A0A087X5W6_POEFO Loading...

Protein FMC1 homolog

Plays a role in the assembly/stability of the mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V).

AlphaFold DB , UniProt , Accession A0A087X5W6, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 112 aa.

						>A0A087X5W6_POEFO|A0A087X5W6
MAMASLSSPLRVCRGILKELRTIQGPSYKQSLAYNYVIDQFRKNKVTGERYCRAQQEAHHASLTYLCLLTSTRNHLALHNLYHGKGERSPEEVAGLVGLRLPTQPGGKGWEK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	36.2	Very low	64.6	Low	234 Å²	234	115.5 Å²	115.5	100%	1.153	66%	0.664	S	S	*	*				0	101.8	0	-109.7	176.4	172.5	0	0	108.1	M3	M1-M3 PolarHBondContact O-N 3.14Å
2	A	31.3	Very low	67	Low	107 Å²	107	105.9 Å²	105.9	88%	0.884	61%	0.608	S	S	*	*			trans	-74.1	112.8	175.7	0	0	0	0	0	108.3	A4	A2-A4 PolarHBondContact O-N 3.16Å; A2-A4 VanDerWaalsContact O-N 3.14Å
3	M	37.3	Very low	69.1	Low	169 Å²	169	98.7 Å²	98.7	83%	0.833	57%	0.568	S	S	*	*			trans	-59.2	117.2	167.6	-76.7	-70.9	145.3	0	0	107.3	M1 S5	M1-M3 PolarHBondContact O-N 3.14Å; M3-S5 PolarHBondContact O-N 3.15Å; M3-S5 VanDerWaalsContact O-N 3.16Å
4	A	51.6	Low	70.9	Confident	87 Å²	87	104.2 Å²	104.2	72%	0.719	58%	0.575	S	S	*	*			trans	-47.4	126.2	172.7	0	0	0	0	0	108	A2 L6	A2-A4 PolarHBondContact O-N 3.16Å; A2-A4 VanDerWaalsContact O-N 3.14Å; A4-L6 PolarHBondContact O-N 2.89Å
5	S	59	Low	72.5	Confident	114 Å²	114	98.5 Å²	98.5	80%	0.797	55%	0.549	S	S	*	.			trans	-54.3	113.6	-179.3	68.9	0	0	0	0	107.7	M3 S7	M3-S5 PolarHBondContact O-N 3.15Å; M3-S5 VanDerWaalsContact O-N 3.16Å; S5-S7 PolarHBondContact O-N 3.3Å
6	L	63.8	Low	74	Confident	120 Å²	120	93.1 Å²	93.1	63%	0.628	52%	0.519	S	S	*	.	P	Polyproline II helix	trans	-51.9	118.8	-179.5	-77.1	161.7	0	0	0	107.7	A4 S8 L63	A4-L6 PolarHBondContact O-N 2.89Å; L6-S8 PolarHBondContact O-N 3.41Å; L6-L63 HydrophobicContact CD2-CD1 3.35Å
7	S	76.4	Confident	75.3	Confident	47 Å²	47	88.9 Å²	88.9	33%	0.329	50%	0.495	S	S	.	.	P	Polyproline II helix	trans	-54.8	139.5	-177.8	57	0	0	0	0	109.2	S5 V12 H59 L63	S5-S7 PolarHBondContact O-N 3.3Å; S7-V12 WeakPolarHBondContact OG-CG2 3.4Å; S7-H59 PolarHBondContact O-CE1 3.17Å; S7-H59 PolarHBondContact O-NE2 2.86Å; S7-L63 WeakPolarHBondContact OG-CD2 3.31Å
8	S	86.2	Confident	76.5	Confident	50 Å²	50	91.8 Å²	91.8	35%	0.35	50%	0.502	S	S	.	.	P	Polyproline II helix	trans	-56	144.4	-172.6	67.2	0	0	0	0	112.2	L6 L10 R11 V12	L6-S8 PolarHBondContact O-N 3.41Å; S8-L10 PolarHBondContact O-N 2.8Å; S8-R11 WeakPolarHBondContact O-CA 3.38Å; S8-R11 WeakPolarHBondContact O-CB 3.44Å; S8-R11 PolarHBondContact O-N 3.03Å; S8-R11 WeakPolarHBondContact OG-CG 3.33Å; S8-V12 PolarHBondContact O-N 3.18Å
9	P	87.3	Confident	77.5	Confident	56 Å²	56	87.7 Å²	87.7	36%	0.364	48%	0.478	S	S	.	.	H	α-helix	trans	-52.3	-35.6	-176.6	-27.6	31.2	0	0	0	113.5	R11 V12 C13 F41	P9-R11 PolarHBondContact O-N 3.48Å; P9-V12 PolarHBondContact O-N 3.04Å; P9-C13 WeakPolarHBondContact O-CB 3.36Å; P9-C13 PolarHBondContact O-N 3.05Å; P9-F41 HydrophobicContact CB-CD1 4.34Å; P9-F41 HydrophobicContact CB-CE1 4.05Å; P9-F41 WeakPolarHBondContact O-CE1 3.24Å
10	L	89.2	Confident	78.4	Confident	110 Å²	110	84.1 Å²	84.1	58%	0.576	46%	0.459	S	S	*	.	H	α-helix	trans	-65.1	-35.6	175.9	-65.2	177.5	0	0	0	113.3	S8 R14	S8-L10 PolarHBondContact O-N 2.8Å; L10-R14 WeakPolarHBondContact O-CB 3.45Å; L10-R14 VanDerWaalsContact O-CG 3.25Å; L10-R14 WeakPolarHBondContact O-CG 3.25Å; L10-R14 PolarHBondContact O-N 3.11Å
11	R	92	Very high	79.2	Confident	177 Å²	177	86.2 Å²	86.2	67%	0.668	46%	0.46	S	S	*	.	H	α-helix	trans	-67.3	-42.6	173.9	-70	-177.8	-150.1	-150.5	6.3	110.5	S8 P9 R14 G15	S8-R11 WeakPolarHBondContact O-CA 3.38Å; S8-R11 WeakPolarHBondContact O-CB 3.44Å; S8-R11 PolarHBondContact O-N 3.03Å; S8-R11 WeakPolarHBondContact OG-CG 3.33Å; P9-R11 PolarHBondContact O-N 3.48Å; R11-R14 PolarHBondContact O-N 3.04Å; R11-G15 PolarHBondContact O-N 2.87Å
12	V	93.4	Very high	82	Confident	0 Å²	0	79.1 Å²	79.1	0%	0	43%	0.43	C	S	.	.	H	α-helix	trans	-62	-48.2	177.5	-175.3	0	0	0	0	110.6	S7 S8 P9 R14 G15 I16 F41 L63 L66	S7-V12 WeakPolarHBondContact OG-CG2 3.4Å; S8-V12 PolarHBondContact O-N 3.18Å; P9-V12 PolarHBondContact O-N 3.04Å; V12-R14 PolarHBondContact O-N 3.37Å; V12-G15 WeakPolarHBondContact O-CA 3.44Å; V12-G15 PolarHBondContact O-N 3.43Å; V12-G15 VanDerWaalsContact O-N 3.1Å; V12-I16 HydrophobicContact CG1-CD1 4.16Å; V12-I16 WeakPolarHBondContact O-CG1 3.29Å; V12-I16 PolarHBondContact O-N 2.82Å; V12-F41 HydrophobicContact CB-CZ 4.37Å; V12-F41 HydrophobicContact CG1-CZ 4.3Å; V12-L63 HydrophobicContact CG1-CD2 4.22Å; V12-L63 HydrophobicContact CG1-CG 4.38Å; V12-L63 HydrophobicContact CG2-CD2 3.48Å; V12-L63 VanDerWaalsContact CG2-CD2 3.48Å; V12-L63 HydrophobicContact CG2-CG 4.02Å; V12-L66 HydrophobicContact CG1-CB 4.4Å; V12-L66 HydrophobicContact CG1-CD2 4.12Å
13	C	93.9	Very high	84.8	Confident	12 Å²	12	79.4 Å²	79.4	8%	0.081	42%	0.415	C	S	.	.	H	α-helix	trans	-54.3	-51.7	174.7	-176.6	0	0	0	0	111.3	P9 G15 I16 L17 F41	P9-C13 WeakPolarHBondContact O-CB 3.36Å; P9-C13 PolarHBondContact O-N 3.05Å; C13-G15 VanDerWaalsContact C-N 3.27Å; C13-G15 PolarHBondContact O-N 2.84Å; C13-I16 PolarHBondContact O-N 3.09Å; C13-L17 VanDerWaalsContact O-CG 3.28Å; C13-L17 WeakPolarHBondContact O-CG 3.26Å; C13-L17 PolarHBondContact O-N 2.88Å; C13-F41 HydrophobicContact CB-CD1 3.76Å; C13-F41 HydrophobicContact CB-CD2 3.93Å; C13-F41 HydrophobicContact CB-CE1 3.7Å; C13-F41 HydrophobicContact CB-CE2 3.87Å; C13-F41 HydrophobicContact CB-CG 3.87Å; C13-F41 HydrophobicContact CB-CZ 3.74Å
14	R	94.6	Very high	87.4	Confident	176 Å²	176	75 Å²	75	66%	0.664	39%	0.393	S	S	*	.	H	α-helix	trans	-59.4	-37.5	177.2	-74.1	171.2	177.2	165.5	-0.8	112.6	L10 R11 V12 L17 K18	L10-R14 WeakPolarHBondContact O-CB 3.45Å; L10-R14 VanDerWaalsContact O-CG 3.25Å; L10-R14 WeakPolarHBondContact O-CG 3.25Å; L10-R14 PolarHBondContact O-N 3.11Å; R11-R14 PolarHBondContact O-N 3.04Å; V12-R14 PolarHBondContact O-N 3.37Å; R14-L17 PolarHBondContact O-N 2.82Å; R14-K18 WeakPolarHBondContact O-CB 3.39Å; R14-K18 PolarHBondContact O-N 3.09Å
15	G	95.8	Very high	89.3	Confident	19 Å²	19	72 Å²	72	20%	0.196	37%	0.37	C	S	.	.	H	α-helix	trans	-60.6	-50.4	174.3	0	0	0	0	0	111.8	R11 V12 C13 L17 K18 E19 L66	R11-G15 PolarHBondContact O-N 2.87Å; V12-G15 WeakPolarHBondContact O-CA 3.44Å; V12-G15 PolarHBondContact O-N 3.43Å; V12-G15 VanDerWaalsContact O-N 3.1Å; C13-G15 VanDerWaalsContact C-N 3.27Å; C13-G15 PolarHBondContact O-N 2.84Å; G15-L17 VanDerWaalsContact C-N 3.33Å; G15-L17 PolarHBondContact O-N 3.45Å; G15-K18 WeakPolarHBondContact O-CB 3.42Å; G15-K18 PolarHBondContact O-N 2.71Å; G15-K18 VanDerWaalsContact O-N 3.11Å; G15-E19 PolarHBondContact O-N 3.27Å; G15-L66 VanDerWaalsContact C-CD1 3.42Å
16	I	96.3	Very high	90.8	Very high	11 Å²	11	72.6 Å²	72.6	6%	0.056	37%	0.371	C	S	.	.	H	α-helix	trans	-60.5	-45	178.4	-64.6	169.2	0	0	0	110.3	V12 C13 K18 E19 L20 V37 F41 L66 L69	V12-I16 HydrophobicContact CG1-CD1 4.16Å; V12-I16 WeakPolarHBondContact O-CG1 3.29Å; V12-I16 PolarHBondContact O-N 2.82Å; C13-I16 PolarHBondContact O-N 3.09Å; I16-K18 VanDerWaalsContact C-N 3.27Å; I16-K18 PolarHBondContact O-N 2.87Å; I16-E19 PolarHBondContact O-N 3.47Å; I16-L20 HydrophobicContact CG2-CD1 4.26Å; I16-L20 HydrophobicContact CG2-CG 4.44Å; I16-L20 WeakPolarHBondContact O-CG 3.47Å; I16-L20 PolarHBondContact O-N 3.03Å; I16-V37 HydrophobicContact CG2-CG1 4.16Å; I16-V37 HydrophobicContact CG2-CG2 3.99Å; I16-F41 HydrophobicContact CD1-CE2 4.2Å; I16-F41 HydrophobicContact CD1-CZ 4.44Å; I16-L66 HydrophobicContact CG1-CB 3.95Å; I16-L66 HydrophobicContact CG1-CD1 4.21Å; I16-L69 HydrophobicContact CG2-CD1 4.24Å
17	L	95.6	Very high	92.2	Very high	22 Å²	22	69.9 Å²	69.9	12%	0.115	36%	0.362	C	S	.	.	H	α-helix	trans	-63.6	-32.1	177.9	-64.2	-178.7	0	0	0	112.9	C13 R14 G15 L20 R21 Y28 Y34 V37 I38	C13-L17 VanDerWaalsContact O-CG 3.28Å; C13-L17 WeakPolarHBondContact O-CG 3.26Å; C13-L17 PolarHBondContact O-N 2.88Å; R14-L17 PolarHBondContact O-N 2.82Å; G15-L17 VanDerWaalsContact C-N 3.33Å; G15-L17 PolarHBondContact O-N 3.45Å; L17-L20 HydrophobicContact CD2-CD1 4.26Å; L17-R21 WeakPolarHBondContact O-CB 3.38Å; L17-R21 PolarHBondContact O-N 2.82Å; L17-Y28 HydrophobicContact CB-CE2 4.38Å; L17-Y34 HydrophobicContact CD1-CE2 4.16Å; L17-Y34 HydrophobicContact CD2-CD2 3.49Å; L17-Y34 VanDerWaalsContact CD2-CD2 3.49Å; L17-Y34 HydrophobicContact CD2-CE2 3.72Å; L17-Y34 HydrophobicContact CD2-CG 4.45Å; L17-Y34 HydrophobicContact CG-CE2 4.5Å; L17-V37 HydrophobicContact CD2-CG1 4.27Å; L17-I38 HydrophobicContact CD1-CD1 3.85Å; L17-I38 HydrophobicContact CD2-CD1 4.49Å
18	K	96.3	Very high	93	Very high	142 Å²	142	68.2 Å²	68.2	62%	0.617	35%	0.349	S	S	*	.	H	α-helix	trans	-67.1	-44.9	173.4	-177.2	-175.5	175.6	-174.2	0	110.8	R14 G15 I16 R21 T22	R14-K18 WeakPolarHBondContact O-CB 3.39Å; R14-K18 PolarHBondContact O-N 3.09Å; G15-K18 WeakPolarHBondContact O-CB 3.42Å; G15-K18 PolarHBondContact O-N 2.71Å; G15-K18 VanDerWaalsContact O-N 3.11Å; I16-K18 VanDerWaalsContact C-N 3.27Å; I16-K18 PolarHBondContact O-N 2.87Å; K18-R21 WeakPolarHBondContact O-CB 3.42Å; K18-R21 PolarHBondContact O-N 3.34Å; K18-T22 PolarHBondContact O-N 2.88Å; K18-T22 PolarHBondContact O-OG1 3.28Å
19	E	96.3	Very high	93.4	Very high	13 Å²	13	71.5 Å²	71.5	6%	0.061	36%	0.357	C	S	.	.	H	α-helix	trans	-62.8	-43.6	175.9	-68.5	-58.9	145.5	0	0	111.3	G15 I16 R21 T22 I23 L66 L69 R73	G15-E19 PolarHBondContact O-N 3.27Å; I16-E19 PolarHBondContact O-N 3.47Å; E19-R21 VanDerWaalsContact C-N 3.3Å; E19-R21 PolarHBondContact O-N 2.92Å; E19-T22 WeakPolarHBondContact O-CB 3.23Å; E19-T22 PolarHBondContact O-N 3.03Å; E19-I23 WeakPolarHBondContact O-CG1 3.48Å; E19-I23 PolarHBondContact O-N 3.44Å; E19-I23 VanDerWaalsContact O-N 3.07Å; E19-L66 HydrophobicContact CG-CD1 4.15Å; E19-L69 HydrophobicContact CB-CB 3.98Å; E19-L69 HydrophobicContact CB-CD1 4.11Å; E19-L69 HydrophobicContact CG-CB 4.01Å; E19-R73 IonicContact OE1-NE 2.66Å; E19-R73 WeakPolarHBondContact OE2-CD 3.08Å; E19-R73 IonicContact OE2-NE 3.49Å
20	L	95.3	Very high	93.6	Very high	16 Å²	16	76.8 Å²	76.8	8%	0.084	38%	0.377	C	S	.	.	H	α-helix	trans	-59.2	-40.2	174.3	-69.9	176.3	0	0	0	112.6	I16 L17 T22 I23 Q24 Y28 A33	I16-L20 HydrophobicContact CG2-CD1 4.26Å; I16-L20 HydrophobicContact CG2-CG 4.44Å; I16-L20 WeakPolarHBondContact O-CG 3.47Å; I16-L20 PolarHBondContact O-N 3.03Å; L17-L20 HydrophobicContact CD2-CD1 4.26Å; L20-T22 VanDerWaalsContact C-N 3.33Å; L20-I23 PolarHBondContact O-N 3.26Å; L20-Q24 WeakPolarHBondContact O-CB 3.35Å; L20-Q24 PolarHBondContact O-N 3.22Å; L20-Y28 HydrophobicContact CB-CD2 4.25Å; L20-A33 HydrophobicContact CD1-CB 4.26Å; L20-A33 HydrophobicContact CD2-CB 4.07Å
21	R	95.4	Very high	93.8	Very high	129 Å²	129	72.4 Å²	72.4	49%	0.487	36%	0.356	S	S	.	.	H	α-helix	trans	-63.6	-38.8	174.6	-175.5	-175.6	-62.4	172	-1.1	112	L17 K18 E19 I23 G25 Y28	L17-R21 WeakPolarHBondContact O-CB 3.38Å; L17-R21 PolarHBondContact O-N 2.82Å; K18-R21 WeakPolarHBondContact O-CB 3.42Å; K18-R21 PolarHBondContact O-N 3.34Å; E19-R21 VanDerWaalsContact C-N 3.3Å; E19-R21 PolarHBondContact O-N 2.92Å; R21-I23 VanDerWaalsContact C-N 3.29Å; R21-I23 PolarHBondContact O-N 3.49Å; R21-G25 WeakPolarHBondContact O-CA 3.17Å; R21-G25 PolarHBondContact O-N 3.18Å; R21-Y28 HydrophobicContact CB-CD1 3.89Å; R21-Y28 HydrophobicContact CB-CD2 4.31Å; R21-Y28 HydrophobicContact CB-CE1 4.1Å; R21-Y28 HydrophobicContact CB-CG 4.01Å; R21-Y28 HydrophobicContact CG-CD1 3.87Å; R21-Y28 HydrophobicContact CG-CE1 4.01Å; R21-Y28 HydrophobicContact CG-CG 4.46Å; R21-Y28 VanDerWaalsContact NE-CE1 3.3Å; R21-Y28 PolarHBondContact NH2-OH 3.27Å
22	T	94.4	Very high	93.9	Very high	85 Å²	85	71 Å²	71	52%	0.521	36%	0.361	S	S	.	.	H	α-helix	trans	-64.1	-37.2	177.3	-52.6	0	0	0	0	111.5	K18 E19 L20	K18-T22 PolarHBondContact O-N 2.88Å; K18-T22 PolarHBondContact O-OG1 3.28Å; E19-T22 WeakPolarHBondContact O-CB 3.23Å; E19-T22 PolarHBondContact O-N 3.03Å; L20-T22 VanDerWaalsContact C-N 3.33Å
23	I	91.6	Very high	93.9	Very high	113 Å²	113	72.9 Å²	72.9	58%	0.579	38%	0.376	S	S	*	.	H	α-helix	trans	-79.7	-44.7	-177.7	-62.7	165.2	0	0	0	112	E19 L20 R21 L69	E19-I23 WeakPolarHBondContact O-CG1 3.48Å; E19-I23 PolarHBondContact O-N 3.44Å; E19-I23 VanDerWaalsContact O-N 3.07Å; L20-I23 PolarHBondContact O-N 3.26Å; R21-I23 VanDerWaalsContact C-N 3.29Å; R21-I23 PolarHBondContact O-N 3.49Å; I23-L69 HydrophobicContact CD1-CD2 4.24Å
24	Q	91.4	Very high	94	Very high	76 Å²	76	74.8 Å²	74.8	36%	0.355	38%	0.382	S	S	.	.	H	α-helix	trans	-105.2	-5.3	-170.3	-61.9	176.7	-2	0	0	113.7	L20 S27 S31	L20-Q24 WeakPolarHBondContact O-CB 3.35Å; L20-Q24 PolarHBondContact O-N 3.22Å; Q24-S27 PolarHBondContact O-OG 3.35Å; Q24-S31 PolarHBondContact OE1-OG 2.8Å; Q24-S31 VanDerWaalsContact OE1-OG 3.07Å
25	G	91.5	Very high	94	Very high	24 Å²	24	70.7 Å²	70.7	25%	0.247	37%	0.373	C	S	.	.	G	3₁₀ helix	trans	71.2	-151.8	-179.5	0	0	0	0	0	113.6	R21 S27 Y28	R21-G25 WeakPolarHBondContact O-CA 3.17Å; R21-G25 PolarHBondContact O-N 3.18Å; G25-S27 VanDerWaalsContact C-N 3.29Å; G25-S27 PolarHBondContact O-N 3.12Å; G25-Y28 WeakPolarHBondContact O-CB 3.4Å; G25-Y28 WeakPolarHBondContact O-CD1 3.32Å; G25-Y28 PolarHBondContact O-N 3.13Å
26	P	90.8	Very high	93.9	Very high	126 Å²	126	76.5 Å²	76.5	82%	0.818	39%	0.39	S	S	*	.	G	3₁₀ helix	trans	-68.3	-24.3	-171.5	26.3	-33.2	0	0	0	113.9	Y28	P26-Y28 VanDerWaalsContact C-N 3.25Å; P26-Y28 PolarHBondContact O-N 2.95Å
27	S	92.6	Very high	93.8	Very high	63 Å²	63	77 Å²	77	44%	0.441	39%	0.393	S	S	.	.	G	3₁₀ helix	trans	-80.8	2	178.9	56.7	0	0	0	0	113.9	Q24 G25 K29 Q30	Q24-S27 PolarHBondContact O-OG 3.35Å; G25-S27 VanDerWaalsContact C-N 3.29Å; G25-S27 PolarHBondContact O-N 3.12Å; S27-K29 PolarHBondContact O-N 2.99Å; S27-Q30 WeakPolarHBondContact O-CB 3.22Å; S27-Q30 PolarHBondContact O-N 3.29Å
28	Y	93.9	Very high	93.7	Very high	13 Å²	13	77.3 Å²	77.3	5%	0.051	40%	0.395	C	S	.	.	G	3₁₀ helix	trans	-52.9	-28.9	-177.3	82.5	-77.2	0	0	0	114	L17 L20 R21 G25 P26 Q30 S31 Y34	L17-Y28 HydrophobicContact CB-CE2 4.38Å; L20-Y28 HydrophobicContact CB-CD2 4.25Å; R21-Y28 HydrophobicContact CB-CD1 3.89Å; R21-Y28 HydrophobicContact CB-CD2 4.31Å; R21-Y28 HydrophobicContact CB-CE1 4.1Å; R21-Y28 HydrophobicContact CB-CG 4.01Å; R21-Y28 HydrophobicContact CG-CD1 3.87Å; R21-Y28 HydrophobicContact CG-CE1 4.01Å; R21-Y28 HydrophobicContact CG-CG 4.46Å; R21-Y28 VanDerWaalsContact NE-CE1 3.3Å; R21-Y28 PolarHBondContact NH2-OH 3.27Å; G25-Y28 WeakPolarHBondContact O-CB 3.4Å; G25-Y28 WeakPolarHBondContact O-CD1 3.32Å; G25-Y28 PolarHBondContact O-N 3.13Å; P26-Y28 VanDerWaalsContact C-N 3.25Å; P26-Y28 PolarHBondContact O-N 2.95Å; Y28-Q30 PolarHBondContact O-N 2.8Å; Y28-S31 WeakPolarHBondContact O-CB 3.43Å; Y28-S31 PolarHBondContact O-N 3.39Å; Y28-S31 VanDerWaalsContact O-N 3.15Å; Y28-S31 PolarHBondContact O-OG 3.34Å; Y28-Y34 AromaticContact CD2-CD2 3.76Å; Y28-Y34 HydrophobicContact CD2-CD2 3.76Å; Y28-Y34 HydrophobicContact CD2-CE2 4.36Å; Y28-Y34 AromaticContact CE2-CD2 3.53Å; Y28-Y34 HydrophobicContact CE2-CD2 3.53Å; Y28-Y34 AromaticContact CE2-CE2 3.67Å; Y28-Y34 HydrophobicContact CE2-CE2 3.67Å; Y28-Y34 WeakPolarHBondContact O-CB 3.28Å
29	K	93	Very high	93.6	Very high	119 Å²	119	73.5 Å²	73.5	52%	0.517	38%	0.381	S	S	.	.	G	3₁₀ helix	trans	-65	-23.7	177.6	-65.1	-178.3	-179	175.6	0	113.9	S27 S31 Y34	S27-K29 PolarHBondContact O-N 2.99Å; K29-S31 VanDerWaalsContact C-N 3.32Å; K29-Y34 HydrophobicContact CB-CE1 4.48Å; K29-Y34 HydrophobicContact CG-CD2 4.45Å; K29-Y34 HydrophobicContact CG-CE2 4.12Å; K29-Y34 VanDerWaalsContact O-CD1 3.24Å; K29-Y34 WeakPolarHBondContact O-CD1 3.47Å
30	Q	93	Very high	93.3	Very high	167 Å²	167	75.8 Å²	75.8	78%	0.78	39%	0.392	S	S	*	.	G	3₁₀ helix	trans	-86.8	-8.3	178.4	-63.5	173.4	-7	0	0	111.9	S27 Y28	S27-Q30 WeakPolarHBondContact O-CB 3.22Å; S27-Q30 PolarHBondContact O-N 3.29Å; Y28-Q30 PolarHBondContact O-N 2.8Å
31	S	93.4	Very high	93	Very high	18 Å²	18	76.8 Å²	76.8	13%	0.126	40%	0.395	C	S	.	.	S	Bend	trans	-72.2	149.5	-177.7	74.1	0	0	0	0	112.6	Q24 Y28 K29 A33 Y34 N35	Q24-S31 PolarHBondContact OE1-OG 2.8Å; Q24-S31 VanDerWaalsContact OE1-OG 3.07Å; Y28-S31 WeakPolarHBondContact O-CB 3.43Å; Y28-S31 PolarHBondContact O-N 3.39Å; Y28-S31 VanDerWaalsContact O-N 3.15Å; Y28-S31 PolarHBondContact O-OG 3.34Å; K29-S31 VanDerWaalsContact C-N 3.32Å; S31-A33 PolarHBondContact O-N 2.94Å; S31-Y34 PolarHBondContact O-N 2.84Å; S31-Y34 WeakPolarHBondContact OG-CB 3.38Å; S31-Y34 PolarHBondContact OG-N 2.96Å; S31-N35 PolarHBondContact O-N 2.93Å; S31-N35 PolarHBondContact O-ND2 2.95Å
32	L	94.3	Very high	92.7	Very high	148 Å²	148	79.4 Å²	79.4	78%	0.775	41%	0.405	S	S	*	.	H	α-helix	trans	-59	-37.4	172.2	-174.6	63	0	0	0	111.5	Y34 N35 Y36	L32-Y34 PolarHBondContact O-N 3.41Å; L32-N35 PolarHBondContact O-N 3.41Å; L32-Y36 WeakPolarHBondContact O-CB 3.44Å; L32-Y36 PolarHBondContact O-N 3.49Å
33	A	93	Very high	92.3	Very high	38 Å²	38	81.8 Å²	81.8	31%	0.314	41%	0.408	S	S	.	.	H	α-helix	trans	-60.6	-43.6	177.1	0	0	0	0	0	112.3	L20 S31 Y36 V37	L20-A33 HydrophobicContact CD1-CB 4.26Å; L20-A33 HydrophobicContact CD2-CB 4.07Å; S31-A33 PolarHBondContact O-N 2.94Å; A33-Y36 PolarHBondContact O-N 3.49Å; A33-V37 WeakPolarHBondContact O-CB 3.27Å; A33-V37 VanDerWaalsContact O-CG2 3.26Å; A33-V37 WeakPolarHBondContact O-CG2 3.34Å; A33-V37 PolarHBondContact O-N 3.02Å
34	Y	94.7	Very high	91.9	Very high	53 Å²	53	78.4 Å²	78.4	21%	0.208	39%	0.392	C	S	.	.	H	α-helix	trans	-60.3	-50.5	176.1	176	-88.1	0	0	0	111.6	L17 Y28 K29 S31 L32 Y36 V37 I38	L17-Y34 HydrophobicContact CD1-CE2 4.16Å; L17-Y34 HydrophobicContact CD2-CD2 3.49Å; L17-Y34 VanDerWaalsContact CD2-CD2 3.49Å; L17-Y34 HydrophobicContact CD2-CE2 3.72Å; L17-Y34 HydrophobicContact CD2-CG 4.45Å; L17-Y34 HydrophobicContact CG-CE2 4.5Å; Y28-Y34 AromaticContact CD2-CD2 3.76Å; Y28-Y34 HydrophobicContact CD2-CD2 3.76Å; Y28-Y34 HydrophobicContact CD2-CE2 4.36Å; Y28-Y34 AromaticContact CE2-CD2 3.53Å; Y28-Y34 HydrophobicContact CE2-CD2 3.53Å; Y28-Y34 AromaticContact CE2-CE2 3.67Å; Y28-Y34 HydrophobicContact CE2-CE2 3.67Å; Y28-Y34 WeakPolarHBondContact O-CB 3.28Å; K29-Y34 HydrophobicContact CB-CE1 4.48Å; K29-Y34 HydrophobicContact CG-CD2 4.45Å; K29-Y34 HydrophobicContact CG-CE2 4.12Å; K29-Y34 VanDerWaalsContact O-CD1 3.24Å; K29-Y34 WeakPolarHBondContact O-CD1 3.47Å; S31-Y34 PolarHBondContact O-N 2.84Å; S31-Y34 WeakPolarHBondContact OG-CB 3.38Å; S31-Y34 PolarHBondContact OG-N 2.96Å; L32-Y34 PolarHBondContact O-N 3.41Å; Y34-Y36 VanDerWaalsContact C-N 3.32Å; Y34-Y36 PolarHBondContact O-N 3.31Å; Y34-V37 PolarHBondContact O-N 3.1Å; Y34-I38 HydrophobicContact CD1-CG1 4.31Å; Y34-I38 HydrophobicContact CE1-CG1 3.9Å; Y34-I38 HydrophobicContact CE2-CG1 4.23Å; Y34-I38 WeakPolarHBondContact O-CG1 3.16Å; Y34-I38 PolarHBondContact O-N 3.18Å
35	N	95.1	Very high	91.2	Very high	90 Å²	90	82 Å²	82	48%	0.481	41%	0.406	S	S	.	.	H	α-helix	trans	-60.8	-44	-179.4	-71	-36.8	0	0	0	111.4	S31 L32 I38 D39	S31-N35 PolarHBondContact O-N 2.93Å; S31-N35 PolarHBondContact O-ND2 2.95Å; L32-N35 PolarHBondContact O-N 3.41Å; N35-I38 PolarHBondContact O-N 3.4Å; N35-D39 VanDerWaalsContact O-CB 3.27Å; N35-D39 WeakPolarHBondContact O-CB 3.19Å; N35-D39 PolarHBondContact O-N 3.47Å
36	Y	94.9	Very high	89.9	Confident	141 Å²	141	86.8 Å²	86.8	55%	0.553	43%	0.43	S	S	*	.	H	α-helix	trans	-60.9	-49.8	177.2	179.1	-97.8	0	0	0	112.2	L32 A33 Y34 I38 D39 Q40	L32-Y36 WeakPolarHBondContact O-CB 3.44Å; L32-Y36 PolarHBondContact O-N 3.49Å; A33-Y36 PolarHBondContact O-N 3.49Å; Y34-Y36 VanDerWaalsContact C-N 3.32Å; Y34-Y36 PolarHBondContact O-N 3.31Å; Y36-I38 PolarHBondContact O-N 3.42Å; Y36-D39 PolarHBondContact O-N 2.92Å; Y36-Q40 HydrophobicContact CD1-CG 4.12Å; Y36-Q40 HydrophobicContact CD2-CG 4.35Å; Y36-Q40 HydrophobicContact CE1-CG 3.69Å; Y36-Q40 HydrophobicContact CE2-CG 3.95Å; Y36-Q40 HydrophobicContact CG-CG 4.44Å; Y36-Q40 WeakPolarHBondContact O-CG 3.29Å; Y36-Q40 PolarHBondContact O-N 3.26Å
37	V	93.8	Very high	88.3	Confident	21 Å²	21	85 Å²	85	13%	0.127	42%	0.417	C	S	.	.	H	α-helix	trans	-59.8	-48.3	180	170.2	0	0	0	0	110.4	I16 L17 A33 Y34 D39 Q40 F41	I16-V37 HydrophobicContact CG2-CG1 4.16Å; I16-V37 HydrophobicContact CG2-CG2 3.99Å; L17-V37 HydrophobicContact CD2-CG1 4.27Å; A33-V37 WeakPolarHBondContact O-CB 3.27Å; A33-V37 VanDerWaalsContact O-CG2 3.26Å; A33-V37 WeakPolarHBondContact O-CG2 3.34Å; A33-V37 PolarHBondContact O-N 3.02Å; Y34-V37 PolarHBondContact O-N 3.1Å; V37-D39 VanDerWaalsContact C-N 3.32Å; V37-D39 PolarHBondContact O-N 3.44Å; V37-Q40 PolarHBondContact O-N 3.05Å; V37-F41 HydrophobicContact CG1-CD2 3.86Å; V37-F41 HydrophobicContact CG1-CE2 3.98Å; V37-F41 VanDerWaalsContact O-CD2 3.29Å; V37-F41 WeakPolarHBondContact O-CD2 3.41Å; V37-F41 PolarHBondContact O-N 3.35Å
38	I	93.8	Very high	86.5	Confident	29 Å²	29	85.2 Å²	85.2	15%	0.149	43%	0.429	C	S	.	.	H	α-helix	trans	-60.6	-42.9	179	-68.5	-63.2	0	0	0	111.6	L17 Y34 N35 Y36 F41 R42	L17-I38 HydrophobicContact CD1-CD1 3.85Å; L17-I38 HydrophobicContact CD2-CD1 4.49Å; Y34-I38 HydrophobicContact CD1-CG1 4.31Å; Y34-I38 HydrophobicContact CE1-CG1 3.9Å; Y34-I38 HydrophobicContact CE2-CG1 4.23Å; Y34-I38 WeakPolarHBondContact O-CG1 3.16Å; Y34-I38 PolarHBondContact O-N 3.18Å; N35-I38 PolarHBondContact O-N 3.4Å; Y36-I38 PolarHBondContact O-N 3.42Å; I38-F41 PolarHBondContact O-N 2.97Å; I38-R42 HydrophobicContact CG2-CG 4.46Å; I38-R42 VanDerWaalsContact CG2-CZ 3.48Å; I38-R42 WeakPolarHBondContact O-CB 3.34Å; I38-R42 VanDerWaalsContact O-CG 3.26Å; I38-R42 WeakPolarHBondContact O-CG 3.47Å; I38-R42 PolarHBondContact O-N 3.49Å
39	D	93	Very high	84.4	Confident	61 Å²	61	93.6 Å²	93.6	33%	0.326	47%	0.469	S	S	.	.	H	α-helix	trans	-61.8	-47.3	177.7	178.7	61.4	0	0	0	112.1	N35 Y36 V37 F41 R42 K43	N35-D39 VanDerWaalsContact O-CB 3.27Å; N35-D39 WeakPolarHBondContact O-CB 3.19Å; N35-D39 PolarHBondContact O-N 3.47Å; Y36-D39 PolarHBondContact O-N 2.92Å; V37-D39 VanDerWaalsContact C-N 3.32Å; V37-D39 PolarHBondContact O-N 3.44Å; D39-F41 PolarHBondContact O-N 2.66Å; D39-R42 PolarHBondContact O-N 3.47Å; D39-K43 WeakPolarHBondContact O-CG 3.37Å; D39-K43 PolarHBondContact O-N 2.87Å; D39-K43 WeakPolarHBondContact OD1-CE 3.46Å; D39-K43 IonicContact OD1-NZ 3.34Å; D39-K43 PolarHBondContact OD1-NZ 3.29Å; D39-K43 WeakPolarHBondContact OD2-CE 3.47Å; D39-K43 IonicContact OD2-NZ 3.44Å; D39-K43 PolarHBondContact OD2-NZ 3.48Å
40	Q	90.1	Very high	82.2	Confident	62 Å²	62	99 Å²	99	29%	0.29	49%	0.486	S	S	.	.	H	α-helix	trans	-60.1	-44	177.2	-68.5	-55.4	-50.2	0	0	112.3	Y36 V37 R42 K43 N44	Y36-Q40 HydrophobicContact CD1-CG 4.12Å; Y36-Q40 HydrophobicContact CD2-CG 4.35Å; Y36-Q40 HydrophobicContact CE1-CG 3.69Å; Y36-Q40 HydrophobicContact CE2-CG 3.95Å; Y36-Q40 HydrophobicContact CG-CG 4.44Å; Y36-Q40 WeakPolarHBondContact O-CG 3.29Å; Y36-Q40 PolarHBondContact O-N 3.26Å; V37-Q40 PolarHBondContact O-N 3.05Å; Q40-R42 VanDerWaalsContact C-N 3.32Å; Q40-R42 PolarHBondContact O-N 3.33Å; Q40-K43 PolarHBondContact O-N 2.94Å; Q40-N44 PolarHBondContact O-N 2.71Å; Q40-N44 PolarHBondContact O-ND2 3.49Å
41	F	89.4	Confident	80.5	Confident	36 Å²	36	100.7 Å²	100.7	16%	0.158	49%	0.486	C	S	.	.	H	α-helix	trans	-69	-29.2	178.2	-86.6	-87.2	0	0	0	113	P9 V12 C13 I16 V37 I38 D39 K45 S62	P9-F41 HydrophobicContact CB-CD1 4.34Å; P9-F41 HydrophobicContact CB-CE1 4.05Å; P9-F41 WeakPolarHBondContact O-CE1 3.24Å; V12-F41 HydrophobicContact CB-CZ 4.37Å; V12-F41 HydrophobicContact CG1-CZ 4.3Å; C13-F41 HydrophobicContact CB-CD1 3.76Å; C13-F41 HydrophobicContact CB-CD2 3.93Å; C13-F41 HydrophobicContact CB-CE1 3.7Å; C13-F41 HydrophobicContact CB-CE2 3.87Å; C13-F41 HydrophobicContact CB-CG 3.87Å; C13-F41 HydrophobicContact CB-CZ 3.74Å; I16-F41 HydrophobicContact CD1-CE2 4.2Å; I16-F41 HydrophobicContact CD1-CZ 4.44Å; V37-F41 HydrophobicContact CG1-CD2 3.86Å; V37-F41 HydrophobicContact CG1-CE2 3.98Å; V37-F41 VanDerWaalsContact O-CD2 3.29Å; V37-F41 WeakPolarHBondContact O-CD2 3.41Å; V37-F41 PolarHBondContact O-N 3.35Å; I38-F41 PolarHBondContact O-N 2.97Å; D39-F41 PolarHBondContact O-N 2.66Å; F41-K45 PolarHBondContact O-N 2.91Å; F41-S62 WeakPolarHBondContact CZ-OG 3.46Å
42	R	88.9	Confident	79.3	Confident	184 Å²	184	102.3 Å²	102.3	69%	0.694	50%	0.498	S	S	*	.	H	α-helix	trans	-73	-45.8	174.9	-76.1	173.3	179.1	178.1	0.6	111.8	I38 D39 Q40 N44 K45	I38-R42 HydrophobicContact CG2-CG 4.46Å; I38-R42 VanDerWaalsContact CG2-CZ 3.48Å; I38-R42 WeakPolarHBondContact O-CB 3.34Å; I38-R42 VanDerWaalsContact O-CG 3.26Å; I38-R42 WeakPolarHBondContact O-CG 3.47Å; I38-R42 PolarHBondContact O-N 3.49Å; D39-R42 PolarHBondContact O-N 3.47Å; Q40-R42 VanDerWaalsContact C-N 3.32Å; Q40-R42 PolarHBondContact O-N 3.33Å; R42-N44 PolarHBondContact O-N 2.91Å; R42-K45 VanDerWaalsContact O-CB 3.24Å; R42-K45 WeakPolarHBondContact O-CB 3.1Å; R42-K45 PolarHBondContact O-N 3.21Å; R42-K45 VanDerWaalsContact O-N 3.11Å
43	K	86.6	Confident	78.5	Confident	135 Å²	135	103.9 Å²	103.9	59%	0.587	49%	0.493	S	S	*	.	H	α-helix	trans	-58.2	-33.7	177.8	-75.2	172.3	173.1	169.2	0	112.4	D39 Q40	D39-K43 WeakPolarHBondContact O-CG 3.37Å; D39-K43 PolarHBondContact O-N 2.87Å; D39-K43 WeakPolarHBondContact OD1-CE 3.46Å; D39-K43 IonicContact OD1-NZ 3.34Å; D39-K43 PolarHBondContact OD1-NZ 3.29Å; D39-K43 WeakPolarHBondContact OD2-CE 3.47Å; D39-K43 IonicContact OD2-NZ 3.44Å; D39-K43 PolarHBondContact OD2-NZ 3.48Å; Q40-K43 PolarHBondContact O-N 2.94Å
44	N	82.2	Confident	77.9	Confident	42 Å²	42	104.7 Å²	104.7	23%	0.225	50%	0.5	C	S	.	.	T	Hydrogen-bonded Turn	trans	-95.2	13.1	-179.7	-68.2	-77.9	0	0	0	114	Q40 R42 Q55	Q40-N44 PolarHBondContact O-N 2.71Å; Q40-N44 PolarHBondContact O-ND2 3.49Å; R42-N44 PolarHBondContact O-N 2.91Å; N44-Q55 PolarHBondContact O-NE2 3.36Å
45	K	76.6	Confident	77.3	Confident	153 Å²	153	105.4 Å²	105.4	67%	0.665	51%	0.505	S	S	*	.	S	Bend	trans	-76.1	-37.1	-168.9	-168.1	179.6	172.1	-170.4	0	114.6	F41 R42	F41-K45 PolarHBondContact O-N 2.91Å; R42-K45 VanDerWaalsContact O-CB 3.24Å; R42-K45 WeakPolarHBondContact O-CB 3.1Å; R42-K45 PolarHBondContact O-N 3.21Å; R42-K45 VanDerWaalsContact O-N 3.11Å
46	V	64	Low	76.8	Confident	123 Å²	123	106.5 Å²	106.5	75%	0.745	51%	0.507	S	S	*	.			trans	-160	113.1	177.8	-178.5	0	0	0	0	108.9
47	T	58.7	Low	76.4	Confident	89 Å²	89	104.2 Å²	104.2	55%	0.546	50%	0.502	S	S	.	.			trans	-137.3	104.5	160.2	45.9	0	0	0	0	107.8
48	G	54.9	Low	76.1	Confident	67 Å²	67	104.6 Å²	104.6	69%	0.691	51%	0.507	S	S	*	.			trans	-72.1	151.2	164.8	0	0	0	0	0	109.1
49	E	49.2	Very low	75.9	Confident	190 Å²	190	104.1 Å²	104.1	89%	0.888	50%	0.504	S	S	*	.	S	Bend	cis	-141.1	144.9	16.8	-63.5	-178.3	145.3	0	0	108.5
50	R	47.5	Very low	75.8	Confident	231 Å²	231	106.9 Å²	106.9	87%	0.872	52%	0.515	S	S	*	.	S	Bend	trans	71.5	83.5	-166.6	-69.5	162.9	56.9	159.9	-5.4	115.5	C52	R50-C52 PolarHBondContact O-N 2.85Å; R50-C52 VanDerWaalsContact O-N 3.15Å
51	Y	56.2	Low	76	Confident	203 Å²	203	105.8 Å²	105.8	80%	0.796	52%	0.516	S	S	*	.			trans	28.8	74.4	155.6	-68.6	-86	0	0	0	115.4	R53	Y51-R53 PolarHBondContact O-N 3.41Å
52	C	68.4	Low	76.1	Confident	53 Å²	53	105.1 Å²	105.1	36%	0.358	52%	0.516	S	S	.	.			trans	-54.9	108.7	175.1	-87.7	0	0	0	0	109.7	R50 A54 Q55 Q56	R50-C52 PolarHBondContact O-N 2.85Å; R50-C52 VanDerWaalsContact O-N 3.15Å; C52-A54 PolarHBondContact O-N 3.02Å; C52-A54 VanDerWaalsContact O-N 3.09Å; C52-Q55 HydrophobicContact CB-CB 4.37Å; C52-Q55 WeakPolarHBondContact O-CB 3.24Å; C52-Q55 PolarHBondContact O-N 3.11Å; C52-Q56 PolarHBondContact O-N 3.43Å
53	R	78.3	Confident	76.4	Confident	181 Å²	181	98.2 Å²	98.2	68%	0.683	49%	0.493	S	S	*	.	H	α-helix	trans	-46	-39	171.5	178.6	177.9	169.8	174.3	-1.1	111.6	Y51 Q55 Q56 E57	Y51-R53 PolarHBondContact O-N 3.41Å; R53-Q55 VanDerWaalsContact C-N 3.28Å; R53-Q55 PolarHBondContact O-N 3.34Å; R53-Q56 PolarHBondContact O-N 3.25Å; R53-Q56 VanDerWaalsContact O-N 3.09Å; R53-E57 HydrophobicContact CG-CG 4.18Å; R53-E57 WeakPolarHBondContact CG-OE1 3.37Å; R53-E57 IonicContact CZ-OE1 3.55Å; R53-E57 IonicContact NE-OE1 2.71Å; R53-E57 PolarHBondContact NE-OE1 3.27Å; R53-E57 IonicContact NH2-OE1 3.53Å; R53-E57 PolarHBondContact NH2-OE1 2.9Å; R53-E57 WeakPolarHBondContact O-CB 3.48Å; R53-E57 WeakPolarHBondContact O-CG 3.45Å; R53-E57 PolarHBondContact O-N 3.01Å
54	A	80.5	Confident	76.9	Confident	55 Å²	55	95.3 Å²	95.3	46%	0.455	49%	0.486	S	S	.	.	H	α-helix	trans	-54.6	-38.1	174.3	0	0	0	0	0	113.9	C52 A58	C52-A54 PolarHBondContact O-N 3.02Å; C52-A54 VanDerWaalsContact O-N 3.09Å; A54-A58 WeakPolarHBondContact O-CB 3.5Å; A54-A58 PolarHBondContact O-N 3.48Å
55	Q	81.3	Confident	77.5	Confident	68 Å²	68	100.4 Å²	100.4	32%	0.318	50%	0.503	S	S	.	.	H	α-helix	trans	-70	-42	176.8	-172.2	-173.5	33.1	0	0	111.2	N44 C52 R53 E57 A58 H59	N44-Q55 PolarHBondContact O-NE2 3.36Å; C52-Q55 HydrophobicContact CB-CB 4.37Å; C52-Q55 WeakPolarHBondContact O-CB 3.24Å; C52-Q55 PolarHBondContact O-N 3.11Å; R53-Q55 VanDerWaalsContact C-N 3.28Å; R53-Q55 PolarHBondContact O-N 3.34Å; Q55-E57 VanDerWaalsContact C-N 3.35Å; Q55-A58 PolarHBondContact O-N 3.02Å; Q55-H59 VanDerWaalsContact O-CB 3.23Å; Q55-H59 WeakPolarHBondContact O-CB 3.42Å; Q55-H59 PolarHBondContact O-N 3.03Å
56	Q	84.1	Confident	78.5	Confident	112 Å²	112	94.6 Å²	94.6	52%	0.523	48%	0.479	S	S	.	.	H	α-helix	trans	-65.2	-41.3	176.8	-66.6	-179.7	-17.9	0	0	111	C52 R53 H59 H60	C52-Q56 PolarHBondContact O-N 3.43Å; R53-Q56 PolarHBondContact O-N 3.25Å; R53-Q56 VanDerWaalsContact O-N 3.09Å; Q56-H59 PolarHBondContact O-N 3.35Å; Q56-H60 VanDerWaalsContact O-CB 3.29Å; Q56-H60 WeakPolarHBondContact O-CB 3.38Å; Q56-H60 PolarHBondContact O-N 3.17Å
57	E	87.3	Confident	80	Confident	94 Å²	94	92.4 Å²	92.4	44%	0.439	47%	0.468	S	S	.	.	H	α-helix	trans	-63.4	-47.6	174.3	-74	175.2	173.7	0	0	111.3	R53 Q55 H59 H60 A61	R53-E57 HydrophobicContact CG-CG 4.18Å; R53-E57 WeakPolarHBondContact CG-OE1 3.37Å; R53-E57 IonicContact CZ-OE1 3.55Å; R53-E57 IonicContact NE-OE1 2.71Å; R53-E57 PolarHBondContact NE-OE1 3.27Å; R53-E57 IonicContact NH2-OE1 3.53Å; R53-E57 PolarHBondContact NH2-OE1 2.9Å; R53-E57 WeakPolarHBondContact O-CB 3.48Å; R53-E57 WeakPolarHBondContact O-CG 3.45Å; R53-E57 PolarHBondContact O-N 3.01Å; Q55-E57 VanDerWaalsContact C-N 3.35Å; E57-H59 VanDerWaalsContact C-N 3.29Å; E57-H59 PolarHBondContact O-N 3.47Å; E57-H60 PolarHBondContact O-N 3.48Å; E57-A61 VanDerWaalsContact O-CB 3.32Å; E57-A61 WeakPolarHBondContact O-CB 3.17Å; E57-A61 PolarHBondContact O-N 3.36Å
58	A	88.1	Confident	81.9	Confident	28 Å²	28	92.9 Å²	92.9	23%	0.231	47%	0.467	C	S	.	.	H	α-helix	trans	-61.4	-39.3	175.9	0	0	0	0	0	111.8	A54 Q55 S62	A54-A58 WeakPolarHBondContact O-CB 3.5Å; A54-A58 PolarHBondContact O-N 3.48Å; Q55-A58 PolarHBondContact O-N 3.02Å; A58-S62 WeakPolarHBondContact O-CB 3.48Å; A58-S62 PolarHBondContact O-N 2.96Å; A58-S62 PolarHBondContact O-OG 3.02Å
59	H	89.1	Confident	83.8	Confident	19 Å²	19	91.9 Å²	91.9	9%	0.088	45%	0.446	C	S	.	.	H	α-helix	trans	-66.5	-45.2	176	-172.4	-109.2	0	0	0	112.1	S7 Q55 Q56 E57 S62 L63	S7-H59 PolarHBondContact O-CE1 3.17Å; S7-H59 PolarHBondContact O-NE2 2.86Å; Q55-H59 VanDerWaalsContact O-CB 3.23Å; Q55-H59 WeakPolarHBondContact O-CB 3.42Å; Q55-H59 PolarHBondContact O-N 3.03Å; Q56-H59 PolarHBondContact O-N 3.35Å; E57-H59 VanDerWaalsContact C-N 3.29Å; E57-H59 PolarHBondContact O-N 3.47Å; H59-S62 WeakPolarHBondContact O-CB 3.33Å; H59-S62 PolarHBondContact O-N 2.91Å; H59-L63 WeakPolarHBondContact O-CG 3.34Å; H59-L63 PolarHBondContact O-N 3.47Å
60	H	91.4	Very high	86.1	Confident	120 Å²	120	84.7 Å²	84.7	56%	0.556	42%	0.415	S	S	*	.	H	α-helix	trans	-62	-47.4	175.9	179.1	73.2	0	0	0	111.3	Q56 E57 S62 L63 T64	Q56-H60 VanDerWaalsContact O-CB 3.29Å; Q56-H60 WeakPolarHBondContact O-CB 3.38Å; Q56-H60 PolarHBondContact O-N 3.17Å; E57-H60 PolarHBondContact O-N 3.48Å; H60-S62 VanDerWaalsContact C-N 3.29Å; H60-S62 PolarHBondContact O-N 2.73Å; H60-L63 WeakPolarHBondContact O-CB 3.47Å; H60-L63 PolarHBondContact O-N 2.96Å; H60-L63 VanDerWaalsContact O-N 3.12Å; H60-T64 PolarHBondContact O-N 3.4Å; H60-T64 PolarHBondContact O-OG1 2.99Å; H60-T64 VanDerWaalsContact O-OG1 3.13Å
61	A	92.7	Very high	88.5	Confident	39 Å²	39	76.7 Å²	76.7	32%	0.322	39%	0.394	S	S	.	.	H	α-helix	trans	-57.1	-43.9	174.9	0	0	0	0	0	111.3	E57 L63 T64 Y65	E57-A61 VanDerWaalsContact O-CB 3.32Å; E57-A61 WeakPolarHBondContact O-CB 3.17Å; E57-A61 PolarHBondContact O-N 3.36Å; A61-L63 VanDerWaalsContact C-N 3.33Å; A61-L63 PolarHBondContact O-N 3.42Å; A61-T64 WeakPolarHBondContact O-CB 3.2Å; A61-T64 PolarHBondContact O-N 3.31Å; A61-Y65 WeakPolarHBondContact O-CD2 3.26Å; A61-Y65 PolarHBondContact O-N 3.01Å
62	S	93.2	Very high	90.4	Very high	21 Å²	21	70.3 Å²	70.3	15%	0.147	38%	0.377	C	S	.	.	H	α-helix	trans	-61.3	-39.8	176.9	-59.7	0	0	0	0	112.6	F41 A58 H59 H60 Y65 L66	F41-S62 WeakPolarHBondContact CZ-OG 3.46Å; A58-S62 WeakPolarHBondContact O-CB 3.48Å; A58-S62 PolarHBondContact O-N 2.96Å; A58-S62 PolarHBondContact O-OG 3.02Å; H59-S62 WeakPolarHBondContact O-CB 3.33Å; H59-S62 PolarHBondContact O-N 2.91Å; H60-S62 VanDerWaalsContact C-N 3.29Å; H60-S62 PolarHBondContact O-N 2.73Å; S62-Y65 PolarHBondContact O-N 3.46Å; S62-L66 WeakPolarHBondContact O-CB 3.44Å; S62-L66 PolarHBondContact O-N 3.32Å
63	L	94.9	Very high	91.7	Very high	40 Å²	40	72.5 Å²	72.5	21%	0.209	38%	0.377	C	S	.	.	H	α-helix	trans	-64.2	-44	174.3	-76.5	168.7	0	0	0	111.9	L6 S7 V12 H59 H60 A61 Y65 L66 C67	L6-L63 HydrophobicContact CD2-CD1 3.35Å; S7-L63 WeakPolarHBondContact OG-CD2 3.31Å; V12-L63 HydrophobicContact CG1-CD2 4.22Å; V12-L63 HydrophobicContact CG1-CG 4.38Å; V12-L63 HydrophobicContact CG2-CD2 3.48Å; V12-L63 VanDerWaalsContact CG2-CD2 3.48Å; V12-L63 HydrophobicContact CG2-CG 4.02Å; H59-L63 WeakPolarHBondContact O-CG 3.34Å; H59-L63 PolarHBondContact O-N 3.47Å; H60-L63 WeakPolarHBondContact O-CB 3.47Å; H60-L63 PolarHBondContact O-N 2.96Å; H60-L63 VanDerWaalsContact O-N 3.12Å; A61-L63 VanDerWaalsContact C-N 3.33Å; A61-L63 PolarHBondContact O-N 3.42Å; L63-Y65 VanDerWaalsContact C-N 3.35Å; L63-Y65 PolarHBondContact O-N 2.93Å; L63-L66 PolarHBondContact O-N 3.38Å; L63-C67 WeakPolarHBondContact O-CB 3.47Å; L63-C67 PolarHBondContact O-N 3.3Å
64	T	96	Very high	92.5	Very high	73 Å²	73	67 Å²	67	45%	0.448	36%	0.362	S	S	.	.	H	α-helix	trans	-59.9	-45.8	176.7	-59	0	0	0	0	110.9	H60 A61 C67 L68	H60-T64 PolarHBondContact O-N 3.4Å; H60-T64 PolarHBondContact O-OG1 2.99Å; H60-T64 VanDerWaalsContact O-OG1 3.13Å; A61-T64 WeakPolarHBondContact O-CB 3.2Å; A61-T64 PolarHBondContact O-N 3.31Å; T64-C67 WeakPolarHBondContact O-CB 3.42Å; T64-C67 PolarHBondContact O-N 2.89Å; T64-L68 WeakPolarHBondContact O-CB 3.33Å; T64-L68 PolarHBondContact O-N 2.74Å
65	Y	95.8	Very high	93.2	Very high	150 Å²	150	69.9 Å²	69.9	59%	0.588	37%	0.365	S	S	*	.	H	α-helix	trans	-64.9	-41.3	176.2	-76.7	-61	0	0	0	112.9	A61 S62 L63 C67 L68 L69	A61-Y65 WeakPolarHBondContact O-CD2 3.26Å; A61-Y65 PolarHBondContact O-N 3.01Å; S62-Y65 PolarHBondContact O-N 3.46Å; L63-Y65 VanDerWaalsContact C-N 3.35Å; L63-Y65 PolarHBondContact O-N 2.93Å; Y65-C67 VanDerWaalsContact C-N 3.32Å; Y65-C67 PolarHBondContact O-N 3.32Å; Y65-L68 PolarHBondContact O-N 2.83Å; Y65-L69 VanDerWaalsContact O-CG 3.31Å; Y65-L69 WeakPolarHBondContact O-CG 3.2Å; Y65-L69 PolarHBondContact O-N 2.87Å
66	L	96.4	Very high	93.8	Very high	30 Å²	30	71 Å²	71	16%	0.157	37%	0.373	C	S	.	.	H	α-helix	trans	-61.4	-43.6	175.4	179.1	55.9	0	0	0	111.5	V12 G15 I16 E19 S62 L63 T70	V12-L66 HydrophobicContact CG1-CB 4.4Å; V12-L66 HydrophobicContact CG1-CD2 4.12Å; G15-L66 VanDerWaalsContact C-CD1 3.42Å; I16-L66 HydrophobicContact CG1-CB 3.95Å; I16-L66 HydrophobicContact CG1-CD1 4.21Å; E19-L66 HydrophobicContact CG-CD1 4.15Å; S62-L66 WeakPolarHBondContact O-CB 3.44Å; S62-L66 PolarHBondContact O-N 3.32Å; L63-L66 PolarHBondContact O-N 3.38Å; L66-T70 WeakPolarHBondContact O-CB 3.47Å; L66-T70 PolarHBondContact O-N 3.07Å; L66-T70 PolarHBondContact O-OG1 3.15Å
67	C	97	Very high	94.3	Very high	77 Å²	77	68.3 Å²	68.3	52%	0.52	37%	0.37	S	S	.	.	H	α-helix	trans	-59.9	-47.5	175.8	-177.1	0	0	0	0	111.1	L63 T64 Y65 T70 S71	L63-C67 WeakPolarHBondContact O-CB 3.47Å; L63-C67 PolarHBondContact O-N 3.3Å; T64-C67 WeakPolarHBondContact O-CB 3.42Å; T64-C67 PolarHBondContact O-N 2.89Å; Y65-C67 VanDerWaalsContact C-N 3.32Å; Y65-C67 PolarHBondContact O-N 3.32Å; C67-T70 PolarHBondContact O-N 2.91Å; C67-S71 WeakPolarHBondContact O-CB 3.32Å; C67-S71 PolarHBondContact O-N 3.42Å; C67-S71 PolarHBondContact O-OG 3.07Å
68	L	96.9	Very high	94.6	Very high	100 Å²	100	68.4 Å²	68.4	52%	0.524	37%	0.373	S	S	.	.	H	α-helix	trans	-57.4	-55.5	177.4	178.5	64.2	0	0	0	111.1	T64 Y65 T70 S71 T72	T64-L68 WeakPolarHBondContact O-CB 3.33Å; T64-L68 PolarHBondContact O-N 2.74Å; Y65-L68 PolarHBondContact O-N 2.83Å; L68-T70 VanDerWaalsContact C-N 3.33Å; L68-T70 PolarHBondContact O-N 3.31Å; L68-S71 PolarHBondContact O-N 3.34Å; L68-S71 VanDerWaalsContact O-N 3.17Å; L68-T72 PolarHBondContact O-N 2.95Å; L68-T72 PolarHBondContact O-OG1 3.07Å
69	L	96.1	Very high	94.7	Very high	46 Å²	46	70.4 Å²	70.4	24%	0.241	38%	0.377	C	S	.	.	H	α-helix	trans	-57	-47	-178.7	-70.1	171.8	0	0	0	111.9	I16 E19 I23 Y65 S71 T72 R73	I16-L69 HydrophobicContact CG2-CD1 4.24Å; E19-L69 HydrophobicContact CB-CB 3.98Å; E19-L69 HydrophobicContact CB-CD1 4.11Å; E19-L69 HydrophobicContact CG-CB 4.01Å; I23-L69 HydrophobicContact CD1-CD2 4.24Å; Y65-L69 VanDerWaalsContact O-CG 3.31Å; Y65-L69 WeakPolarHBondContact O-CG 3.2Å; Y65-L69 PolarHBondContact O-N 2.87Å; L69-S71 PolarHBondContact O-N 3.22Å; L69-T72 PolarHBondContact O-N 3.47Å; L69-R73 PolarHBondContact O-N 3.34Å
70	T	96.9	Very high	94.7	Very high	39 Å²	39	75.5 Å²	75.5	24%	0.239	41%	0.405	C	S	.	.	H	α-helix	trans	-63	-43.7	179	-52.8	0	0	0	0	111.3	L66 C67 L68 R73 N74	L66-T70 WeakPolarHBondContact O-CB 3.47Å; L66-T70 PolarHBondContact O-N 3.07Å; L66-T70 PolarHBondContact O-OG1 3.15Å; C67-T70 PolarHBondContact O-N 2.91Å; L68-T70 VanDerWaalsContact C-N 3.33Å; L68-T70 PolarHBondContact O-N 3.31Å; T70-R73 PolarHBondContact O-N 2.71Å; T70-N74 WeakPolarHBondContact O-CB 3.34Å; T70-N74 VanDerWaalsContact O-CG 3.29Å; T70-N74 PolarHBondContact O-N 3.05Å; T70-N74 PolarHBondContact O-ND2 2.93Å
71	S	97.1	Very high	94.5	Very high	62 Å²	62	75.6 Å²	75.6	43%	0.434	41%	0.409	S	S	.	.	H	α-helix	trans	-67.3	-40.7	-179.6	-60.2	0	0	0	0	111.4	C67 L68 L69 N74 H75	C67-S71 WeakPolarHBondContact O-CB 3.32Å; C67-S71 PolarHBondContact O-N 3.42Å; C67-S71 PolarHBondContact O-OG 3.07Å; L68-S71 PolarHBondContact O-N 3.34Å; L68-S71 VanDerWaalsContact O-N 3.17Å; L69-S71 PolarHBondContact O-N 3.22Å; S71-N74 PolarHBondContact O-N 3.29Å; S71-H75 WeakPolarHBondContact O-CB 3.37Å; S71-H75 PolarHBondContact O-N 2.76Å
72	T	96.5	Very high	94.1	Very high	70 Å²	70	82 Å²	82	43%	0.429	43%	0.426	S	S	.	.	H	α-helix	trans	-61.8	-45.1	174.4	-58	0	0	0	0	111.2	L68 L69 N74 H75 L76	L68-T72 PolarHBondContact O-N 2.95Å; L68-T72 PolarHBondContact O-OG1 3.07Å; L69-T72 PolarHBondContact O-N 3.47Å; T72-N74 PolarHBondContact O-N 3.5Å; T72-H75 PolarHBondContact O-N 3.34Å; T72-L76 HydrophobicContact CG2-CD1 4.39Å; T72-L76 WeakPolarHBondContact O-CG 3.42Å; T72-L76 PolarHBondContact O-N 3.21Å
73	R	95.4	Very high	93.5	Very high	99 Å²	99	87 Å²	87	37%	0.374	45%	0.447	S	S	.	.	H	α-helix	trans	-60.4	-46.9	176	-174.8	-172.1	61.3	66.2	10.1	111.6	E19 L69 T70 L76 A77	E19-R73 IonicContact OE1-NE 2.66Å; E19-R73 WeakPolarHBondContact OE2-CD 3.08Å; E19-R73 IonicContact OE2-NE 3.49Å; L69-R73 PolarHBondContact O-N 3.34Å; T70-R73 PolarHBondContact O-N 2.71Å; R73-L76 PolarHBondContact O-N 3.49Å; R73-A77 PolarHBondContact O-N 2.89Å
74	N	96.1	Very high	92.2	Very high	66 Å²	66	87.5 Å²	87.5	35%	0.353	46%	0.462	S	S	.	.	H	α-helix	trans	-64.4	-41.9	178.2	-72.8	-16.8	0	0	0	111.6	T70 S71 T72 L76 A77 L78	T70-N74 WeakPolarHBondContact O-CB 3.34Å; T70-N74 VanDerWaalsContact O-CG 3.29Å; T70-N74 PolarHBondContact O-N 3.05Å; T70-N74 PolarHBondContact O-ND2 2.93Å; S71-N74 PolarHBondContact O-N 3.29Å; T72-N74 PolarHBondContact O-N 3.5Å; N74-L76 PolarHBondContact O-N 3.35Å; N74-A77 PolarHBondContact O-N 3.42Å; N74-L78 WeakPolarHBondContact O-CG 3.41Å; N74-L78 PolarHBondContact O-N 2.84Å
75	H	95.4	Very high	90.8	Very high	115 Å²	115	94.6 Å²	94.6	53%	0.532	49%	0.487	S	S	.	.	H	α-helix	trans	-59.3	-47.1	176.4	174.2	72.1	0	0	0	111	S71 T72 A77 L78 H79	S71-H75 WeakPolarHBondContact O-CB 3.37Å; S71-H75 PolarHBondContact O-N 2.76Å; T72-H75 PolarHBondContact O-N 3.34Å; H75-A77 VanDerWaalsContact C-N 3.32Å; H75-A77 PolarHBondContact O-N 3.36Å; H75-L78 PolarHBondContact O-N 3.03Å; H75-H79 WeakPolarHBondContact O-CB 3.19Å; H75-H79 PolarHBondContact O-N 3.18Å
76	L	94.2	Very high	89.7	Confident	91 Å²	91	90.1 Å²	90.1	48%	0.476	49%	0.487	S	S	.	.	H	α-helix	trans	-62.1	-39.2	175.8	-72.6	173.1	0	0	0	112.3	T72 R73 N74 H79 N80	T72-L76 HydrophobicContact CG2-CD1 4.39Å; T72-L76 WeakPolarHBondContact O-CG 3.42Å; T72-L76 PolarHBondContact O-N 3.21Å; R73-L76 PolarHBondContact O-N 3.49Å; N74-L76 PolarHBondContact O-N 3.35Å; L76-H79 PolarHBondContact O-N 3.03Å; L76-N80 WeakPolarHBondContact O-CB 3.41Å; L76-N80 PolarHBondContact O-N 3.25Å; L76-N80 PolarHBondContact O-ND2 3.43Å
77	A	93.1	Very high	88.6	Confident	55 Å²	55	98.1 Å²	98.1	46%	0.455	52%	0.523	S	S	.	.	H	α-helix	trans	-63.7	-45.7	175.9	0	0	0	0	0	111.9	R73 N74 H75 N80 L81	R73-A77 PolarHBondContact O-N 2.89Å; N74-A77 PolarHBondContact O-N 3.42Å; H75-A77 VanDerWaalsContact C-N 3.32Å; H75-A77 PolarHBondContact O-N 3.36Å; A77-N80 PolarHBondContact O-N 3.37Å; A77-L81 WeakPolarHBondContact O-CB 2.84Å; A77-L81 PolarHBondContact O-N 3.27Å
78	L	93.4	Very high	87.7	Confident	96 Å²	96	101.9 Å²	101.9	50%	0.503	53%	0.526	S	S	.	.	H	α-helix	trans	-65.7	-42.3	176.6	-70	172.7	0	0	0	111.6	N74 H75 L81 Y82	N74-L78 WeakPolarHBondContact O-CG 3.41Å; N74-L78 PolarHBondContact O-N 2.84Å; H75-L78 PolarHBondContact O-N 3.03Å; L78-L81 PolarHBondContact O-N 2.84Å; L78-Y82 HydrophobicContact CB-CD2 4.43Å; L78-Y82 HydrophobicContact CD2-CD2 4.04Å; L78-Y82 HydrophobicContact CD2-CE2 3.73Å; L78-Y82 WeakPolarHBondContact O-CB 3.31Å; L78-Y82 WeakPolarHBondContact O-CD2 3.2Å; L78-Y82 PolarHBondContact O-N 3.47Å
79	H	91.9	Very high	87.1	Confident	70 Å²	70	99.2 Å²	99.2	32%	0.324	52%	0.516	S	S	.	.	H	α-helix	trans	-59	-51.3	174.6	-176.8	-82.3	0	0	0	109.8	H75 L76 L81 Y82 H83	H75-H79 WeakPolarHBondContact O-CB 3.19Å; H75-H79 PolarHBondContact O-N 3.18Å; L76-H79 PolarHBondContact O-N 3.03Å; H79-L81 PolarHBondContact O-N 3.42Å; H79-Y82 PolarHBondContact O-N 2.89Å; H79-H83 AromaticContact CD2-CG 3.86Å; H79-H83 AromaticContact CD2-ND1 3.84Å; H79-H83 AromaticContact CE1-CD2 3.39Å; H79-H83 PolarHBondContact CE1-CD2 3.49Å; H79-H83 AromaticContact CE1-CG 3.37Å; H79-H83 AromaticContact CE1-ND1 3.87Å; H79-H83 AromaticContact CE1-NE2 3.9Å; H79-H83 AromaticContact ND1-CG 3.98Å; H79-H83 AromaticContact NE2-CD2 3.59Å; H79-H83 AromaticContact NE2-CE1 3.58Å; H79-H83 AromaticContact NE2-CG 3.28Å; H79-H83 VanDerWaalsContact NE2-CG 3.28Å; H79-H83 AromaticContact NE2-ND1 3.29Å; H79-H83 PolarHBondContact NE2-ND1 3.17Å; H79-H83 AromaticContact NE2-NE2 3.78Å; H79-H83 VanDerWaalsContact O-CA 3.31Å; H79-H83 WeakPolarHBondContact O-CA 3.36Å; H79-H83 WeakPolarHBondContact O-CB 3.33Å; H79-H83 PolarHBondContact O-N 2.76Å
80	N	88	Confident	86.5	Confident	127 Å²	127	101 Å²	101	68%	0.679	53%	0.531	S	S	*	.	H	α-helix	trans	-63.2	-28.4	179.4	-67.9	-17.3	0	0	0	113.5	L76 A77	L76-N80 WeakPolarHBondContact O-CB 3.41Å; L76-N80 PolarHBondContact O-N 3.25Å; L76-N80 PolarHBondContact O-ND2 3.43Å; A77-N80 PolarHBondContact O-N 3.37Å
81	L	87.3	Confident	86.1	Confident	121 Å²	121	104.4 Å²	104.4	63%	0.634	54%	0.544	S	S	*	.	H	α-helix	trans	-80.8	-41.7	179	-176.3	61.1	0	0	0	113.1	A77 L78 H79	A77-L81 WeakPolarHBondContact O-CB 2.84Å; A77-L81 PolarHBondContact O-N 3.27Å; L78-L81 PolarHBondContact O-N 2.84Å; H79-L81 PolarHBondContact O-N 3.42Å
82	Y	83.8	Confident	85.5	Confident	175 Å²	175	107 Å²	107	69%	0.686	55%	0.549	S	S	*	.	H	α-helix	trans	-114.8	-18.7	-168.3	-63.8	-67.4	0	0	0	114.6	L78 H79 G84	L78-Y82 HydrophobicContact CB-CD2 4.43Å; L78-Y82 HydrophobicContact CD2-CD2 4.04Å; L78-Y82 HydrophobicContact CD2-CE2 3.73Å; L78-Y82 WeakPolarHBondContact O-CB 3.31Å; L78-Y82 WeakPolarHBondContact O-CD2 3.2Å; L78-Y82 PolarHBondContact O-N 3.47Å; H79-Y82 PolarHBondContact O-N 2.89Å; Y82-G84 PolarHBondContact O-N 2.73Å
83	H	81.4	Confident	85.1	Confident	124 Å²	124	107 Å²	107	57%	0.574	55%	0.549	S	S	*	.	S	Bend	trans	-63.6	103.8	171	-167.7	75.1	0	0	0	107.1	H79	H79-H83 AromaticContact CD2-CG 3.86Å; H79-H83 AromaticContact CD2-ND1 3.84Å; H79-H83 AromaticContact CE1-CD2 3.39Å; H79-H83 PolarHBondContact CE1-CD2 3.49Å; H79-H83 AromaticContact CE1-CG 3.37Å; H79-H83 AromaticContact CE1-ND1 3.87Å; H79-H83 AromaticContact CE1-NE2 3.9Å; H79-H83 AromaticContact ND1-CG 3.98Å; H79-H83 AromaticContact NE2-CD2 3.59Å; H79-H83 AromaticContact NE2-CE1 3.58Å; H79-H83 AromaticContact NE2-CG 3.28Å; H79-H83 VanDerWaalsContact NE2-CG 3.28Å; H79-H83 AromaticContact NE2-ND1 3.29Å; H79-H83 PolarHBondContact NE2-ND1 3.17Å; H79-H83 AromaticContact NE2-NE2 3.78Å; H79-H83 VanDerWaalsContact O-CA 3.31Å; H79-H83 WeakPolarHBondContact O-CA 3.36Å; H79-H83 WeakPolarHBondContact O-CB 3.33Å; H79-H83 PolarHBondContact O-N 2.76Å
84	G	67.6	Low	84.7	Confident	52 Å²	52	103 Å²	103	54%	0.536	54%	0.536	S	S	.	.			trans	-61.1	144.6	-175.9	0	0	0	0	0	110.2	Y82 G86	Y82-G84 PolarHBondContact O-N 2.73Å; G84-G86 PolarHBondContact O-N 3.32Å
85	K	66.4	Low	84.3	Confident	221 Å²	221	102.2 Å²	102.2	96%	0.961	55%	0.545	S	S	*	.	S	Bend	trans	-68.5	25.8	169.4	-64.4	-177.1	176.9	179.7	0	112.7
86	G	72.4	Confident	83.9	Confident	57 Å²	57	102.1 Å²	102.1	59%	0.588	55%	0.547	S	S	*	.	S	Bend	trans	86.6	-163	-163	0	0	0	0	0	112.8	G84 R88	G84-G86 PolarHBondContact O-N 3.32Å; G86-R88 PolarHBondContact O-N 3.33Å
87	E	73.7	Confident	83.8	Confident	198 Å²	198	102.5 Å²	102.5	93%	0.925	55%	0.553	S	S	*	*	S	Bend	trans	-63.2	130.5	169.7	-68.4	-170.6	160.2	0	0	109.7
88	R	78.3	Confident	83.5	Confident	155 Å²	155	103.2 Å²	103.2	59%	0.585	57%	0.566	S	S	*	*	P	Polyproline II helix	trans	-68.2	147.8	172.3	-69.2	-178.6	-171.6	-178.3	0.7	109	G86 E92 V93	G86-R88 PolarHBondContact O-N 3.33Å; R88-E92 WeakPolarHBondContact CA-OE2 3.38Å; R88-E92 HydrophobicContact CB-CB 4.17Å; R88-E92 WeakPolarHBondContact CB-OE2 3.2Å; R88-V93 HydrophobicContact CB-CG2 3.73Å
89	S	84.3	Confident	83.3	Confident	44 Å²	44	103.9 Å²	103.9	31%	0.308	57%	0.569	S	S	.	*	P	Polyproline II helix	trans	-64.1	152.9	179.1	89.8	0	0	0	0	110.5	E91 E92 V93	S89-E91 WeakPolarHBondContact CB-OE2 3.49Å; S89-E91 PolarHBondContact O-N 3.22Å; S89-E91 VanDerWaalsContact O-N 3.13Å; S89-E91 PolarHBondContact OG-N 3.26Å; S89-E91 PolarHBondContact OG-OE2 3.16Å; S89-E92 PolarHBondContact N-OE2 3.39Å; S89-E92 VanDerWaalsContact N-OE2 3.09Å; S89-E92 PolarHBondContact O-N 3.34Å; S89-E92 PolarHBondContact OG-N 3.29Å; S89-V93 WeakPolarHBondContact O-CG2 3.3Å; S89-V93 PolarHBondContact O-N 3.39Å
90	P	84	Confident	82.9	Confident	85 Å²	85	111.1 Å²	111.1	55%	0.552	59%	0.594	S	S	*	*	H	α-helix	trans	-53.9	-32.5	177	-26.4	35.2	0	0	0	113.4	A94 L101	P90-A94 VanDerWaalsContact O-CB 3.3Å; P90-A94 WeakPolarHBondContact O-CB 3.44Å; P90-A94 PolarHBondContact O-N 3.42Å; P90-L101 HydrophobicContact CB-CD1 4.09Å; P90-L101 HydrophobicContact CB-CD2 4.12Å
91	E	87.2	Confident	82.7	Confident	110 Å²	110	108.6 Å²	108.6	51%	0.514	58%	0.58	S	S	.	*	H	α-helix	trans	-64.1	-48.6	174	-59.5	71.2	-161.1	0	0	112.1	S89 V93 A94 G95 L101	S89-E91 WeakPolarHBondContact CB-OE2 3.49Å; S89-E91 PolarHBondContact O-N 3.22Å; S89-E91 VanDerWaalsContact O-N 3.13Å; S89-E91 PolarHBondContact OG-N 3.26Å; S89-E91 PolarHBondContact OG-OE2 3.16Å; E91-V93 VanDerWaalsContact C-N 3.32Å; E91-V93 PolarHBondContact O-N 2.8Å; E91-A94 PolarHBondContact O-N 3.37Å; E91-G95 PolarHBondContact O-N 2.97Å; E91-L101 HydrophobicContact CB-CD1 4.28Å; E91-L101 HydrophobicContact CG-CD1 3.44Å; E91-L101 VanDerWaalsContact CG-CD1 3.44Å; E91-L101 HydrophobicContact CG-CG 4.19Å; E91-L101 WeakPolarHBondContact OE1-CD1 3.33Å
92	E	85.5	Confident	82.4	Confident	115 Å²	115	106.8 Å²	106.8	54%	0.537	58%	0.575	S	S	.	*	H	α-helix	trans	-63.4	-41.6	179	-69.4	179.9	142.5	0	0	110.6	R88 S89 G95 L96	R88-E92 WeakPolarHBondContact CA-OE2 3.38Å; R88-E92 HydrophobicContact CB-CB 4.17Å; R88-E92 WeakPolarHBondContact CB-OE2 3.2Å; S89-E92 PolarHBondContact N-OE2 3.39Å; S89-E92 VanDerWaalsContact N-OE2 3.09Å; S89-E92 PolarHBondContact O-N 3.34Å; S89-E92 PolarHBondContact OG-N 3.29Å; E92-G95 PolarHBondContact O-N 3.38Å; E92-L96 WeakPolarHBondContact O-CG 3.45Å; E92-L96 PolarHBondContact O-N 3.49Å; E92-L96 VanDerWaalsContact O-N 3.16Å
93	V	87.3	Confident	82.2	Confident	72 Å²	72	104.4 Å²	104.4	44%	0.436	58%	0.579	S	S	.	*	H	α-helix	trans	-65.5	-44.9	177.5	178.6	0	0	0	0	111.1	R88 S89 E91 G95 L96	R88-V93 HydrophobicContact CB-CG2 3.73Å; S89-V93 WeakPolarHBondContact O-CG2 3.3Å; S89-V93 PolarHBondContact O-N 3.39Å; E91-V93 VanDerWaalsContact C-N 3.32Å; E91-V93 PolarHBondContact O-N 2.8Å; V93-G95 VanDerWaalsContact C-N 3.31Å; V93-G95 PolarHBondContact O-N 2.93Å; V93-L96 PolarHBondContact O-N 2.98Å
94	A	88.5	Confident	81.9	Confident	13 Å²	13	104 Å²	104	11%	0.107	58%	0.578	C	S	.	*	H	α-helix	trans	-57.9	-44.8	175	0	0	0	0	0	111.1	P90 E91 L96 V97 G98 L99	P90-A94 VanDerWaalsContact O-CB 3.3Å; P90-A94 WeakPolarHBondContact O-CB 3.44Å; P90-A94 PolarHBondContact O-N 3.42Å; E91-A94 PolarHBondContact O-N 3.37Å; A94-L96 VanDerWaalsContact C-N 3.33Å; A94-L96 PolarHBondContact O-N 3.09Å; A94-V97 WeakPolarHBondContact O-CG2 3.45Å; A94-V97 PolarHBondContact O-N 3.49Å; A94-G98 PolarHBondContact O-N 3.33Å; A94-L99 CarbonylContact C-O 3.11Å; A94-L99 HydrophobicContact CB-CB 4.14Å; A94-L99 CarbonylContact O-C 3.48Å; A94-L99 WeakPolarHBondContact O-CA 3.18Å; A94-L99 WeakPolarHBondContact O-CB 2.99Å; A94-L99 PolarHBondContact O-N 3.13Å
95	G	87.7	Confident	81.9	Confident	51 Å²	51	107.6 Å²	107.6	53%	0.526	59%	0.592	S	S	.	*	H	α-helix	trans	-60.9	-35.7	178.5	0	0	0	0	0	114.3	E91 E92 V93 V97 G98 L99	E91-G95 PolarHBondContact O-N 2.97Å; E92-G95 PolarHBondContact O-N 3.38Å; V93-G95 VanDerWaalsContact C-N 3.31Å; V93-G95 PolarHBondContact O-N 2.93Å; G95-V97 VanDerWaalsContact C-N 3.25Å; G95-V97 PolarHBondContact O-N 2.85Å; G95-G98 PolarHBondContact O-N 2.64Å; G95-L99 PolarHBondContact N-O 3.47Å
96	L	86.8	Confident	82.2	Confident	112 Å²	112	100.6 Å²	100.6	59%	0.586	58%	0.582	S	S	*	*	H	α-helix	trans	-62.9	-31.7	178.4	-69.6	163.4	0	0	0	113.2	E92 V93 A94	E92-L96 WeakPolarHBondContact O-CG 3.45Å; E92-L96 PolarHBondContact O-N 3.49Å; E92-L96 VanDerWaalsContact O-N 3.16Å; V93-L96 PolarHBondContact O-N 2.98Å; A94-L96 VanDerWaalsContact C-N 3.33Å; A94-L96 PolarHBondContact O-N 3.09Å
97	V	90.8	Very high	81.7	Confident	100 Å²	100	100 Å²	100	61%	0.606	58%	0.576	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.7	9.9	179.9	-64.3	0	0	0	0	112.5	A94 G95 L99	A94-V97 WeakPolarHBondContact O-CG2 3.45Å; A94-V97 PolarHBondContact O-N 3.49Å; G95-V97 VanDerWaalsContact C-N 3.25Å; G95-V97 PolarHBondContact O-N 2.85Å; V97-L99 VanDerWaalsContact C-N 3.3Å; V97-L99 HydrophobicContact CG2-CB 4.02Å; V97-L99 HydrophobicContact CG2-CD1 3.67Å; V97-L99 HydrophobicContact CG2-CG 3.74Å; V97-L99 PolarHBondContact O-N 3.03Å
98	G	88.3	Confident	81.1	Confident	69 Å²	69	99 Å²	99	71%	0.711	57%	0.568	S	S	*	*	T	Hydrogen-bonded Turn	trans	73.9	18.9	-178.9	0	0	0	0	0	114.2	A94 G95	A94-G98 PolarHBondContact O-N 3.33Å; G95-G98 PolarHBondContact O-N 2.64Å
99	L	88	Confident	80.2	Confident	111 Å²	111	93.5 Å²	93.5	58%	0.581	56%	0.56	S	S	*	*			trans	-102.3	167	176.8	-60.3	178.2	0	0	0	111.1	A94 G95 V97	A94-L99 CarbonylContact C-O 3.11Å; A94-L99 HydrophobicContact CB-CB 4.14Å; A94-L99 CarbonylContact O-C 3.48Å; A94-L99 WeakPolarHBondContact O-CA 3.18Å; A94-L99 WeakPolarHBondContact O-CB 2.99Å; A94-L99 PolarHBondContact O-N 3.13Å; G95-L99 PolarHBondContact N-O 3.47Å; V97-L99 VanDerWaalsContact C-N 3.3Å; V97-L99 HydrophobicContact CG2-CB 4.02Å; V97-L99 HydrophobicContact CG2-CD1 3.67Å; V97-L99 HydrophobicContact CG2-CG 3.74Å; V97-L99 PolarHBondContact O-N 3.03Å
100	R	84.6	Confident	79	Confident	222 Å²	222	101.7 Å²	101.7	84%	0.838	58%	0.584	S	S	*	*			trans	-131.3	152	171.4	-70	-173.9	177.3	174.6	-0.1	109.7
101	L	83.8	Confident	78	Confident	74 Å²	74	106.6 Å²	106.6	39%	0.387	60%	0.6	S	S	.	*			trans	-68.5	143.6	173.3	-71.2	-174.2	0	0	0	111.2	P90 E91	P90-L101 HydrophobicContact CB-CD1 4.09Å; P90-L101 HydrophobicContact CB-CD2 4.12Å; E91-L101 HydrophobicContact CB-CD1 4.28Å; E91-L101 HydrophobicContact CG-CD1 3.44Å; E91-L101 VanDerWaalsContact CG-CD1 3.44Å; E91-L101 HydrophobicContact CG-CG 4.19Å; E91-L101 WeakPolarHBondContact OE1-CD1 3.33Å
102	P	80.9	Confident	76.6	Confident	82 Å²	82	114.2 Å²	114.2	53%	0.532	63%	0.631	S	S	.	*			trans	-69	132.5	176.2	28.2	-32.9	0	0	0	110.9	Q104	P102-Q104 VanDerWaalsContact C-N 3.31Å
103	T	78.4	Confident	76.1	Confident	126 Å²	126	114.2 Å²	114.2	77%	0.773	64%	0.636	S	S	*	*	S	Bend	trans	-77.8	-17.9	177.5	-40.9	0	0	0	0	112.9
104	Q	76.5	Confident	75.5	Confident	116 Å²	116	116.4 Å²	116.4	54%	0.542	65%	0.646	S	S	.	*	S	Bend	trans	-137.9	139.3	179.8	-175.2	-177.5	-44.2	0	0	110.9	P102 G106 G107	P102-Q104 VanDerWaalsContact C-N 3.31Å; Q104-G106 PolarHBondContact O-N 3.21Å; Q104-G107 PolarHBondContact O-N 3.26Å
105	P	67.6	Low	74.8	Confident	127 Å²	127	122.1 Å²	122.1	83%	0.825	68%	0.676	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.5	121.1	167.6	22.4	-31	0	0	0	110.2
106	G	71.8	Confident	74	Confident	73 Å²	73	126.3 Å²	126.3	75%	0.753	69%	0.685	S	S	*	*	T	Hydrogen-bonded Turn	trans	112.7	2.4	-175.1	0	0	0	0	0	115.7	Q104 K108	Q104-G106 PolarHBondContact O-N 3.21Å; G106-K108 VanDerWaalsContact C-N 3.33Å; G106-K108 PolarHBondContact O-N 3.3Å
107	G	62.8	Low	73.2	Confident	45 Å²	45	127.2 Å²	127.2	46%	0.464	69%	0.691	S	S	.	*	S	Bend	trans	75.6	10.2	163.5	0	0	0	0	0	116.5	Q104	Q104-G107 PolarHBondContact O-N 3.26Å
108	K	59.6	Low	72.1	Confident	176 Å²	176	129 Å²	129	77%	0.765	70%	0.697	S	S	*	*			trans	-105	100.4	175	-63.5	-170.7	179.6	-171.2	0	109.7	G106	G106-K108 VanDerWaalsContact C-N 3.33Å; G106-K108 PolarHBondContact O-N 3.3Å
109	G	60	Low	70.9	Confident	40 Å²	40	133.3 Å²	133.3	41%	0.412	70%	0.696	S	S	.	*			trans	-176.7	22	-179.8	0	0	0	0	0	115.4
110	W	59.8	Low	69.6	Low	217 Å²	217	135 Å²	135	82%	0.822	71%	0.705	S	S	*	*			trans	-94	1.1	-175.7	-55.2	0.6	0	0	0	112.7	K112	W110-K112 PolarHBondContact O-N 3.21Å
111	E	62.6	Low	68.4	Low	188 Å²	188	127.8 Å²	127.8	88%	0.879	69%	0.694	S	S	*	*			trans	-85.4	84.6	177.3	-66.2	-177.9	172.7	0	0	109.9
112	K	56.3	Low	66.9	Low	269 Å²	269	132.6 Å²	132.6	100%	1.17	72%	0.721	S	S	*	*			trans	-176.5	0	147.2	-101.7	171	-167.5	-174.9	0	111	W110	W110-K112 PolarHBondContact O-N 3.21Å

Retrieved 112 of 112 residues in 237.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).