	177.2	0	0	0	0	0	110.8	V74 S83	V74-G76 PolarHBondContact O-N 3.49Å; G76-S83 CarbonylContact C-O 3.56Å; G76-S83 WeakPolarHBondContact CA-O 3.38Å; G76-S83 PolarHBondContact N-O 3.15Å; G76-S83 PolarHBondContact O-N 3.37Å; G76-S83 VanDerWaalsContact O-O 3.12Å
77	T	91.1	Very high	90.7	Very high	35 Å²	35	58.1 Å²	58.1	22%	0.215	36%	0.355	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.1	128.1	-177.7	-59	0	0	0	0	110	M81 M98 P100 W116	T77-M81 WeakPolarHBondContact CA-O 3.45Å; T77-M98 PolarHBondContact N-SD 3.33Å; T77-M98 VanDerWaalsContact N-SD 3.43Å; T77-M98 VanDerWaalsContact O-CG 3.31Å; T77-M98 WeakPolarHBondContact O-CG 3.2Å; T77-P100 HydrophobicContact CG2-CB 4.27Å; T77-P100 WeakPolarHBondContact O-CA 3.35Å; T77-W116 HydrophobicContact CG2-CZ2 4.32Å
78	T	92.1	Very high	90.9	Very high	45 Å²	45	58.4 Å²	58.4	28%	0.276	36%	0.357	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.6	126.6	174.9	-52.7	0	0	0	0	107.7	A80 M81 S83	T78-A80 PolarHBondContact O-N 3.43Å; T78-M81 PolarHBondContact N-O 2.98Å; T78-M81 WeakPolarHBondContact O-CB 3.48Å; T78-M81 PolarHBondContact O-N 3.05Å; T78-S83 WeakPolarHBondContact CB-OG 3.49Å; T78-S83 PolarHBondContact N-OG 3.08Å; T78-S83 VanDerWaalsContact N-OG 3.14Å; T78-S83 PolarHBondContact OG1-OG 3.35Å
79	R	92.5	Very high	91.1	Very high	158 Å²	158	55.8 Å²	55.8	60%	0.596	34%	0.337	S	S	*	.	T	Hydrogen-bonded Turn	trans	47.8	54	-178.4	-64.2	-172.8	-71.3	-165.6	-4.2	113.4	M81 Q99 M102	R79-M81 PolarHBondContact O-N 3.16Å; R79-Q99 PolarHBondContact N-O 2.9Å; R79-M102 HydrophobicContact CB-SD 4.44Å
80	A	89.1	Confident	91.2	Very high	61 Å²	61	56 Å²	56	50%	0.504	34%	0.337	S	S	.	.	T	Hydrogen-bonded Turn	trans	55.3	18.7	-179.4	0	0	0	0	0	115.5	T78 P100 M102	T78-A80 PolarHBondContact O-N 3.43Å; A80-P100 PolarHBondContact N-O 3.41Å; A80-M102 HydrophobicContact CB-CG 4.01Å; A80-M102 HydrophobicContact CB-SD 4.04Å
81	M	88.4	Confident	91.3	Very high	132 Å²	132	54.7 Å²	54.7	65%	0.65	35%	0.345	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-118.9	141.5	178	-170.2	100	92.5	0	0	109.3	T77 T78 R79	T77-M81 WeakPolarHBondContact CA-O 3.45Å; T78-M81 PolarHBondContact N-O 2.98Å; T78-M81 WeakPolarHBondContact O-CB 3.48Å; T78-M81 PolarHBondContact O-N 3.05Å; R79-M81 PolarHBondContact O-N 3.16Å
82	P	90.3	Very high	91.5	Very high	25 Å²	25	53 Å²	53	16%	0.162	33%	0.326	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-61.8	138.3	170.9	26.7	-36.6	0	0	0	111.8	C44 V46 V65	C44-P82 HydrophobicContact CB-CB 3.91Å; C44-P82 HydrophobicContact CB-CG 4.34Å; V46-P82 HydrophobicContact CG2-CG 3.99Å; V65-P82 HydrophobicContact CB-CB 4.28Å; V65-P82 HydrophobicContact CG1-CB 3.37Å; V65-P82 HydrophobicContact CG1-CG 3.92Å; V65-P82 HydrophobicContact CG2-CB 3.95Å; V65-P82 HydrophobicContact CG2-CG 4.1Å
83	S	91	Very high	91.7	Very high	20 Å²	20	54.9 Å²	54.9	14%	0.14	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.6	156.5	-175.1	58.4	0	0	0	0	111.2	C44 G76 T78	C44-S83 VanDerWaalsContact SG-C 3.51Å; G76-S83 CarbonylContact C-O 3.56Å; G76-S83 WeakPolarHBondContact CA-O 3.38Å; G76-S83 PolarHBondContact N-O 3.15Å; G76-S83 PolarHBondContact O-N 3.37Å; G76-S83 VanDerWaalsContact O-O 3.12Å; T78-S83 WeakPolarHBondContact CB-OG 3.49Å; T78-S83 PolarHBondContact N-OG 3.08Å; T78-S83 VanDerWaalsContact N-OG 3.14Å; T78-S83 PolarHBondContact OG1-OG 3.35Å
84	C	91.7	Very high	91.9	Very high	11 Å²	11	58.2 Å²	58.2	7%	0.074	33%	0.329	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.6	127.9	166.3	-65.5	0	0	0	0	110.3	G42 C69 Q73 V74	G42-C84 VanDerWaalsContact CA-SG 3.51Å; C69-C84 WeakPolarHBondContact CA-SG 3.4Å; C69-C84 HydrophobicContact CB-CB 3.79Å; C69-C84 WeakPolarHBondContact CB-SG 3.41Å; C69-C84 WeakPolarHBondContact SG-CB 3.42Å; C69-C84 CovalentContact SG-SG 2.04Å; C69-C84 PolarHBondContact SG-SG 3.43Å; Q73-C84 HydrophobicContact CB-CB 4.27Å; V74-C84 WeakPolarHBondContact O-CA 3.37Å
85	V	92.5	Very high	92.1	Very high	11 Å²	11	56.3 Å²	56.3	7%	0.067	32%	0.317	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.5	164.3	179.9	-57.8	0	0	0	0	109.7	Q73 V74 A87 I89 V90 M98	Q73-V85 CarbonylContact C-O 3.47Å; Q73-V85 WeakPolarHBondContact CA-O 3.17Å; Q73-V85 WeakPolarHBondContact CB-O 3.43Å; V74-V85 HydrophobicContact CG2-CG2 4.26Å; V74-V85 PolarHBondContact N-O 3.34Å; V74-V85 PolarHBondContact O-N 2.89Å; V85-A87 PolarHBondContact O-N 3.38Å; V85-I89 HydrophobicContact CB-CD1 4.43Å; V85-V90 HydrophobicContact CG2-CG2 4.29Å; V85-M98 HydrophobicContact CB-CB 4.48Å; V85-M98 HydrophobicContact CG1-CB 3.94Å; V85-M98 HydrophobicContact CG2-CE 4.3Å
86	D	92.9	Very high	92.3	Very high	77 Å²	77	55.3 Å²	55.3	41%	0.412	31%	0.305	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-60.5	133.5	176.4	-168.2	-65.7	0	0	0	111.1	S88 I89	D86-S88 VanDerWaalsContact CG-OG 3.31Å; D86-S88 PolarHBondContact O-N 2.88Å; D86-S88 WeakPolarHBondContact OD1-CB 3.44Å; D86-S88 PolarHBondContact OD1-N 2.94Å; D86-S88 PolarHBondContact OD1-OG 3.43Å; D86-I89 HydrophobicContact CB-CD1 4.22Å; D86-I89 HydrophobicContact CB-CG1 4.27Å; D86-I89 WeakPolarHBondContact O-CB 3.31Å; D86-I89 PolarHBondContact O-N 2.99Å; D86-I89 VanDerWaalsContact O-N 3.08Å
87	A	92.1	Very high	92.5	Very high	34 Å²	34	60.3 Å²	60.3	28%	0.281	33%	0.325	S	S	.	.	H	α-helix	trans	-57.9	-30.4	-179.5	0	0	0	0	0	113.3	G72 V74 V85 I89 V90 A91	G72-A87 VanDerWaalsContact O-CB 3.31Å; G72-A87 WeakPolarHBondContact O-CB 3.44Å; G72-A87 PolarHBondContact O-N 3.27Å; V74-A87 HydrophobicContact CG1-CB 3.93Å; V85-A87 PolarHBondContact O-N 3.38Å; A87-I89 VanDerWaalsContact C-N 3.27Å; A87-I89 PolarHBondContact O-N 3.43Å; A87-V90 PolarHBondContact O-N 2.81Å; A87-A91 WeakPolarHBondContact O-CB 3.34Å; A87-A91 PolarHBondContact O-N 3.35Å
88	S	93.3	Very high	92.6	Very high	42 Å²	42	59.1 Å²	59.1	29%	0.294	32%	0.317	S	S	.	.	H	α-helix	trans	-60.4	-35.7	176.8	63	0	0	0	0	112.3	D86 V90 A91 Q92	D86-S88 VanDerWaalsContact CG-OG 3.31Å; D86-S88 PolarHBondContact O-N 2.88Å; D86-S88 WeakPolarHBondContact OD1-CB 3.44Å; D86-S88 PolarHBondContact OD1-N 2.94Å; D86-S88 PolarHBondContact OD1-OG 3.43Å; S88-V90 VanDerWaalsContact C-N 3.33Å; S88-V90 PolarHBondContact O-N 2.54Å; S88-A91 PolarHBondContact O-N 2.79Å; S88-Q92 VanDerWaalsContact O-CB 3.26Å; S88-Q92 WeakPolarHBondContact O-CB 3.44Å; S88-Q92 WeakPolarHBondContact O-CG 3.46Å; S88-Q92 PolarHBondContact O-N 3.2Å
89	I	92.6	Very high	92.7	Very high	18 Å²	18	63.6 Å²	63.6	9%	0.092	34%	0.335	C	S	.	.	H	α-helix	trans	-61.4	-44.4	-179.6	-63.3	175.5	0	0	0	110.5	V85 D86 A87 K93 W94 M98	V85-I89 HydrophobicContact CB-CD1 4.43Å; D86-I89 HydrophobicContact CB-CD1 4.22Å; D86-I89 HydrophobicContact CB-CG1 4.27Å; D86-I89 WeakPolarHBondContact O-CB 3.31Å; D86-I89 PolarHBondContact O-N 2.99Å; D86-I89 VanDerWaalsContact O-N 3.08Å; A87-I89 VanDerWaalsContact C-N 3.27Å; A87-I89 PolarHBondContact O-N 3.43Å; I89-K93 CarbonylContact O-C 3.5Å; I89-K93 WeakPolarHBondContact O-CA 3.05Å; I89-K93 PolarHBondContact O-N 2.98Å; I89-W94 HydrophobicContact CG2-CB 4.27Å; I89-W94 VanDerWaalsContact CG2-O 3.29Å; I89-W94 WeakPolarHBondContact CG2-O 3.24Å; I89-W94 PolarHBondContact O-N 3.2Å; I89-M98 HydrophobicContact CD1-CB 4.29Å; I89-M98 HydrophobicContact CG2-CB 4.21Å; I89-M98 HydrophobicContact CG2-CE 3.6Å; I89-M98 HydrophobicContact CG2-CG 4.46Å
90	V	91.1	Very high	92.9	Very high	45 Å²	45	56.2 Å²	56.2	27%	0.273	31%	0.308	S	S	.	.	H	α-helix	trans	-75.6	-39.4	178.8	179.3	0	0	0	0	110.9	V74 V85 A87 S88 Q92 K93 W95 M98	V74-V90 HydrophobicContact CG2-CB 4.02Å; V74-V90 HydrophobicContact CG2-CG2 3.54Å; V85-V90 HydrophobicContact CG2-CG2 4.29Å; A87-V90 PolarHBondContact O-N 2.81Å; S88-V90 VanDerWaalsContact C-N 3.33Å; S88-V90 PolarHBondContact O-N 2.54Å; V90-Q92 PolarHBondContact O-N 3.38Å; V90-K93 PolarHBondContact O-N 2.87Å; V90-W95 HydrophobicContact CB-CZ3 4.29Å; V90-W95 HydrophobicContact CG1-CH2 4.03Å; V90-W95 HydrophobicContact CG1-CZ3 3.96Å; V90-W95 HydrophobicContact CG2-CZ3 4.21Å; V90-M98 HydrophobicContact CG2-CE 4.26Å
91	A	91.9	Very high	93.2	Very high	75 Å²	75	53.9 Å²	53.9	62%	0.62	29%	0.287	S	S	*	.	H	α-helix	trans	-64.1	-40.9	179	0	0	0	0	0	112.5	A87 S88 K93	A87-A91 WeakPolarHBondContact O-CB 3.34Å; A87-A91 PolarHBondContact O-N 3.35Å; S88-A91 PolarHBondContact O-N 2.79Å; A91-K93 VanDerWaalsContact C-N 3.34Å
92	Q	93.6	Very high	93.5	Very high	97 Å²	97	52.3 Å²	52.3	45%	0.453	28%	0.279	S	S	.	.	T	Hydrogen-bonded Turn	trans	-91.2	0	179.8	-61.1	178	-66.4	0	0	112.7	S88 V90 W94	S88-Q92 VanDerWaalsContact O-CB 3.26Å; S88-Q92 WeakPolarHBondContact O-CB 3.44Å; S88-Q92 WeakPolarHBondContact O-CG 3.46Å; S88-Q92 PolarHBondContact O-N 3.2Å; V90-Q92 PolarHBondContact O-N 3.38Å; Q92-W94 HydrophobicContact CB-CD2 3.75Å; Q92-W94 HydrophobicContact CB-CE3 4.3Å; Q92-W94 HydrophobicContact CB-CG 3.98Å; Q92-W94 HydrophobicContact CB-CZ2 4.17Å; Q92-W94 VanDerWaalsContact CD-CH2 3.5Å; Q92-W94 HydrophobicContact CG-CZ2 4.43Å; Q92-W94 VanDerWaalsContact O-CD1 3.25Å; Q92-W94 PolarHBondContact O-N 3.13Å
93	K	94.2	Very high	93.7	Very high	93 Å²	93	59.5 Å²	59.5	40%	0.404	31%	0.311	S	S	.	.	T	Hydrogen-bonded Turn	trans	59.4	33.5	177.9	-49.7	-177.7	-178	-176.2	0	112.6	I89 V90 A91 W95 L113	I89-K93 CarbonylContact O-C 3.5Å; I89-K93 WeakPolarHBondContact O-CA 3.05Å; I89-K93 PolarHBondContact O-N 2.98Å; V90-K93 PolarHBondContact O-N 2.87Å; A91-K93 VanDerWaalsContact C-N 3.34Å; K93-W95 HydrophobicContact CB-CZ2 3.83Å; K93-W95 HydrophobicContact CG-CZ2 3.89Å; K93-W95 PolarHBondContact O-N 3.5Å; K93-W95 PolarHBondContact O-NE1 2.84Å; K93-L113 HydrophobicContact CB-CB 4.4Å; K93-L113 HydrophobicContact CD-CB 3.49Å; K93-L113 VanDerWaalsContact CD-CB 3.49Å; K93-L113 HydrophobicContact CD-CD1 4.11Å; K93-L113 HydrophobicContact CD-CG 4.43Å; K93-L113 WeakPolarHBondContact CD-O 3.32Å
94	W	95.3	Very high	93.7	Very high	116 Å²	116	62 Å²	62	44%	0.439	34%	0.34	S	S	.	.			trans	-82.2	51.9	178.2	-65.9	-14.7	0	0	0	111.3	I89 Q92 C96 Q97	I89-W94 HydrophobicContact CG2-CB 4.27Å; I89-W94 VanDerWaalsContact CG2-O 3.29Å; I89-W94 WeakPolarHBondContact CG2-O 3.24Å; I89-W94 PolarHBondContact O-N 3.2Å; Q92-W94 HydrophobicContact CB-CD2 3.75Å; Q92-W94 HydrophobicContact CB-CE3 4.3Å; Q92-W94 HydrophobicContact CB-CG 3.98Å; Q92-W94 HydrophobicContact CB-CZ2 4.17Å; Q92-W94 VanDerWaalsContact CD-CH2 3.5Å; Q92-W94 HydrophobicContact CG-CZ2 4.43Å; Q92-W94 VanDerWaalsContact O-CD1 3.25Å; Q92-W94 PolarHBondContact O-N 3.13Å; W94-C96 PolarHBondContact O-N 2.9Å; W94-Q97 HydrophobicContact CB-CB 4.07Å; W94-Q97 VanDerWaalsContact O-CB 3.27Å; W94-Q97 WeakPolarHBondContact O-CB 3.42Å; W94-Q97 PolarHBondContact O-N 3.23Å
95	W	95.3	Very high	94	Very high	13 Å²	13	63 Å²	63	5%	0.049	34%	0.343	C	S	.	.	T	Hydrogen-bonded Turn	trans	-55.3	-32.6	-167	-48.3	113.2	0	0	0	114.7	V90 K93 Q97 M98 P100 V109 L113 W116 V129	V90-W95 HydrophobicContact CB-CZ3 4.29Å; V90-W95 HydrophobicContact CG1-CH2 4.03Å; V90-W95 HydrophobicContact CG1-CZ3 3.96Å; V90-W95 HydrophobicContact CG2-CZ3 4.21Å; K93-W95 HydrophobicContact CB-CZ2 3.83Å; K93-W95 HydrophobicContact CG-CZ2 3.89Å; K93-W95 PolarHBondContact O-N 3.5Å; K93-W95 PolarHBondContact O-NE1 2.84Å; W95-Q97 VanDerWaalsContact C-N 3.34Å; W95-M98 HydrophobicContact CE3-CE 3.95Å; W95-M98 WeakPolarHBondContact O-CG 3.42Å; W95-P100 WeakPolarHBondContact O-CD 3.38Å; W95-V109 HydrophobicContact CB-CG2 4.25Å; W95-L113 WeakPolarHBondContact CZ2-O 3.28Å; W95-L113 PolarHBondContact NE1-O 2.7Å; W95-W116 HydrophobicContact CB-CB 3.9Å; W95-W116 HydrophobicContact CB-CD2 4.34Å; W95-W116 HydrophobicContact CB-CE3 3.87Å; W95-W116 HydrophobicContact CB-CG 4.39Å; W95-W116 HydrophobicContact CD2-CE3 4.23Å; W95-W116 HydrophobicContact CE3-CE3 4.16Å; W95-W116 HydrophobicContact CE3-CZ3 4.09Å; W95-W116 HydrophobicContact CG-CE3 4.13Å; W95-V129 HydrophobicContact CH2-CB 4.42Å; W95-V129 HydrophobicContact CH2-CG2 4.24Å; W95-V129 HydrophobicContact CZ3-CG2 4.09Å
96	C	96.1	Very high	94.2	Very high	40 Å²	40	67.5 Å²	67.5	27%	0.27	36%	0.364	S	S	.	.	T	Hydrogen-bonded Turn	trans	-80	-14.4	178.5	-68.9	0	0	0	0	114.1	W94 M98 Q99 C107	W94-C96 PolarHBondContact O-N 2.9Å; C96-M98 VanDerWaalsContact C-N 3.33Å; C96-Q99 PolarHBondContact O-N 2.84Å; C96-Q99 VanDerWaalsContact O-N 3.11Å; C96-C107 WeakPolarHBondContact CA-SG 3.06Å; C96-C107 HydrophobicContact CB-CB 3.85Å; C96-C107 WeakPolarHBondContact CB-SG 3.31Å; C96-C107 WeakPolarHBondContact SG-CB 3.43Å; C96-C107 CovalentContact SG-SG 2.05Å; C96-C107 PolarHBondContact SG-SG 3.45Å
97	Q	95.1	Very high	94.4	Very high	118 Å²	118	65.6 Å²	65.6	55%	0.551	36%	0.356	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.2	-26.9	178.3	-171	169.8	-13.4	0	0	112.6	W94 W95 Q99	W94-Q97 HydrophobicContact CB-CB 4.07Å; W94-Q97 VanDerWaalsContact O-CB 3.27Å; W94-Q97 WeakPolarHBondContact O-CB 3.42Å; W94-Q97 PolarHBondContact O-N 3.23Å; W95-Q97 VanDerWaalsContact C-N 3.34Å; Q97-Q99 PolarHBondContact O-N 2.87Å
98	M	93.3	Very high	94.6	Very high	10 Å²	10	68.6 Å²	68.6	5%	0.049	36%	0.363	C	S	.	.	T	Hydrogen-bonded Turn	trans	-74	-0.5	170.3	62.7	176.2	83.1	0	0	113.6	T77 V85 I89 V90 W95 C96 P100	T77-M98 PolarHBondContact N-SD 3.33Å; T77-M98 VanDerWaalsContact N-SD 3.43Å; T77-M98 VanDerWaalsContact O-CG 3.31Å; T77-M98 WeakPolarHBondContact O-CG 3.2Å; V85-M98 HydrophobicContact CB-CB 4.48Å; V85-M98 HydrophobicContact CG1-CB 3.94Å; V85-M98 HydrophobicContact CG2-CE 4.3Å; I89-M98 HydrophobicContact CD1-CB 4.29Å; I89-M98 HydrophobicContact CG2-CB 4.21Å; I89-M98 HydrophobicContact CG2-CE 3.6Å; I89-M98 HydrophobicContact CG2-CG 4.46Å; V90-M98 HydrophobicContact CG2-CE 4.26Å; W95-M98 HydrophobicContact CE3-CE 3.95Å; W95-M98 WeakPolarHBondContact O-CG 3.42Å; C96-M98 VanDerWaalsContact C-N 3.33Å; M98-P100 HydrophobicContact CG-CB 4.26Å; M98-P100 HydrophobicContact CG-CG 4.4Å
99	Q	95.8	Very high	94.8	Very high	140 Å²	140	69.4 Å²	69.4	65%	0.654	37%	0.366	S	S	*	.			trans	51.6	60.7	-177.8	-58.2	-180	-45.4	0	0	112.6	R79 C96 Q97 C101	R79-Q99 PolarHBondContact N-O 2.9Å; C96-Q99 PolarHBondContact O-N 2.84Å; C96-Q99 VanDerWaalsContact O-N 3.11Å; Q97-Q99 PolarHBondContact O-N 2.87Å; Q99-C101 VanDerWaalsContact C-N 3.3Å; Q99-C101 PolarHBondContact O-N 3.33Å
100	P	95.3	Very high	95	Very high	3 Å²	3	69.6 Å²	69.6	2%	0.019	37%	0.367	C	S	.	.			trans	-76.6	-17.5	-171.4	32.7	-36.7	0	0	0	113.5	T77 A80 W95 M98 W116	T77-P100 HydrophobicContact CG2-CB 4.27Å; T77-P100 WeakPolarHBondContact O-CA 3.35Å; A80-P100 PolarHBondContact N-O 3.41Å; W95-P100 WeakPolarHBondContact O-CD 3.38Å; M98-P100 HydrophobicContact CG-CB 4.26Å; M98-P100 HydrophobicContact CG-CG 4.4Å; P100-W116 HydrophobicContact CB-CD2 4.35Å; P100-W116 HydrophobicContact CB-CZ2 4Å; P100-W116 HydrophobicContact CG-CD2 4.19Å; P100-W116 HydrophobicContact CG-CG 3.94Å
101	C	95.9	Very high	95.2	Very high	12 Å²	12	73.8 Å²	73.8	8%	0.081	40%	0.395	C	S	.	.	S	Bend	trans	-88.4	160.6	-176.7	-52.8	0	0	0	0	112.5	Q99 E105 C107 C118	Q99-C101 VanDerWaalsContact C-N 3.3Å; Q99-C101 PolarHBondContact O-N 3.33Å; C101-E105 HydrophobicContact CB-CB 3.74Å; C101-C107 VanDerWaalsContact SG-CB 3.53Å; C101-C118 WeakPolarHBondContact CA-SG 3.36Å; C101-C118 HydrophobicContact CB-CB 3.71Å; C101-C118 WeakPolarHBondContact CB-SG 3.31Å; C101-C118 WeakPolarHBondContact SG-CA 3.44Å; C101-C118 WeakPolarHBondContact SG-CB 3.44Å; C101-C118 CovalentContact SG-SG 2.03Å; C101-C118 PolarHBondContact SG-SG 2.83Å
102	M	94.8	Very high	95.3	Very high	98 Å²	98	74 Å²	74	48%	0.483	39%	0.386	S	S	.	.	P	Polyproline II helix	trans	-74.5	165.4	173.7	-66.9	-71.2	-80.2	0	0	111.2	R79 A80 G104 E105	R79-M102 HydrophobicContact CB-SD 4.44Å; A80-M102 HydrophobicContact CB-CG 4.01Å; A80-M102 HydrophobicContact CB-SD 4.04Å; M102-G104 PolarHBondContact O-N 2.89Å; M102-E105 HydrophobicContact CB-CG 4.3Å; M102-E105 PolarHBondContact N-OE2 3.37Å; M102-E105 WeakPolarHBondContact O-CB 3.43Å; M102-E105 PolarHBondContact O-N 2.77Å; M102-E105 VanDerWaalsContact O-N 3.08Å
103	E	93.3	Very high	95.4	Very high	176 Å²	176	73.2 Å²	73.2	82%	0.822	38%	0.384	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.1	134.1	171.3	-71.4	178.8	-169.8	0	0	110.7	E105	E103-E105 VanDerWaalsContact C-N 3.29Å; E103-E105 PolarHBondContact O-N 3.14Å
104	G	92.6	Very high	95.4	Very high	72 Å²	72	71 Å²	71	74%	0.742	38%	0.379	S	S	*	.	T	Hydrogen-bonded Turn	trans	82.4	-2.5	-175.9	0	0	0	0	0	115.1	M102 T120	M102-G104 PolarHBondContact O-N 2.89Å; G104-T120 PolarHBondContact O-OG1 2.92Å; G104-T120 VanDerWaalsContact O-OG1 3.14Å
105	E	96.6	Very high	95.4	Very high	33 Å²	33	65.5 Å²	65.5	15%	0.154	36%	0.358	C	S	.	.	P	Polyproline II helix	trans	-93.9	139.3	169.5	-66.9	-178.8	156.6	0	0	111	C101 M102 E103 C118 S119 K125	C101-E105 HydrophobicContact CB-CB 3.74Å; M102-E105 HydrophobicContact CB-CG 4.3Å; M102-E105 PolarHBondContact N-OE2 3.37Å; M102-E105 WeakPolarHBondContact O-CB 3.43Å; M102-E105 PolarHBondContact O-N 2.77Å; M102-E105 VanDerWaalsContact O-N 3.08Å; E103-E105 VanDerWaalsContact C-N 3.29Å; E103-E105 PolarHBondContact O-N 3.14Å; E105-C118 HydrophobicContact CB-CB 4.3Å; E105-C118 WeakPolarHBondContact OE2-CB 3.33Å; E105-S119 WeakPolarHBondContact CA-O 3.43Å; E105-K125 IonicContact OE1-NZ 2.71Å; E105-K125 PolarHBondContact OE1-NZ 2.94Å
106	E	96.6	Very high	95.5	Very high	105 Å²	105	65.3 Å²	65.3	49%	0.491	36%	0.357	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.1	126.9	173.1	-171.9	-168.7	178.6	0	0	109.7	K108 C118 S119	E106-K108 WeakPolarHBondContact OE1-CE 3.3Å; E106-K108 IonicContact OE1-NZ 2.91Å; E106-K108 PolarHBondContact OE1-NZ 2.95Å; E106-K108 IonicContact OE2-NZ 2.75Å; E106-K108 PolarHBondContact OE2-NZ 3.41Å; E106-C118 WeakPolarHBondContact O-CA 3.36Å; E106-S119 PolarHBondContact N-O 2.82Å; E106-S119 PolarHBondContact O-N 3Å; E106-S119 PolarHBondContact O-OG 3.05Å
107	C	97.4	Very high	95.5	Very high	38 Å²	38	64.2 Å²	64.2	26%	0.257	35%	0.35	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.9	131	175.5	-172.2	0	0	0	0	111.4	C96 C101	C96-C107 WeakPolarHBondContact CA-SG 3.06Å; C96-C107 HydrophobicContact CB-CB 3.85Å; C96-C107 WeakPolarHBondContact CB-SG 3.31Å; C96-C107 WeakPolarHBondContact SG-CB 3.43Å; C96-C107 CovalentContact SG-SG 2.05Å; C96-C107 PolarHBondContact SG-SG 3.45Å; C101-C107 VanDerWaalsContact SG-CB 3.53Å
108	K	97	Very high	95.6	Very high	97 Å²	97	59 Å²	59	42%	0.422	33%	0.326	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.7	134.4	172.1	-73.1	175.4	169.7	133.4	0	110.8	E106 W116 S117	E106-K108 WeakPolarHBondContact OE1-CE 3.3Å; E106-K108 IonicContact OE1-NZ 2.91Å; E106-K108 PolarHBondContact OE1-NZ 2.95Å; E106-K108 IonicContact OE2-NZ 2.75Å; E106-K108 PolarHBondContact OE2-NZ 3.41Å; K108-W116 CarbonylContact O-C 3.47Å; K108-W116 VanDerWaalsContact O-CA 3.24Å; K108-W116 WeakPolarHBondContact O-CA 3.09Å; K108-W116 WeakPolarHBondContact O-CB 3.04Å; K108-S117 PolarHBondContact N-O 3.26Å; K108-S117 PolarHBondContact O-N 3.35Å
109	V	96.9	Very high	95.7	Very high	58 Å²	58	59.5 Å²	59.5	35%	0.352	33%	0.331	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73	138	170.9	170	0	0	0	0	109.1	W95 L113	W95-V109 HydrophobicContact CB-CG2 4.25Å; V109-L113 HydrophobicContact CG1-CD2 3.73Å
110	L	96.9	Very high	95.8	Very high	22 Å²	22	55.8 Å²	55.8	12%	0.115	32%	0.318	C	S	.	.			trans	-66.4	146.4	176.3	-65.2	179.2	0	0	0	111.1	D112 L113 G115 T126 K128	L110-D112 VanDerWaalsContact CB-OD1 3.27Å; L110-D112 WeakPolarHBondContact CB-OD1 3.06Å; L110-D112 PolarHBondContact O-N 2.77Å; L110-L113 WeakPolarHBondContact O-CA 3.06Å; L110-L113 PolarHBondContact O-N 3.02Å; L110-G115 PolarHBondContact N-O 3.49Å; L110-T126 HydrophobicContact CD1-CG2 3.94Å; L110-T126 HydrophobicContact CD2-CG2 4.02Å; L110-K128 HydrophobicContact CD1-CG 3.88Å
111	P	95.2	Very high	95.6	Very high	133 Å²	133	59.3 Å²	59.3	86%	0.864	36%	0.355	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.6	-29.9	-179.3	-24.7	33.8	0	0	0	114.4	L113	P111-L113 PolarHBondContact O-N 2.81Å
112	D	95.1	Very high	95.2	Very high	81 Å²	81	66.9 Å²	66.9	43%	0.433	39%	0.394	S	S	.	.	T	Hydrogen-bonded Turn	trans	-83.1	-0.1	177.2	62.6	7.4	0	0	0	113.1	L110 T114	L110-D112 VanDerWaalsContact CB-OD1 3.27Å; L110-D112 WeakPolarHBondContact CB-OD1 3.06Å; L110-D112 PolarHBondContact O-N 2.77Å; D112-T114 HydrophobicContact CB-CG2 4.03Å; D112-T114 VanDerWaalsContact CG-CG2 3.46Å; D112-T114 PolarHBondContact O-N 2.85Å; D112-T114 VanDerWaalsContact O-N 3.12Å; D112-T114 WeakPolarHBondContact OD1-CB 3.33Å; D112-T114 PolarHBondContact OD1-N 3.32Å; D112-T114 PolarHBondContact OD1-OG1 3.41Å; D112-T114 PolarHBondContact OD2-OG1 3.48Å
113	L	94.5	Very high	95	Very high	79 Å²	79	69.7 Å²	69.7	41%	0.414	40%	0.404	S	S	.	.	S	Bend	trans	57.1	19.4	-175.8	-48.5	173.2	0	0	0	113.5	K93 W95 V109 L110 P111 G115	K93-L113 HydrophobicContact CB-CB 4.4Å; K93-L113 HydrophobicContact CD-CB 3.49Å; K93-L113 VanDerWaalsContact CD-CB 3.49Å; K93-L113 HydrophobicContact CD-CD1 4.11Å; K93-L113 HydrophobicContact CD-CG 4.43Å; K93-L113 WeakPolarHBondContact CD-O 3.32Å; W95-L113 WeakPolarHBondContact CZ2-O 3.28Å; W95-L113 PolarHBondContact NE1-O 2.7Å; V109-L113 HydrophobicContact CG1-CD2 3.73Å; L110-L113 WeakPolarHBondContact O-CA 3.06Å; L110-L113 PolarHBondContact O-N 3.02Å; P111-L113 PolarHBondContact O-N 2.81Å; L113-G115 VanDerWaalsContact C-N 3.29Å
114	T	94.9	Very high	94.9	Very high	48 Å²	48	65.8 Å²	65.8	29%	0.294	39%	0.392	S	S	.	.	S	Bend	trans	-84.9	-3.5	-179.6	66.3	0	0	0	0	113.1	D112 V129	D112-T114 HydrophobicContact CB-CG2 4.03Å; D112-T114 VanDerWaalsContact CG-CG2 3.46Å; D112-T114 PolarHBondContact O-N 2.85Å; D112-T114 VanDerWaalsContact O-N 3.12Å; D112-T114 WeakPolarHBondContact OD1-CB 3.33Å; D112-T114 PolarHBondContact OD1-N 3.32Å; D112-T114 PolarHBondContact OD1-OG1 3.41Å; D112-T114 PolarHBondContact OD2-OG1 3.48Å; T114-V129 PolarHBondContact O-N 2.98Å
115	G	95.3	Very high	94.8	Very high	0 Å²	0	68 Å²	68	0%	0	38%	0.381	C	S	.	.	E	Extended strand (participates in β ladder)	trans	168.1	-148.2	178.6	0	0	0	0	0	112.7	L110 L113 T127	L110-G115 PolarHBondContact N-O 3.49Å; L113-G115 VanDerWaalsContact C-N 3.29Å; G115-T127 WeakPolarHBondContact CA-O 3.36Å
116	W	96.7	Very high	94.6	Very high	9 Å²	9	70.2 Å²	70.2	3%	0.034	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142	167.3	-174.5	65.7	96	0	0	0	112.3	T77 W95 P100 K108 T127 V129	T77-W116 HydrophobicContact CG2-CZ2 4.32Å; W95-W116 HydrophobicContact CB-CB 3.9Å; W95-W116 HydrophobicContact CB-CD2 4.34Å; W95-W116 HydrophobicContact CB-CE3 3.87Å; W95-W116 HydrophobicContact CB-CG 4.39Å; W95-W116 HydrophobicContact CD2-CE3 4.23Å; W95-W116 HydrophobicContact CE3-CE3 4.16Å; W95-W116 HydrophobicContact CE3-CZ3 4.09Å; W95-W116 HydrophobicContact CG-CE3 4.13Å; P100-W116 HydrophobicContact CB-CD2 4.35Å; P100-W116 HydrophobicContact CB-CZ2 4Å; P100-W116 HydrophobicContact CG-CD2 4.19Å; P100-W116 HydrophobicContact CG-CG 3.94Å; K108-W116 CarbonylContact O-C 3.47Å; K108-W116 VanDerWaalsContact O-CA 3.24Å; K108-W116 WeakPolarHBondContact O-CA 3.09Å; K108-W116 WeakPolarHBondContact O-CB 3.04Å; W116-T127 HydrophobicContact CH2-CG2 3.45Å; W116-T127 VanDerWaalsContact CH2-CG2 3.45Å; W116-T127 HydrophobicContact CZ2-CG2 3.42Å; W116-T127 VanDerWaalsContact CZ2-CG2 3.42Å; W116-T127 HydrophobicContact CZ3-CG2 4.02Å; W116-T127 PolarHBondContact N-O 3.35Å; W116-T127 PolarHBondContact O-N 2.04Å; W116-V129 HydrophobicContact CZ3-CG2 3.81Å
117	S	96.6	Very high	94.4	Very high	16 Å²	16	68 Å²	68	11%	0.112	39%	0.39	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128	141.9	169.1	62	0	0	0	0	110.9	K108 K125	K108-S117 PolarHBondContact N-O 3.26Å; K108-S117 PolarHBondContact O-N 3.35Å; S117-K125 CarbonylContact C-O 3.55Å; S117-K125 WeakPolarHBondContact CA-O 3.34Å
118	C	97	Very high	94.1	Very high	8 Å²	8	72.6 Å²	72.6	5%	0.054	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	120.6	170.3	-59	0	0	0	0	108.7	C101 E105 E106 K125	C101-C118 WeakPolarHBondContact CA-SG 3.36Å; C101-C118 HydrophobicContact CB-CB 3.71Å; C101-C118 WeakPolarHBondContact CB-SG 3.31Å; C101-C118 WeakPolarHBondContact SG-CA 3.44Å; C101-C118 WeakPolarHBondContact SG-CB 3.44Å; C101-C118 CovalentContact SG-SG 2.03Å; C101-C118 PolarHBondContact SG-SG 2.83Å; E105-C118 HydrophobicContact CB-CB 4.3Å; E105-C118 WeakPolarHBondContact OE2-CB 3.33Å; E106-C118 WeakPolarHBondContact O-CA 3.36Å; C118-K125 HydrophobicContact CB-CB 4.48Å; C118-K125 PolarHBondContact N-O 2.83Å; C118-K125 PolarHBondContact O-N 2.05Å
119	S	96.3	Very high	93.6	Very high	22 Å²	22	71.1 Å²	71.1	15%	0.154	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.6	135	-179.4	47.5	0	0	0	0	112.3	E105 E106 K123	E105-S119 WeakPolarHBondContact CA-O 3.43Å; E106-S119 PolarHBondContact N-O 2.82Å; E106-S119 PolarHBondContact O-N 3Å; E106-S119 PolarHBondContact O-OG 3.05Å; S119-K123 WeakPolarHBondContact CA-O 3.11Å
120	T	96.1	Very high	92.9	Very high	61 Å²	61	74.7 Å²	74.7	37%	0.374	43%	0.427	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.3	110.1	170.4	-122.7	0	0	0	0	108.7	G104 N122 K123	G104-T120 PolarHBondContact O-OG1 2.92Å; G104-T120 VanDerWaalsContact O-OG1 3.14Å; T120-N122 PolarHBondContact O-N 2.84Å; T120-N122 VanDerWaalsContact O-N 3.14Å; T120-K123 PolarHBondContact N-O 3.37Å; T120-K123 PolarHBondContact O-N 3.27Å
121	G	90.9	Very high	91.4	Very high	77 Å²	77	88.5 Å²	88.5	79%	0.794	48%	0.478	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.3	-119.4	-171.2	0	0	0	0	0	111.6
122	N	89.4	Confident	91.2	Very high	172 Å²	172	86.3 Å²	86.3	92%	0.92	46%	0.459	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.4	1.2	179.5	-61.8	-21.7	0	0	0	114.2	T120	T120-N122 PolarHBondContact O-N 2.84Å; T120-N122 VanDerWaalsContact O-N 3.14Å
123	K	88.9	Confident	91	Very high	156 Å²	156	86.6 Å²	86.6	68%	0.678	46%	0.46	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.1	124.4	-179.8	-64.2	-178.7	-179	178.4	0	109.4	S119 T120	S119-K123 WeakPolarHBondContact CA-O 3.11Å; T120-K123 PolarHBondContact N-O 3.37Å; T120-K123 PolarHBondContact O-N 3.27Å
124	V	91.9	Very high	90.8	Very high	95 Å²	95	87 Å²	87	58%	0.576	46%	0.463	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-120.1	125.4	176.2	-176.7	0	0	0	0	108.9
125	K	91.4	Very high	90.5	Very high	118 Å²	118	89.3 Å²	89.3	51%	0.513	47%	0.473	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.3	126.8	172.1	-61.9	169.9	-174	160.1	0	107.9	E105 S117 C118	E105-K125 IonicContact OE1-NZ 2.71Å; E105-K125 PolarHBondContact OE1-NZ 2.94Å; S117-K125 CarbonylContact C-O 3.55Å; S117-K125 WeakPolarHBondContact CA-O 3.34Å; C118-K125 HydrophobicContact CB-CB 4.48Å; C118-K125 PolarHBondContact N-O 2.83Å; C118-K125 PolarHBondContact O-N 2.05Å
126	T	91.9	Very high	90.2	Very high	79 Å²	79	94.9 Å²	94.9	49%	0.485	50%	0.502	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116	133.8	-179.2	-60.1	0	0	0	0	109.9	L110 K128	L110-T126 HydrophobicContact CD1-CG2 3.94Å; L110-T126 HydrophobicContact CD2-CG2 4.02Å; T126-K128 HydrophobicContact CG2-CG 4.35Å
127	T	91.6	Very high	89.8	Confident	58 Å²	58	100.6 Å²	100.6	36%	0.356	53%	0.533	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.7	125.3	173.2	-56	0	0	0	0	108.6	G115 W116	G115-T127 WeakPolarHBondContact CA-O 3.36Å; W116-T127 HydrophobicContact CH2-CG2 3.45Å; W116-T127 VanDerWaalsContact CH2-CG2 3.45Å; W116-T127 HydrophobicContact CZ2-CG2 3.42Å; W116-T127 VanDerWaalsContact CZ2-CG2 3.42Å; W116-T127 HydrophobicContact CZ3-CG2 4.02Å; W116-T127 PolarHBondContact N-O 3.35Å; W116-T127 PolarHBondContact O-N 2.04Å
128	K	91.2	Very high	89.3	Confident	136 Å²	136	106.6 Å²	106.6	59%	0.591	56%	0.563	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-111.7	139.2	174.5	-68.2	-168.9	175.7	-165.2	0	109.6	L110 T126	L110-K128 HydrophobicContact CD1-CG 3.88Å; T126-K128 HydrophobicContact CG2-CG 4.35Å
129	V	87.9	Confident	88.7	Confident	65 Å²	65	114.2 Å²	114.2	39%	0.394	60%	0.603	S	S	.	*			trans	-103.6	114.7	175.6	-175.7	0	0	0	0	107.8	W95 T114 W116	W95-V129 HydrophobicContact CH2-CB 4.42Å; W95-V129 HydrophobicContact CH2-CG2 4.24Å; W95-V129 HydrophobicContact CZ3-CG2 4.09Å; T114-V129 PolarHBondContact O-N 2.98Å; W116-V129 HydrophobicContact CZ3-CG2 3.81Å
130	T	81.9	Confident	88.1	Confident	134 Å²	134	121.9 Å²	121.9	82%	0.822	64%	0.64	S	S	*	*			trans	-93.7	133	170	52.2	0	0	0	0	108.9
131	R	64.1	Low	87.4	Confident	312 Å²	312	127.5 Å²	127.5	100%	1.177	66%	0.664	S	S	*	*			trans	-88.6	0	177	-134.1	-177	-170	176.3	2.8	111.2

Retrieved 131 of 131 residues in 262.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).