A0A087X6A2_POEFO Loading...

CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae)

AlphaFold DB , UniProt , Accession A0A087X6A2, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 137 aa.

						>A0A087X6A2_POEFO|A0A087X6A2
MVQIFIRGSVDGSSPPEWLLVELQGEMMSRRNSGLAGNVMGDLLYTKEGLPVLIVGHHILYGKQVKLEKPFAVLTKHSGHSQDTDAAGDIAMETDQQGPSSSSSSSSTSYSVSALIKRKLIFKTRPKPIITNVPKKV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.6	Low	70.7	Confident	228 Å²	228	138.6 Å²	138.6	100%	1.123	72%	0.723	S	S	*	*				0	121.8	0	-173.1	-177.6	-120.9	0	0	106.7
2	V	70	Confident	70.6	Confident	135 Å²	135	132.7 Å²	132.7	82%	0.818	72%	0.721	S	S	*	*			trans	-97.8	125.4	-179.5	-179.4	0	0	0	0	108.3	I4	V2-I4 HydrophobicContact CG1-CG1 4.44Å
3	Q	73.9	Confident	71	Confident	146 Å²	146	126.6 Å²	126.6	68%	0.682	69%	0.694	S	S	*	*			trans	-107.9	133.3	173.8	-70.7	-179	-41.4	0	0	108.7	F5	Q3-F5 HydrophobicContact CB-CE2 4.45Å
4	I	74.4	Confident	71.6	Confident	127 Å²	127	124.6 Å²	124.6	65%	0.651	69%	0.694	S	S	*	*			trans	-113.3	119.5	177.5	-57.8	175	0	0	0	107.1	V2	V2-I4 HydrophobicContact CG1-CG1 4.44Å
5	F	74.2	Confident	72.5	Confident	178 Å²	178	118.5 Å²	118.5	78%	0.781	66%	0.662	S	S	*	*	P	Polyproline II helix	trans	-88.2	121	175.9	-66.6	-86.2	0	0	0	109.3	Q3	Q3-F5 HydrophobicContact CB-CE2 4.45Å
6	I	75.4	Confident	73.7	Confident	75 Å²	75	115.8 Å²	115.8	39%	0.385	65%	0.651	S	S	.	*	P	Polyproline II helix	trans	-92.5	116.7	176.9	-56.4	175.4	0	0	0	107.2	G8 V112 L115	I6-G8 PolarHBondContact O-N 2.85Å; I6-V112 HydrophobicContact CB-CG2 4.44Å; I6-V112 HydrophobicContact CD1-CG1 4.38Å; I6-V112 HydrophobicContact CD1-CG2 4.22Å; I6-V112 HydrophobicContact CG1-CG2 4.02Å; I6-V112 HydrophobicContact CG2-CB 4.21Å; I6-V112 HydrophobicContact CG2-CG2 3.75Å; I6-L115 HydrophobicContact CD1-CD2 4.01Å
7	R	72.1	Confident	74.8	Confident	243 Å²	243	114.6 Å²	114.6	92%	0.917	64%	0.639	S	S	*	*	P	Polyproline II helix	trans	-71.9	122.2	166.6	-81.6	-176.8	169.7	145.5	-2.3	108
8	G	67.4	Low	76	Confident	57 Å²	57	115.4 Å²	115.4	59%	0.588	63%	0.631	S	S	*	*	P	Polyproline II helix	trans	-61.6	155.3	171.1	0	0	0	0	0	110.6	I6	I6-G8 PolarHBondContact O-N 2.85Å
9	S	72	Confident	77	Confident	63 Å²	63	113.6 Å²	113.6	44%	0.441	62%	0.62	S	S	.	*	P	Polyproline II helix	trans	-64.8	152.5	173.1	178.6	0	0	0	0	110.2	D11 G12	S9-D11 WeakPolarHBondContact CB-OD1 3.21Å; S9-D11 PolarHBondContact O-N 2.78Å; S9-D11 PolarHBondContact OG-OD1 2.88Å; S9-G12 WeakPolarHBondContact O-CA 3.39Å; S9-G12 PolarHBondContact O-N 3.41Å
10	V	66.8	Low	78	Confident	156 Å²	156	110.6 Å²	110.6	95%	0.945	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.6	-24.7	-172	-163.8	0	0	0	0	111.9	G12	V10-G12 PolarHBondContact O-N 3.22Å
11	D	74.4	Confident	78.8	Confident	117 Å²	117	108.4 Å²	108.4	63%	0.626	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.6	0.3	172.5	64	-16.3	0	0	0	113.6	S9 S13	S9-D11 WeakPolarHBondContact CB-OD1 3.21Å; S9-D11 PolarHBondContact O-N 2.78Å; S9-D11 PolarHBondContact OG-OD1 2.88Å; D11-S13 PolarHBondContact O-N 3.33Å; D11-S13 WeakPolarHBondContact OD1-CB 3.38Å; D11-S13 PolarHBondContact OD1-N 3.07Å; D11-S13 VanDerWaalsContact OD1-N 3.07Å; D11-S13 PolarHBondContact OD1-OG 3.44Å; D11-S13 WeakPolarHBondContact OD2-CB 3.42Å; D11-S13 PolarHBondContact OD2-OG 2.88Å
12	G	69	Low	80.6	Confident	67 Å²	67	100.3 Å²	100.3	69%	0.691	55%	0.552	S	S	*	*			trans	73.6	6.8	-175.9	0	0	0	0	0	113.8	S9 V10	S9-G12 WeakPolarHBondContact O-CA 3.39Å; S9-G12 PolarHBondContact O-N 3.41Å; V10-G12 PolarHBondContact O-N 3.22Å
13	S	75.4	Confident	81.8	Confident	54 Å²	54	96.4 Å²	96.4	38%	0.378	53%	0.526	S	S	.	.	P	Polyproline II helix	trans	-73.9	132.8	178.5	69.7	0	0	0	0	110.8	D11	D11-S13 PolarHBondContact O-N 3.33Å; D11-S13 WeakPolarHBondContact OD1-CB 3.38Å; D11-S13 PolarHBondContact OD1-N 3.07Å; D11-S13 VanDerWaalsContact OD1-N 3.07Å; D11-S13 PolarHBondContact OD1-OG 3.44Å; D11-S13 WeakPolarHBondContact OD2-CB 3.42Å; D11-S13 PolarHBondContact OD2-OG 2.88Å
14	S	79.3	Confident	82.6	Confident	99 Å²	99	96.1 Å²	96.1	69%	0.692	53%	0.525	S	S	*	.	P	Polyproline II helix	trans	-76.5	147.5	171.7	62.9	0	0	0	0	109.8
15	P	86.3	Confident	83.4	Confident	32 Å²	32	93.4 Å²	93.4	21%	0.208	53%	0.529	C	S	.	.	P	Polyproline II helix	trans	-52.4	143.8	171.3	-23.3	32.3	0	0	0	111.1	V112 L115	P15-V112 HydrophobicContact CB-CG1 4.14Å; P15-V112 HydrophobicContact CG-CB 4.47Å; P15-V112 HydrophobicContact CG-CG1 3.97Å; P15-L115 HydrophobicContact CB-CG 4.39Å
16	P	91.8	Very high	84	Confident	75 Å²	75	92.9 Å²	92.9	49%	0.487	53%	0.529	S	S	.	.	P	Polyproline II helix	trans	-60.7	153.4	179.5	26.3	-35.2	0	0	0	111.4	S113 A114 L115	P16-S113 WeakPolarHBondContact CD-O 3.47Å; P16-S113 VanDerWaalsContact CG-O 3.29Å; P16-S113 WeakPolarHBondContact CG-O 3.41Å; P16-A114 HydrophobicContact CG-CB 4.37Å; P16-A114 CarbonylContact O-C 3.59Å; P16-A114 VanDerWaalsContact O-CA 3.27Å; P16-A114 WeakPolarHBondContact O-CA 3.47Å; P16-A114 WeakPolarHBondContact O-CB 3.33Å; P16-L115 PolarHBondContact O-N 3.47Å
17	E	92.4	Very high	84.5	Confident	96 Å²	96	92.7 Å²	92.7	45%	0.449	53%	0.527	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.8	124.1	173.1	-172.4	165.5	155.6	0	0	110.1	L115 K117	E17-L115 CarbonylContact C-O 3.52Å; E17-L115 VanDerWaalsContact CA-O 3.3Å; E17-L115 WeakPolarHBondContact CA-O 3.44Å; E17-K117 WeakPolarHBondContact OE2-CD 3.48Å; E17-K117 WeakPolarHBondContact OE2-CE 3.45Å; E17-K117 IonicContact OE2-NZ 2.78Å; E17-K117 PolarHBondContact OE2-NZ 3.13Å
18	W	96.1	Very high	85.1	Confident	130 Å²	130	88.6 Å²	88.6	49%	0.492	52%	0.52	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.3	151.4	174.4	-73.4	6.9	0	0	0	110.9	V73 A114 L115 I116	W18-V73 HydrophobicContact CE3-CG1 4.47Å; W18-V73 HydrophobicContact CE3-CG2 3.97Å; W18-V73 HydrophobicContact CH2-CG1 4.49Å; W18-V73 HydrophobicContact CZ3-CB 4.45Å; W18-V73 HydrophobicContact CZ3-CG1 3.91Å; W18-V73 HydrophobicContact CZ3-CG2 4.23Å; W18-A114 HydrophobicContact CB-CB 4.03Å; W18-A114 HydrophobicContact CD2-CB 3.32Å; W18-A114 VanDerWaalsContact CE2-CB 3.48Å; W18-A114 HydrophobicContact CE3-CB 3.9Å; W18-A114 HydrophobicContact CG-CB 3.38Å; W18-A114 HydrophobicContact CZ2-CB 4.15Å; W18-L115 PolarHBondContact N-O 3.25Å; W18-I116 HydrophobicContact CB-CG1 4.01Å
19	L	95.1	Very high	85.8	Confident	80 Å²	80	87.7 Å²	87.7	42%	0.419	51%	0.505	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.9	127.4	173.4	-177.1	64.8	0	0	0	109.5	R118 L120	L19-R118 HydrophobicContact CD1-CB 3.95Å; L19-L120 HydrophobicContact CD1-CD2 4.33Å; L19-L120 HydrophobicContact CD1-CG 4.2Å; L19-L120 HydrophobicContact CD2-CD1 3.73Å; L19-L120 HydrophobicContact CD2-CD2 4.2Å; L19-L120 HydrophobicContact CD2-CG 3.76Å; L19-L120 HydrophobicContact CG-CG 4.12Å
20	L	96.6	Very high	86	Confident	53 Å²	53	95.3 Å²	95.3	28%	0.277	52%	0.524	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.2	132.2	174.7	176.7	66.1	0	0	0	110.5	F71 I116 R118 K119 L120	L20-F71 HydrophobicContact CD2-CD2 4.31Å; L20-F71 HydrophobicContact CD2-CE2 4.09Å; L20-I116 HydrophobicContact CB-CD1 4.45Å; L20-I116 HydrophobicContact CB-CG2 3.61Å; L20-R118 PolarHBondContact N-O 3.21Å; L20-K119 HydrophobicContact CB-CB 3.87Å; L20-K119 HydrophobicContact CD2-CB 4.15Å; L20-K119 HydrophobicContact CD2-CD 4.38Å; L20-K119 HydrophobicContact CG-CB 4.16Å; L20-K119 CarbonylContact O-C 3.55Å; L20-K119 WeakPolarHBondContact O-CA 3.5Å; L20-K119 WeakPolarHBondContact O-CB 3.33Å; L20-L120 PolarHBondContact O-N 2.79Å
21	V	95.5	Very high	86.6	Confident	66 Å²	66	98.6 Å²	98.6	40%	0.4	52%	0.519	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.7	120.1	170	178.3	0	0	0	0	108.4	L23 L120 F122	V21-L23 HydrophobicContact CG1-CD1 4.48Å; V21-L23 HydrophobicContact CG1-CD2 4.37Å; V21-L23 HydrophobicContact CG1-CG 4.19Å; V21-L120 HydrophobicContact CG2-CD1 4.41Å; V21-F122 HydrophobicContact CG1-CD2 4.19Å; V21-F122 HydrophobicContact CG1-CE2 3.97Å
22	E	95.3	Very high	86.4	Confident	58 Å²	58	100.5 Å²	100.5	27%	0.271	53%	0.53	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.1	121.1	179.7	-177.7	-177.4	135	0	0	109.4	K119 L120 I121 F122 K123	E22-K119 IonicContact OE1-NZ 3.92Å; E22-K119 WeakPolarHBondContact OE2-CD 3.49Å; E22-K119 WeakPolarHBondContact OE2-CE 3.36Å; E22-K119 IonicContact OE2-NZ 2.63Å; E22-K119 PolarHBondContact OE2-NZ 3.38Å; E22-L120 PolarHBondContact N-O 2.83Å; E22-I121 HydrophobicContact CB-CG1 4.49Å; E22-F122 PolarHBondContact O-N 3.12Å; E22-K123 WeakPolarHBondContact OE1-CE 3.36Å; E22-K123 IonicContact OE1-NZ 3.74Å
23	L	93.6	Very high	86.9	Confident	53 Å²	53	99.7 Å²	99.7	28%	0.277	51%	0.513	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	130.2	-179	-59.3	156.2	0	0	0	108.3	V21 G25 M27 M40 L53 L60 F122	V21-L23 HydrophobicContact CG1-CD1 4.48Å; V21-L23 HydrophobicContact CG1-CD2 4.37Å; V21-L23 HydrophobicContact CG1-CG 4.19Å; L23-G25 PolarHBondContact O-N 2.89Å; L23-M27 HydrophobicContact CD1-CG 4.01Å; L23-M27 HydrophobicContact CD1-SD 3.68Å; L23-M40 HydrophobicContact CD1-CE 3.59Å; L23-M40 HydrophobicContact CD2-CE 4.41Å; L23-L53 HydrophobicContact CD2-CD2 3.49Å; L23-L53 VanDerWaalsContact CD2-CD2 3.49Å; L23-L60 HydrophobicContact CD2-CD2 4.49Å; L23-F122 HydrophobicContact CD2-CB 4.02Å; L23-F122 HydrophobicContact CD2-CD2 3.89Å; L23-F122 HydrophobicContact CD2-CG 4.16Å
24	Q	91.4	Very high	87.1	Confident	139 Å²	139	100 Å²	100	65%	0.65	52%	0.524	S	S	*	.	S	Bend	trans	-85.4	112.8	172.2	-176.2	175.5	-16.7	0	0	110.2	F122 K123	Q24-F122 PolarHBondContact N-O 3.17Å; Q24-K123 HydrophobicContact CB-CG 4.45Å; Q24-K123 PolarHBondContact OE1-O 2.84Å
25	G	90.4	Very high	87.3	Confident	71 Å²	71	99.3 Å²	99.3	73%	0.732	51%	0.513	S	S	*	.	S	Bend	trans	126.9	-157.3	-179.6	0	0	0	0	0	111.3	L23	L23-G25 PolarHBondContact O-N 2.89Å
26	E	88.3	Confident	87.4	Confident	166 Å²	166	102.3 Å²	102.3	78%	0.776	54%	0.54	S	S	*	.			trans	-117.3	140.2	-179.7	-173.5	175.6	-179.4	0	0	110.4	M28	E26-M28 HydrophobicContact CG-CG 4.28Å
27	M	85.2	Confident	87	Confident	71 Å²	71	103.1 Å²	103.1	35%	0.35	56%	0.562	S	S	.	*			trans	-92.1	121.1	169.6	-83.9	-167.9	58.9	0	0	110.1	L23 L35 M40	L23-M27 HydrophobicContact CD1-CG 4.01Å; L23-M27 HydrophobicContact CD1-SD 3.68Å; M27-L35 HydrophobicContact CB-CD1 3.83Å; M27-L35 HydrophobicContact CE-CD1 4.02Å; M27-L35 HydrophobicContact CE-CD2 4.05Å; M27-L35 HydrophobicContact SD-CD1 4.49Å; M27-M40 HydrophobicContact CE-CB 4.26Å; M27-M40 HydrophobicContact CE-CE 3.68Å; M27-M40 HydrophobicContact CE-CG 3.49Å; M27-M40 VanDerWaalsContact CE-CG 3.49Å; M27-M40 HydrophobicContact CE-SD 3.48Å; M27-M40 WeakPolarHBondContact CE-SD 3.43Å; M27-M40 HydrophobicContact CG-CE 4.24Å; M27-M40 HydrophobicContact SD-CE 3.33Å; M27-M40 WeakPolarHBondContact SD-CE 3.49Å; M27-M40 HydrophobicContact SD-CG 4.35Å; M27-M40 HydrophobicContact SD-SD 3.58Å
28	M	84.1	Confident	86.7	Confident	157 Å²	157	102.9 Å²	102.9	77%	0.773	56%	0.564	S	S	*	*			trans	-112.8	133.3	179.2	-65.1	-169.6	-73.2	0	0	111.6	E26	E26-M28 HydrophobicContact CG-CG 4.28Å
29	S	83.5	Confident	86.2	Confident	38 Å²	38	103.1 Å²	103.1	27%	0.266	58%	0.579	S	S	.	*			trans	-80.4	137.5	166.2	174.7	0	0	0	0	110.2	R31 N32 S33	S29-R31 PolarHBondContact O-N 2.78Å; S29-R31 PolarHBondContact OG-N 2.9Å; S29-N32 PolarHBondContact O-N 2.84Å; S29-S33 WeakPolarHBondContact CB-O 3.45Å; S29-S33 PolarHBondContact OG-O 2.83Å; S29-S33 PolarHBondContact OG-OG 3.46Å
30	R	76.2	Confident	85.8	Confident	224 Å²	224	102.5 Å²	102.5	85%	0.845	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.9	-28.4	177.3	-169	-179.9	-65.7	176	2	112.8
31	R	77.9	Confident	85.5	Confident	225 Å²	225	101.5 Å²	101.5	85%	0.849	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-104.1	12	-175.4	-64.4	-169.2	-179.8	-164.1	1.2	113.4	S29 S33	S29-R31 PolarHBondContact O-N 2.78Å; S29-R31 PolarHBondContact OG-N 2.9Å; R31-S33 PolarHBondContact O-N 2.94Å
32	N	71	Confident	85.4	Confident	157 Å²	157	103.3 Å²	103.3	84%	0.84	59%	0.585	S	S	*	*	S	Bend	trans	51	23.7	-170.2	-158.7	20.8	0	0	0	113.2	S29	S29-N32 PolarHBondContact O-N 2.84Å
33	S	79.3	Confident	85.5	Confident	50 Å²	50	104.2 Å²	104.2	35%	0.35	59%	0.591	S	S	.	*			trans	-82.4	153.1	171.1	61.6	0	0	0	0	108.9	S29 R31	S29-S33 WeakPolarHBondContact CB-O 3.45Å; S29-S33 PolarHBondContact OG-O 2.83Å; S29-S33 PolarHBondContact OG-OG 3.46Å; R31-S33 PolarHBondContact O-N 2.94Å
34	G	80.7	Confident	85.5	Confident	59 Å²	59	105.8 Å²	105.8	61%	0.608	60%	0.599	S	S	*	*			trans	-52.9	151.5	170.9	0	0	0	0	0	111.9	A36 N38	G34-A36 VanDerWaalsContact C-N 3.28Å; G34-A36 PolarHBondContact O-N 3.47Å; G34-N38 PolarHBondContact O-ND2 2.84Å
35	L	83.6	Confident	85.7	Confident	86 Å²	86	104.5 Å²	104.5	45%	0.45	59%	0.589	S	S	.	*	S	Bend	trans	-72.9	-22.7	179.9	-63	174	0	0	0	112.7	M27 G37 N38	M27-L35 HydrophobicContact CB-CD1 3.83Å; M27-L35 HydrophobicContact CE-CD1 4.02Å; M27-L35 HydrophobicContact CE-CD2 4.05Å; M27-L35 HydrophobicContact SD-CD1 4.49Å; L35-G37 PolarHBondContact O-N 2.55Å; L35-N38 PolarHBondContact O-N 2.63Å
36	A	86.5	Confident	85.8	Confident	95 Å²	95	103.2 Å²	103.2	79%	0.785	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.2	135	-177.8	0	0	0	0	0	111.8	G34 N38	G34-A36 VanDerWaalsContact C-N 3.28Å; G34-A36 PolarHBondContact O-N 3.47Å; A36-N38 PolarHBondContact O-N 2.96Å
37	G	85.2	Confident	86.1	Confident	91 Å²	91	105.7 Å²	105.7	94%	0.938	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	74.6	-8	179.8	0	0	0	0	0	115.3	L35	L35-G37 PolarHBondContact O-N 2.55Å
38	N	85.3	Confident	86.3	Confident	91 Å²	91	109.6 Å²	109.6	49%	0.487	59%	0.593	S	S	.	*	S	Bend	trans	-89.1	140.4	177.7	-71.7	-63.2	0	0	0	111.4	G34 L35 A36 M40	G34-N38 PolarHBondContact O-ND2 2.84Å; L35-N38 PolarHBondContact O-N 2.63Å; A36-N38 PolarHBondContact O-N 2.96Å; N38-M40 PolarHBondContact O-N 2.87Å; N38-M40 VanDerWaalsContact O-N 3.13Å
39	V	86.4	Confident	86.7	Confident	135 Å²	135	104 Å²	104	82%	0.818	58%	0.575	S	S	*	*			trans	-66.9	113.5	171.6	178.9	0	0	0	0	108.4
40	M	86.3	Confident	87.2	Confident	68 Å²	68	106.1 Å²	106.1	34%	0.335	58%	0.583	S	S	.	*			trans	-73.7	-40.2	177.8	175.3	-176.6	175.1	0	0	111.7	L23 M27 N38 L53 V55	L23-M40 HydrophobicContact CD1-CE 3.59Å; L23-M40 HydrophobicContact CD2-CE 4.41Å; M27-M40 HydrophobicContact CE-CB 4.26Å; M27-M40 HydrophobicContact CE-CE 3.68Å; M27-M40 HydrophobicContact CE-CG 3.49Å; M27-M40 VanDerWaalsContact CE-CG 3.49Å; M27-M40 HydrophobicContact CE-SD 3.48Å; M27-M40 WeakPolarHBondContact CE-SD 3.43Å; M27-M40 HydrophobicContact CG-CE 4.24Å; M27-M40 HydrophobicContact SD-CE 3.33Å; M27-M40 WeakPolarHBondContact SD-CE 3.49Å; M27-M40 HydrophobicContact SD-CG 4.35Å; M27-M40 HydrophobicContact SD-SD 3.58Å; N38-M40 PolarHBondContact O-N 2.87Å; N38-M40 VanDerWaalsContact O-N 3.13Å; M40-L53 HydrophobicContact CE-CD2 3.91Å; M40-V55 HydrophobicContact CE-CG2 3.68Å; M40-V55 HydrophobicContact CG-CG2 4.38Å
41	G	90.8	Very high	88.2	Confident	32 Å²	32	95.4 Å²	95.4	33%	0.33	54%	0.543	S	S	.	.			trans	154.2	-169.3	-171.8	0	0	0	0	0	112.8	I54	G41-I54 CarbonylContact C-O 3.49Å; G41-I54 WeakPolarHBondContact CA-O 3.32Å
42	D	93.6	Very high	89.1	Confident	103 Å²	103	85.3 Å²	85.3	55%	0.551	51%	0.506	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106.7	131.8	-174.8	-59.1	-52.8	0	0	0	111.3	L44 L53 I54	D42-L44 HydrophobicContact CB-CD1 3.95Å; D42-L53 CarbonylContact O-C 3.46Å; D42-L53 WeakPolarHBondContact O-CA 3.49Å; D42-I54 HydrophobicContact CB-CB 4.37Å; D42-I54 PolarHBondContact N-O 2.94Å; D42-I54 PolarHBondContact O-N 3.47Å
43	L	95.5	Very high	90.2	Very high	77 Å²	77	78.3 Å²	78.3	40%	0.403	47%	0.469	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	118.4	172.7	178.3	66.3	0	0	0	109.4	P51 L53 L120 F122	L43-P51 HydrophobicContact CD1-CB 4.17Å; L43-L53 HydrophobicContact CB-CD1 4.17Å; L43-L53 HydrophobicContact CD1-CB 4.28Å; L43-L53 HydrophobicContact CD1-CD1 4.32Å; L43-L120 HydrophobicContact CD1-CD1 4.12Å; L43-L120 HydrophobicContact CD2-CD1 3.61Å; L43-L120 HydrophobicContact CG-CD1 4.48Å; L43-F122 HydrophobicContact CD1-CZ 3.79Å
44	L	95.3	Very high	91	Very high	86 Å²	86	78 Å²	78	45%	0.45	46%	0.463	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.4	161.6	180	-56.5	103.3	0	0	0	110.7	D42 P51 V52 I54	D42-L44 HydrophobicContact CB-CD1 3.95Å; L44-P51 CarbonylContact O-C 3.57Å; L44-P51 WeakPolarHBondContact O-CA 2.94Å; L44-V52 PolarHBondContact N-O 2.81Å; L44-V52 PolarHBondContact O-N 2.85Å; L44-I54 HydrophobicContact CD1-CD1 3.69Å; L44-I54 HydrophobicContact CD1-CG1 4.18Å
45	Y	95.3	Very high	91.5	Very high	112 Å²	112	77.1 Å²	77.1	44%	0.439	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.5	135	170.3	-76.9	-95.8	0	0	0	109.7	G49 L50 P51	Y45-G49 WeakPolarHBondContact CD1-O 3.4Å; Y45-L50 WeakPolarHBondContact CA-O 3.27Å; Y45-P51 HydrophobicContact CD1-CB 4.45Å; Y45-P51 HydrophobicContact CE1-CB 4.05Å
46	T	93	Very high	91.7	Very high	44 Å²	44	75.6 Å²	75.6	27%	0.27	45%	0.451	S	S	.	.			trans	-69.8	169.6	170.1	74.5	0	0	0	0	110.7	E48 G49 L50 V52	T46-E48 WeakPolarHBondContact CB-OE2 3.48Å; T46-E48 PolarHBondContact O-N 2.98Å; T46-E48 PolarHBondContact OG1-N 2.73Å; T46-E48 PolarHBondContact OG1-OE2 3.23Å; T46-G49 WeakPolarHBondContact O-CA 3.3Å; T46-G49 PolarHBondContact O-N 2.91Å; T46-L50 HydrophobicContact CG2-CB 4.3Å; T46-L50 PolarHBondContact N-O 3.29Å; T46-L50 PolarHBondContact OG1-N 2.79Å; T46-V52 HydrophobicContact CG2-CG2 3.62Å
47	K	92.7	Very high	91.8	Very high	218 Å²	218	77.7 Å²	77.7	95%	0.948	44%	0.444	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.3	-26.7	173	-65	-175.6	179.4	-179.8	0	112.5	G49	K47-G49 PolarHBondContact O-N 2.81Å
48	E	91.4	Very high	92.1	Very high	154 Å²	154	77.6 Å²	77.6	72%	0.72	42%	0.419	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.2	2.8	173	-47.5	93.1	-171.8	0	0	113.4	T46	T46-E48 WeakPolarHBondContact CB-OE2 3.48Å; T46-E48 PolarHBondContact O-N 2.98Å; T46-E48 PolarHBondContact OG1-N 2.73Å; T46-E48 PolarHBondContact OG1-OE2 3.23Å
49	G	91.4	Very high	92.5	Very high	39 Å²	39	74.8 Å²	74.8	40%	0.402	40%	0.403	S	S	.	.			trans	77.8	18.5	179.6	0	0	0	0	0	114.4	Y45 T46 K47	Y45-G49 WeakPolarHBondContact CD1-O 3.4Å; T46-G49 WeakPolarHBondContact O-CA 3.3Å; T46-G49 PolarHBondContact O-N 2.91Å; K47-G49 PolarHBondContact O-N 2.81Å
50	L	93.8	Very high	93	Very high	82 Å²	82	69 Å²	69	43%	0.429	37%	0.368	S	S	.	.			trans	-85	131.3	175.7	-63	176.9	0	0	0	110.5	Y45 T46	Y45-L50 WeakPolarHBondContact CA-O 3.27Å; T46-L50 HydrophobicContact CG2-CB 4.3Å; T46-L50 PolarHBondContact N-O 3.29Å; T46-L50 PolarHBondContact OG1-N 2.79Å
51	P	97.1	Very high	93.4	Very high	0 Å²	0	71.1 Å²	71.1	0%	0	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.5	134.6	178.7	31.6	-36.1	0	0	0	110.9	L43 L44 Y45 G62 L120 F122	L43-P51 HydrophobicContact CD1-CB 4.17Å; L44-P51 CarbonylContact O-C 3.57Å; L44-P51 WeakPolarHBondContact O-CA 2.94Å; Y45-P51 HydrophobicContact CD1-CB 4.45Å; Y45-P51 HydrophobicContact CE1-CB 4.05Å; P51-G62 WeakPolarHBondContact CD-O 3.44Å; P51-G62 WeakPolarHBondContact O-CA 3.43Å; P51-G62 PolarHBondContact O-N 2.89Å; P51-L120 HydrophobicContact CB-CD1 4.17Å; P51-L120 HydrophobicContact CB-CD2 4.25Å; P51-L120 HydrophobicContact CG-CD2 4.12Å; P51-F122 HydrophobicContact CB-CE1 4.36Å; P51-F122 HydrophobicContact CB-CZ 4.01Å; P51-F122 HydrophobicContact CG-CZ 4.37Å
52	V	96.2	Very high	93.6	Very high	13 Å²	13	70.2 Å²	70.2	8%	0.079	36%	0.363	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.2	121.9	176.9	-179.4	0	0	0	0	107.9	L44 T46 I59 L60 Y61	L44-V52 PolarHBondContact N-O 2.81Å; L44-V52 PolarHBondContact O-N 2.85Å; T46-V52 HydrophobicContact CG2-CG2 3.62Å; V52-I59 HydrophobicContact CG1-CD1 3.63Å; V52-I59 HydrophobicContact CG1-CG1 3.62Å; V52-L60 WeakPolarHBondContact CA-O 3.2Å; V52-Y61 HydrophobicContact CG1-CE1 4.43Å; V52-Y61 HydrophobicContact CG2-CD1 3.89Å; V52-Y61 HydrophobicContact CG2-CE1 4.05Å
53	L	95.8	Very high	93.7	Very high	10 Å²	10	71.6 Å²	71.6	5%	0.052	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	127.1	-178.6	-180	70.7	0	0	0	109.8	L23 M40 D42 L43 V55 L60 F122	L23-L53 HydrophobicContact CD2-CD2 3.49Å; L23-L53 VanDerWaalsContact CD2-CD2 3.49Å; M40-L53 HydrophobicContact CE-CD2 3.91Å; D42-L53 CarbonylContact O-C 3.46Å; D42-L53 WeakPolarHBondContact O-CA 3.49Å; L43-L53 HydrophobicContact CB-CD1 4.17Å; L43-L53 HydrophobicContact CD1-CB 4.28Å; L43-L53 HydrophobicContact CD1-CD1 4.32Å; L53-V55 HydrophobicContact CD1-CG2 4.37Å; L53-V55 HydrophobicContact CD2-CG2 3.93Å; L53-V55 HydrophobicContact CG-CG2 3.8Å; L53-L60 HydrophobicContact CB-CB 4.39Å; L53-L60 PolarHBondContact N-O 3.26Å; L53-L60 PolarHBondContact O-N 3.26Å; L53-F122 HydrophobicContact CB-CD1 3.98Å; L53-F122 HydrophobicContact CB-CE1 3.44Å; L53-F122 VanDerWaalsContact CB-CE1 3.44Å; L53-F122 HydrophobicContact CB-CE2 4.28Å; L53-F122 HydrophobicContact CB-CZ 3.61Å; L53-F122 HydrophobicContact CD2-CD2 4.31Å; L53-F122 HydrophobicContact CD2-CE2 4.23Å; L53-F122 HydrophobicContact CD2-CZ 4.38Å
54	I	94.4	Very high	93.7	Very high	44 Å²	44	71.6 Å²	71.6	23%	0.226	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.4	117.2	177.7	-61.4	175	0	0	0	108	G41 D42 L44 H58 I59 I129	G41-I54 CarbonylContact C-O 3.49Å; G41-I54 WeakPolarHBondContact CA-O 3.32Å; D42-I54 HydrophobicContact CB-CB 4.37Å; D42-I54 PolarHBondContact N-O 2.94Å; D42-I54 PolarHBondContact O-N 3.47Å; L44-I54 HydrophobicContact CD1-CD1 3.69Å; L44-I54 HydrophobicContact CD1-CG1 4.18Å; I54-H58 CarbonylContact C-O 3.6Å; I54-H58 WeakPolarHBondContact CA-O 3.43Å; I54-I59 HydrophobicContact CG1-CG1 4.43Å; I54-I129 HydrophobicContact CG2-CD1 3.84Å
55	V	91.8	Very high	93.8	Very high	39 Å²	39	69.7 Å²	69.7	24%	0.236	35%	0.354	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.8	107.4	179.5	-177.3	0	0	0	0	108.8	M40 L53 H57 H58 L60	M40-V55 HydrophobicContact CE-CG2 3.68Å; M40-V55 HydrophobicContact CG-CG2 4.38Å; L53-V55 HydrophobicContact CD1-CG2 4.37Å; L53-V55 HydrophobicContact CD2-CG2 3.93Å; L53-V55 HydrophobicContact CG-CG2 3.8Å; V55-H57 PolarHBondContact O-N 2.79Å; V55-H57 VanDerWaalsContact O-N 3.16Å; V55-H58 PolarHBondContact N-O 3.42Å; V55-H58 WeakPolarHBondContact O-CB 3.49Å; V55-H58 PolarHBondContact O-N 3.05Å; V55-L60 HydrophobicContact CG2-CD1 4.22Å
56	G	87.9	Confident	93.9	Very high	55 Å²	55	72.4 Å²	72.4	57%	0.567	37%	0.368	S	S	*	.	T	Hydrogen-bonded Turn	trans	57	-117.9	-173.6	0	0	0	0	0	111.5
57	H	89	Confident	94	Very high	138 Å²	138	71.3 Å²	71.3	64%	0.639	36%	0.361	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.2	10.4	178.1	-56.6	112	0	0	0	113.9	V55 I129	V55-H57 PolarHBondContact O-N 2.79Å; V55-H57 VanDerWaalsContact O-N 3.16Å; H57-I129 PolarHBondContact O-N 3.5Å
58	H	91.1	Very high	94.1	Very high	90 Å²	90	70.2 Å²	70.2	42%	0.417	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.4	141	-177.5	-60.7	110.9	0	0	0	111.9	I54 V55 L60 P126 K127	I54-H58 CarbonylContact C-O 3.6Å; I54-H58 WeakPolarHBondContact CA-O 3.43Å; V55-H58 PolarHBondContact N-O 3.42Å; V55-H58 WeakPolarHBondContact O-CB 3.49Å; V55-H58 PolarHBondContact O-N 3.05Å; H58-L60 HydrophobicContact CB-CD1 4.36Å; H58-P126 HydrophobicContact CB-CB 3.79Å; H58-K127 CarbonylContact C-O 3.57Å; H58-K127 VanDerWaalsContact CA-O 3.32Å; H58-K127 WeakPolarHBondContact CA-O 3.12Å
59	I	94.8	Very high	94.2	Very high	31 Å²	31	70.9 Å²	70.9	16%	0.159	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	130.6	168	-174.4	169.1	0	0	0	109.6	V52 I54 Y61 K127 I129	V52-I59 HydrophobicContact CG1-CD1 3.63Å; V52-I59 HydrophobicContact CG1-CG1 3.62Å; I54-I59 HydrophobicContact CG1-CG1 4.43Å; I59-Y61 HydrophobicContact CD1-CE1 4.42Å; I59-Y61 HydrophobicContact CD1-CE2 4.04Å; I59-Y61 WeakPolarHBondContact CD1-OH 3.35Å; I59-Y61 HydrophobicContact CG1-CE2 4.01Å; I59-Y61 HydrophobicContact CG2-CE2 4.24Å; I59-K127 HydrophobicContact CG2-CB 3.79Å; I59-K127 WeakPolarHBondContact CG2-O 3.03Å; I59-K127 PolarHBondContact N-O 3.4Å; I59-K127 PolarHBondContact O-N 2.9Å; I59-I129 HydrophobicContact CB-CD1 4.44Å; I59-I129 HydrophobicContact CB-CG1 4.1Å; I59-I129 HydrophobicContact CG2-CG1 4.18Å
60	L	95.2	Very high	94.3	Very high	14 Å²	14	72.7 Å²	72.7	7%	0.073	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	127.4	177.2	-60.8	92.3	0	0	0	109.1	L23 V52 L53 V55 H58 F122 P126	L23-L60 HydrophobicContact CD2-CD2 4.49Å; V52-L60 WeakPolarHBondContact CA-O 3.2Å; L53-L60 HydrophobicContact CB-CB 4.39Å; L53-L60 PolarHBondContact N-O 3.26Å; L53-L60 PolarHBondContact O-N 3.26Å; V55-L60 HydrophobicContact CG2-CD1 4.22Å; H58-L60 HydrophobicContact CB-CD1 4.36Å; L60-F122 HydrophobicContact CB-CB 4.29Å; L60-F122 HydrophobicContact CB-CD1 3.79Å; L60-F122 HydrophobicContact CB-CG 4.36Å; L60-F122 HydrophobicContact CD2-CB 4.11Å; L60-P126 HydrophobicContact CD1-CB 4.45Å; L60-P126 HydrophobicContact CD2-CG 4.09Å; L60-P126 HydrophobicContact CG-CB 4.2Å; L60-P126 HydrophobicContact CG-CG 4.33Å
61	Y	95	Very high	94.2	Very high	113 Å²	113	73.7 Å²	73.7	44%	0.443	37%	0.365	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.5	123.7	173.4	-65.9	-89.9	0	0	0	108.6	V52 I59 T124 K127	V52-Y61 HydrophobicContact CG1-CE1 4.43Å; V52-Y61 HydrophobicContact CG2-CD1 3.89Å; V52-Y61 HydrophobicContact CG2-CE1 4.05Å; I59-Y61 HydrophobicContact CD1-CE1 4.42Å; I59-Y61 HydrophobicContact CD1-CE2 4.04Å; I59-Y61 WeakPolarHBondContact CD1-OH 3.35Å; I59-Y61 HydrophobicContact CG1-CE2 4.01Å; I59-Y61 HydrophobicContact CG2-CE2 4.24Å; Y61-T124 PolarHBondContact O-OG1 3.28Å; Y61-T124 VanDerWaalsContact O-OG1 3.07Å; Y61-K127 HydrophobicContact CE2-CD 4.34Å
62	G	96	Very high	94	Very high	12 Å²	12	76 Å²	76	12%	0.124	38%	0.384	C	S	.	.			trans	-115.3	-177.5	-177.6	0	0	0	0	0	113.3	P51 I121 F122	P51-G62 WeakPolarHBondContact CD-O 3.44Å; P51-G62 WeakPolarHBondContact O-CA 3.43Å; P51-G62 PolarHBondContact O-N 2.89Å; G62-I121 CarbonylContact C-O 3.59Å; G62-I121 WeakPolarHBondContact CA-O 3.12Å; G62-F122 VanDerWaalsContact CA-CD1 3.43Å
63	K	95.7	Very high	93.9	Very high	133 Å²	133	77.1 Å²	77.1	58%	0.578	39%	0.391	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-138.6	141.6	173.4	-178.9	176.4	178.6	178.4	0	109.8	V65 I121	K63-V65 HydrophobicContact CD-CG2 4.39Å; K63-V65 HydrophobicContact CG-CG2 4.23Å; K63-I121 PolarHBondContact N-O 3.18Å; K63-I121 PolarHBondContact O-N 3.28Å
64	Q	95.8	Very high	93.7	Very high	77 Å²	77	80.6 Å²	80.6	36%	0.36	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.4	132.5	168.6	-173.2	173.9	-72.3	0	0	110.5	K119 L120	Q64-K119 WeakPolarHBondContact CA-O 3.38Å; Q64-L120 HydrophobicContact CB-CD2 3.83Å; Q64-L120 HydrophobicContact CG-CD2 3.89Å
65	V	96.4	Very high	93.6	Very high	46 Å²	46	81.3 Å²	81.3	28%	0.279	42%	0.416	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.8	130.6	-179.9	179.9	0	0	0	0	109.6	K63 R118 K119 I121	K63-V65 HydrophobicContact CD-CG2 4.39Å; K63-V65 HydrophobicContact CG-CG2 4.23Å; V65-R118 CarbonylContact O-C 3.59Å; V65-R118 WeakPolarHBondContact O-CA 3.29Å; V65-K119 HydrophobicContact CB-CG 4.28Å; V65-K119 PolarHBondContact N-O 3.07Å; V65-K119 PolarHBondContact O-N 3.06Å; V65-I121 HydrophobicContact CB-CD1 4.03Å; V65-I121 HydrophobicContact CG2-CD1 3.6Å; V65-I121 HydrophobicContact CG2-CG1 4.36Å
66	K	96.8	Very high	93.7	Very high	168 Å²	168	84.9 Å²	84.9	73%	0.73	43%	0.428	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77.3	131.3	169.2	-174.1	-179.7	177.9	-175.9	0	108.8
67	L	95.9	Very high	93.7	Very high	21 Å²	21	86.1 Å²	86.1	11%	0.11	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.6	128.8	177.9	-63.6	173.5	0	0	0	109.6	K69 F71 I116 K117 K119	L67-K69 VanDerWaalsContact C-N 3.26Å; L67-F71 HydrophobicContact CD1-CD2 3.9Å; L67-F71 HydrophobicContact CD1-CE2 3.94Å; L67-F71 HydrophobicContact CD1-CG 4.47Å; L67-I116 HydrophobicContact CD1-CG2 3.84Å; L67-K117 WeakPolarHBondContact CB-O 3.5Å; L67-K117 PolarHBondContact N-O 2.92Å; L67-K119 HydrophobicContact CD2-CD 3.85Å; L67-K119 HydrophobicContact CD2-CG 3.91Å
68	E	94.8	Very high	93.6	Very high	195 Å²	195	83.4 Å²	83.4	91%	0.911	42%	0.415	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-65.2	-35.4	171.1	-66.3	-179.6	177.1	0	0	111.3
69	K	92.6	Very high	92.6	Very high	169 Å²	169	81.2 Å²	81.2	74%	0.735	42%	0.417	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-119.3	101.1	175.4	-64.3	-178.8	-177.1	175.9	0	108.5	L67	L67-K69 VanDerWaalsContact C-N 3.26Å
70	P	93.4	Very high	90.8	Very high	77 Å²	77	87.5 Å²	87.5	50%	0.5	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-58.8	152	176.3	-24.7	34.9	0	0	0	112	I116 K117	P70-I116 CarbonylContact C-O 3.43Å; P70-I116 WeakPolarHBondContact CA-O 3.49Å; P70-I116 WeakPolarHBondContact CB-O 3.49Å; P70-K117 HydrophobicContact CB-CG 4.23Å; P70-K117 HydrophobicContact CG-CG 4.41Å
71	F	93.3	Very high	88.8	Confident	103 Å²	103	91.4 Å²	91.4	45%	0.452	47%	0.473	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.4	145	173.3	-53.4	-41.3	0	0	0	110.8	L20 L67 L115 I116	L20-F71 HydrophobicContact CD2-CD2 4.31Å; L20-F71 HydrophobicContact CD2-CE2 4.09Å; L67-F71 HydrophobicContact CD1-CD2 3.9Å; L67-F71 HydrophobicContact CD1-CE2 3.94Å; L67-F71 HydrophobicContact CD1-CG 4.47Å; F71-L115 CarbonylContact O-C 3.59Å; F71-L115 WeakPolarHBondContact O-CA 3.47Å; F71-I116 HydrophobicContact CB-CB 4.18Å; F71-I116 PolarHBondContact N-O 2.85Å; F71-I116 PolarHBondContact O-N 3.48Å
72	A	92.4	Very high	86.9	Confident	47 Å²	47	95 Å²	95	39%	0.388	50%	0.495	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.6	131	165.3	0	0	0	0	0	108.4	L74 V112 L115	A72-L74 HydrophobicContact CB-CD2 4.38Å; A72-V112 HydrophobicContact CB-CG1 4.48Å; A72-L115 HydrophobicContact CB-CD2 4.01Å
73	V	93.9	Very high	84.6	Confident	37 Å²	37	100.9 Å²	100.9	22%	0.224	52%	0.523	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87	119.7	171.9	-176.8	0	0	0	0	107.4	W18 V112 S113 A114 I116	W18-V73 HydrophobicContact CE3-CG1 4.47Å; W18-V73 HydrophobicContact CE3-CG2 3.97Å; W18-V73 HydrophobicContact CH2-CG1 4.49Å; W18-V73 HydrophobicContact CZ3-CB 4.45Å; W18-V73 HydrophobicContact CZ3-CG1 3.91Å; W18-V73 HydrophobicContact CZ3-CG2 4.23Å; V73-V112 CarbonylContact O-C 3.56Å; V73-V112 WeakPolarHBondContact O-CA 3.45Å; V73-S113 PolarHBondContact O-N 2.86Å; V73-A114 HydrophobicContact CB-CB 4.22Å; V73-A114 HydrophobicContact CG2-CB 4.15Å; V73-A114 PolarHBondContact N-O 2.93Å; V73-I116 HydrophobicContact CG2-CD1 3.62Å; V73-I116 HydrophobicContact CG2-CG1 4Å
74	L	92.4	Very high	82	Confident	84 Å²	84	100.6 Å²	100.6	44%	0.44	53%	0.532	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.1	128.7	-179.5	-56.5	-179	0	0	0	109.8	A72 Y110 S111 V112	A72-L74 HydrophobicContact CB-CD2 4.38Å; L74-Y110 HydrophobicContact CB-CD1 4.39Å; L74-S111 CarbonylContact C-O 3.58Å; L74-S111 WeakPolarHBondContact CA-O 3.29Å; L74-V112 HydrophobicContact CD2-CB 4.46Å; L74-V112 HydrophobicContact CD2-CG2 3.74Å
75	T	92.4	Very high	79.6	Confident	59 Å²	59	105.4 Å²	105.4	36%	0.362	56%	0.561	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-98.5	122.2	168.7	-66.3	0	0	0	0	108.7	Y110 S111 S113	T75-Y110 CarbonylContact O-C 3.56Å; T75-Y110 VanDerWaalsContact O-CA 3.29Å; T75-Y110 WeakPolarHBondContact O-CA 3.05Å; T75-S111 PolarHBondContact N-O 2.87Å; T75-S111 PolarHBondContact O-N 2.89Å; T75-S113 WeakPolarHBondContact CB-OG 3.34Å; T75-S113 PolarHBondContact OG1-OG 2.81Å
76	K	92.2	Very high	77.3	Confident	113 Å²	113	107.3 Å²	107.3	49%	0.491	58%	0.581	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-81	132.8	175.6	-174.8	-179.2	177.7	-175.7	0	109.7	T108 Y110	K76-T108 HydrophobicContact CD-CG2 4.27Å; K76-T108 VanDerWaalsContact CE-CG2 3.42Å; K76-T108 HydrophobicContact CG-CG2 3.99Å; K76-Y110 HydrophobicContact CB-CD1 3.82Å; K76-Y110 HydrophobicContact CB-CE1 3.51Å; K76-Y110 HydrophobicContact CD-CE1 4.02Å; K76-Y110 HydrophobicContact CG-CD1 4.15Å; K76-Y110 HydrophobicContact CG-CE1 3.55Å
77	H	89.5	Confident	74.9	Confident	81 Å²	81	104.2 Å²	104.2	38%	0.375	59%	0.587	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-112.2	114.6	170.9	-56.1	-76	0	0	0	108.3	S109 S111	H77-S109 WeakPolarHBondContact CB-OG 3.47Å; H77-S109 PolarHBondContact N-O 2.85Å; H77-S109 PolarHBondContact O-N 3.46Å; H77-S111 PolarHBondContact NE2-OG 3.16Å
78	S	86.9	Confident	72.6	Confident	82 Å²	82	106.9 Å²	106.9	57%	0.573	62%	0.619	S	S	*	*			trans	-89.4	121.8	171.2	-57.6	0	0	0	0	107.6	H80	S78-H80 PolarHBondContact O-N 2.67Å
79	G	68.8	Low	70	Confident	43 Å²	43	105.2 Å²	105.2	44%	0.443	62%	0.617	S	S	.	*			trans	-72.5	57.6	178.5	0	0	0	0	0	113.6
80	H	57	Low	68.1	Low	164 Å²	164	105.1 Å²	105.1	76%	0.759	62%	0.623	S	S	*	*			trans	-98.8	111.3	168.2	-148	62.6	0	0	0	107.4	S78 Q82	S78-H80 PolarHBondContact O-N 2.67Å; H80-Q82 PolarHBondContact O-N 2.88Å
81	S	53.3	Low	66	Low	95 Å²	95	105.9 Å²	105.9	66%	0.664	64%	0.636	S	S	*	*			trans	-49.3	110.3	172.3	42.4	0	0	0	0	110	D83	S81-D83 PolarHBondContact O-N 2.85Å
82	Q	55.8	Low	64.1	Low	190 Å²	190	109.7 Å²	109.7	89%	0.888	66%	0.657	S	S	*	*			trans	-72.1	99.5	157.4	-87.5	-177.6	-5.6	0	0	106.7	H80	H80-Q82 PolarHBondContact O-N 2.88Å
83	D	46.3	Very low	62	Low	135 Å²	135	117 Å²	117	72%	0.722	68%	0.683	S	S	*	*			trans	-135.5	116.8	159	-82.8	-40.2	0	0	0	109.3	S81	S81-D83 PolarHBondContact O-N 2.85Å
84	T	42.5	Very low	59.7	Low	126 Å²	126	120.8 Å²	120.8	77%	0.773	71%	0.706	S	S	*	*			trans	70.5	104	151.5	60.8	0	0	0	0	120.8	A86	T84-A86 PolarHBondContact O-N 2.77Å
85	D	45.9	Very low	58.1	Low	178 Å²	178	124.8 Å²	124.8	95%	0.952	73%	0.728	S	S	*	*			trans	-63	101.8	139.5	-74.1	-48.4	0	0	0	109.4
86	A	47	Very low	55.8	Low	86 Å²	86	130.4 Å²	130.4	71%	0.711	75%	0.751	S	S	*	*			trans	-164.1	112	151.8	0	0	0	0	0	110.6	T84	T84-A86 PolarHBondContact O-N 2.77Å
87	A	46.8	Very low	53.9	Low	104 Å²	104	135.1 Å²	135.1	86%	0.86	77%	0.774	S	S	*	*			trans	43.8	103.6	153.5	0	0	0	0	0	119
88	G	47.4	Very low	51.5	Low	76 Å²	76	133.7 Å²	133.7	78%	0.784	78%	0.782	S	S	*	*			trans	37.3	113.4	140.3	0	0	0	0	0	119.6
89	D	40.1	Very low	49.9	Very low	161 Å²	161	136.5 Å²	136.5	86%	0.861	80%	0.798	S	S	*	*			trans	-152.6	135.1	134	-131.5	-38.4	0	0	0	111	A91	D89-A91 PolarHBondContact O-N 2.68Å
90	I	52.6	Low	48.4	Very low	166 Å²	166	139.3 Å²	139.3	85%	0.851	81%	0.811	S	S	*	*			trans	-85.9	107.3	176.6	-64.7	167	0	0	0	106
91	A	48.7	Very low	48.1	Very low	94 Å²	94	137.4 Å²	137.4	78%	0.777	82%	0.816	S	S	*	*			trans	-110	106.6	172.3	0	0	0	0	0	110.1	D89	D89-A91 PolarHBondContact O-N 2.68Å
92	M	53.7	Low	47.8	Very low	183 Å²	183	137.5 Å²	137.5	90%	0.901	82%	0.817	S	S	*	*			trans	-58.9	127.7	173.7	-138.7	178.1	-149.6	0	0	110.3	T94	M92-T94 PolarHBondContact O-N 2.81Å
93	E	48.6	Very low	47.4	Very low	199 Å²	199	133.6 Å²	133.6	93%	0.93	81%	0.81	S	S	*	*			trans	-71.5	119.4	166.8	-78	-171.9	148.1	0	0	109.1
94	T	46.7	Very low	47.9	Very low	117 Å²	117	132.7 Å²	132.7	72%	0.718	82%	0.815	S	S	*	*			trans	-111.1	119.8	164.9	175.6	0	0	0	0	108.1	M92 Q96	M92-T94 PolarHBondContact O-N 2.81Å; T94-Q96 PolarHBondContact O-N 2.81Å
95	D	57.3	Low	48.7	Very low	168 Å²	168	131.5 Å²	131.5	90%	0.898	81%	0.811	S	S	*	*			trans	-61.1	109.5	178.2	-82.5	-47.9	0	0	0	110.9
96	Q	44.5	Very low	49.7	Very low	178 Å²	178	126.5 Å²	126.5	83%	0.832	79%	0.791	S	S	*	*			trans	-134.1	113.6	160.2	-75.3	-168.9	63.9	0	0	111.3	T94	T94-Q96 PolarHBondContact O-N 2.81Å
97	Q	51.9	Low	51.2	Low	211 Å²	211	126.8 Å²	126.8	99%	0.986	79%	0.787	S	S	*	*			trans	-64.7	123.4	173	-90.5	155.5	-12.4	0	0	112.3
98	G	39.8	Very low	53.2	Low	52 Å²	52	125.1 Å²	125.1	54%	0.536	77%	0.766	S	S	.	*			trans	-158.5	145.1	160.5	0	0	0	0	0	109.4	S100	G98-S100 PolarHBondContact O-N 3.5Å
99	P	52.6	Low	55.1	Low	141 Å²	141	124.4 Å²	124.4	92%	0.916	75%	0.75	S	S	*	*			trans	-82.5	69.3	-177.8	35.2	-32.2	0	0	0	109.5	S101	P99-S101 PolarHBondContact O-N 3.25Å
100	S	39.1	Very low	57.5	Low	102 Å²	102	123.5 Å²	123.5	71%	0.713	74%	0.735	S	S	*	*			trans	-88.1	100.7	166.9	45.8	0	0	0	0	108.5	G98 S102	G98-S100 PolarHBondContact O-N 3.5Å; S100-S102 VanDerWaalsContact C-N 3.27Å; S100-S102 PolarHBondContact O-N 2.95Å
101	S	49.2	Very low	59.3	Low	123 Å²	123	117.9 Å²	117.9	86%	0.86	71%	0.711	S	S	*	*			trans	-66.9	74.7	177.6	55.7	0	0	0	0	112.7	P99	P99-S101 PolarHBondContact O-N 3.25Å
102	S	48.1	Very low	61.3	Low	98 Å²	98	115.3 Å²	115.3	69%	0.685	69%	0.685	S	S	*	*			trans	-151.6	58.2	158.8	65.5	0	0	0	0	110	S100 S104	S100-S102 VanDerWaalsContact C-N 3.27Å; S100-S102 PolarHBondContact O-N 2.95Å; S102-S104 PolarHBondContact O-N 2.79Å
103	S	47.8	Very low	63.1	Low	107 Å²	107	108.1 Å²	108.1	75%	0.748	65%	0.653	S	S	*	*			trans	-56	99.8	150.8	56.5	0	0	0	0	105.8	S105	S103-S105 PolarHBondContact O-N 2.88Å
104	S	56	Low	65.2	Low	117 Å²	117	98.7 Å²	98.7	82%	0.818	61%	0.609	S	S	*	*			trans	-63.9	77.3	172.5	46.7	0	0	0	0	107.6	S102 S106	S102-S104 PolarHBondContact O-N 2.79Å; S104-S106 VanDerWaalsContact C-N 3.35Å; S104-S106 PolarHBondContact O-N 3.06Å
105	S	58.1	Low	67.5	Low	100 Å²	100	95.1 Å²	95.1	70%	0.699	59%	0.585	S	S	*	*			trans	-61.1	102.5	174.7	58	0	0	0	0	105.4	S103 S107	S103-S105 PolarHBondContact O-N 2.88Å; S105-S107 VanDerWaalsContact C-N 3.35Å; S105-S107 PolarHBondContact O-N 2.8Å
106	S	67.2	Low	69.3	Low	74 Å²	74	87.9 Å²	87.9	52%	0.517	55%	0.546	S	S	.	.			trans	-55.6	103.6	174.3	51.1	0	0	0	0	107.2	S104 T108	S104-S106 VanDerWaalsContact C-N 3.35Å; S104-S106 PolarHBondContact O-N 3.06Å; S106-T108 PolarHBondContact O-N 3.19Å
107	S	79.4	Confident	71.8	Confident	92 Å²	92	83.6 Å²	83.6	64%	0.643	53%	0.525	S	S	*	.			trans	-70.1	108.8	-176.8	57.5	0	0	0	0	106.9	S105 S109	S105-S107 VanDerWaalsContact C-N 3.35Å; S105-S107 PolarHBondContact O-N 2.8Å; S107-S109 PolarHBondContact O-N 2.9Å
108	T	87.6	Confident	73.9	Confident	68 Å²	68	79.2 Å²	79.2	42%	0.417	50%	0.499	S	S	.	.			trans	-76.6	119.6	173.9	-65.2	0	0	0	0	107.4	K76 S106 Y110	K76-T108 HydrophobicContact CD-CG2 4.27Å; K76-T108 VanDerWaalsContact CE-CG2 3.42Å; K76-T108 HydrophobicContact CG-CG2 3.99Å; S106-T108 PolarHBondContact O-N 3.19Å; T108-Y110 HydrophobicContact CG2-CD2 4.38Å; T108-Y110 HydrophobicContact CG2-CE2 3.61Å
109	S	88.9	Confident	76.6	Confident	62 Å²	62	78.5 Å²	78.5	43%	0.434	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.3	159.4	174.4	64.1	0	0	0	0	110.7	H77 S107	H77-S109 WeakPolarHBondContact CB-OG 3.47Å; H77-S109 PolarHBondContact N-O 2.85Å; H77-S109 PolarHBondContact O-N 3.46Å; S107-S109 PolarHBondContact O-N 2.9Å
110	Y	89.7	Confident	78.8	Confident	141 Å²	141	71.8 Å²	71.8	55%	0.553	44%	0.438	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-130.1	135.3	178.3	-65.2	-95	0	0	0	109.3	L74 T75 K76 T108	L74-Y110 HydrophobicContact CB-CD1 4.39Å; T75-Y110 CarbonylContact O-C 3.56Å; T75-Y110 VanDerWaalsContact O-CA 3.29Å; T75-Y110 WeakPolarHBondContact O-CA 3.05Å; K76-Y110 HydrophobicContact CB-CD1 3.82Å; K76-Y110 HydrophobicContact CB-CE1 3.51Å; K76-Y110 HydrophobicContact CD-CE1 4.02Å; K76-Y110 HydrophobicContact CG-CD1 4.15Å; K76-Y110 HydrophobicContact CG-CE1 3.55Å; T108-Y110 HydrophobicContact CG2-CD2 4.38Å; T108-Y110 HydrophobicContact CG2-CE2 3.61Å
111	S	90.3	Very high	81.5	Confident	49 Å²	49	67.9 Å²	67.9	34%	0.343	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	146.4	169.9	66.3	0	0	0	0	110.7	L74 T75 H77 S113	L74-S111 CarbonylContact C-O 3.58Å; L74-S111 WeakPolarHBondContact CA-O 3.29Å; T75-S111 PolarHBondContact N-O 2.87Å; T75-S111 PolarHBondContact O-N 2.89Å; H77-S111 PolarHBondContact NE2-OG 3.16Å; S111-S113 PolarHBondContact O-N 2.98Å
112	V	91	Very high	83.8	Confident	40 Å²	40	62 Å²	62	24%	0.242	37%	0.368	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.9	113.9	173	-178.3	0	0	0	0	108.3	I6 P15 A72 V73 L74 L115	I6-V112 HydrophobicContact CB-CG2 4.44Å; I6-V112 HydrophobicContact CD1-CG1 4.38Å; I6-V112 HydrophobicContact CD1-CG2 4.22Å; I6-V112 HydrophobicContact CG1-CG2 4.02Å; I6-V112 HydrophobicContact CG2-CB 4.21Å; I6-V112 HydrophobicContact CG2-CG2 3.75Å; P15-V112 HydrophobicContact CB-CG1 4.14Å; P15-V112 HydrophobicContact CG-CB 4.47Å; P15-V112 HydrophobicContact CG-CG1 3.97Å; A72-V112 HydrophobicContact CB-CG1 4.48Å; V73-V112 CarbonylContact O-C 3.56Å; V73-V112 WeakPolarHBondContact O-CA 3.45Å; L74-V112 HydrophobicContact CD2-CB 4.46Å; L74-V112 HydrophobicContact CD2-CG2 3.74Å; V112-L115 HydrophobicContact CG1-CD2 4.44Å
113	S	91.7	Very high	86	Confident	32 Å²	32	63 Å²	63	22%	0.224	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.3	-35.2	-179.7	-59.2	0	0	0	0	112.6	P16 V73 T75 S111	P16-S113 WeakPolarHBondContact CD-O 3.47Å; P16-S113 VanDerWaalsContact CG-O 3.29Å; P16-S113 WeakPolarHBondContact CG-O 3.41Å; V73-S113 PolarHBondContact O-N 2.86Å; T75-S113 WeakPolarHBondContact CB-OG 3.34Å; T75-S113 PolarHBondContact OG1-OG 2.81Å; S111-S113 PolarHBondContact O-N 2.98Å
114	A	93.3	Very high	88.1	Confident	0 Å²	0	61.5 Å²	61.5	0%	0	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-162.4	164.8	-179.1	0	0	0	0	0	112.7	P16 W18 V73	P16-A114 HydrophobicContact CG-CB 4.37Å; P16-A114 CarbonylContact O-C 3.59Å; P16-A114 VanDerWaalsContact O-CA 3.27Å; P16-A114 WeakPolarHBondContact O-CA 3.47Å; P16-A114 WeakPolarHBondContact O-CB 3.33Å; W18-A114 HydrophobicContact CB-CB 4.03Å; W18-A114 HydrophobicContact CD2-CB 3.32Å; W18-A114 VanDerWaalsContact CE2-CB 3.48Å; W18-A114 HydrophobicContact CE3-CB 3.9Å; W18-A114 HydrophobicContact CG-CB 3.38Å; W18-A114 HydrophobicContact CZ2-CB 4.15Å; V73-A114 HydrophobicContact CB-CB 4.22Å; V73-A114 HydrophobicContact CG2-CB 4.15Å; V73-A114 PolarHBondContact N-O 2.93Å
115	L	93.4	Very high	89.8	Confident	43 Å²	43	66.2 Å²	66.2	23%	0.225	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.8	135.5	167.9	-63.2	176.2	0	0	0	110.1	I6 P15 P16 E17 W18 F71 A72 V112	I6-L115 HydrophobicContact CD1-CD2 4.01Å; P15-L115 HydrophobicContact CB-CG 4.39Å; P16-L115 PolarHBondContact O-N 3.47Å; E17-L115 CarbonylContact C-O 3.52Å; E17-L115 VanDerWaalsContact CA-O 3.3Å; E17-L115 WeakPolarHBondContact CA-O 3.44Å; W18-L115 PolarHBondContact N-O 3.25Å; F71-L115 CarbonylContact O-C 3.59Å; F71-L115 WeakPolarHBondContact O-CA 3.47Å; A72-L115 HydrophobicContact CB-CD2 4.01Å; V112-L115 HydrophobicContact CG1-CD2 4.44Å
116	I	96.4	Very high	91.4	Very high	16 Å²	16	63.8 Å²	63.8	8%	0.082	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.4	113.4	177.3	-59.4	170.9	0	0	0	107.9	W18 L20 L67 P70 F71 V73 R118	W18-I116 HydrophobicContact CB-CG1 4.01Å; L20-I116 HydrophobicContact CB-CD1 4.45Å; L20-I116 HydrophobicContact CB-CG2 3.61Å; L67-I116 HydrophobicContact CD1-CG2 3.84Å; P70-I116 CarbonylContact C-O 3.43Å; P70-I116 WeakPolarHBondContact CA-O 3.49Å; P70-I116 WeakPolarHBondContact CB-O 3.49Å; F71-I116 HydrophobicContact CB-CB 4.18Å; F71-I116 PolarHBondContact N-O 2.85Å; F71-I116 PolarHBondContact O-N 3.48Å; V73-I116 HydrophobicContact CG2-CD1 3.62Å; V73-I116 HydrophobicContact CG2-CG1 4Å; I116-R118 WeakPolarHBondContact CG2-O 3.32Å
117	K	96	Very high	92.7	Very high	87 Å²	87	66.2 Å²	66.2	38%	0.378	33%	0.329	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	-15.1	179.9	-57.4	179.5	-164.9	145.7	0	113.2	E17 L67 P70	E17-K117 WeakPolarHBondContact OE2-CD 3.48Å; E17-K117 WeakPolarHBondContact OE2-CE 3.45Å; E17-K117 IonicContact OE2-NZ 2.78Å; E17-K117 PolarHBondContact OE2-NZ 3.13Å; L67-K117 WeakPolarHBondContact CB-O 3.5Å; L67-K117 PolarHBondContact N-O 2.92Å; P70-K117 HydrophobicContact CB-CG 4.23Å; P70-K117 HydrophobicContact CG-CG 4.41Å
118	R	96.9	Very high	93.2	Very high	119 Å²	119	66 Å²	66	45%	0.449	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.7	154.3	-176.5	-59.1	179.3	-171.4	-178.3	2.9	109.8	L19 L20 V65 I116	L19-R118 HydrophobicContact CD1-CB 3.95Å; L20-R118 PolarHBondContact N-O 3.21Å; V65-R118 CarbonylContact O-C 3.59Å; V65-R118 WeakPolarHBondContact O-CA 3.29Å; I116-R118 WeakPolarHBondContact CG2-O 3.32Å
119	K	97.1	Very high	93.4	Very high	37 Å²	37	66 Å²	66	16%	0.161	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.8	149.5	171.4	62.1	172.3	171.1	173	0	112.7	L20 E22 Q64 V65 L67 I121	L20-K119 HydrophobicContact CB-CB 3.87Å; L20-K119 HydrophobicContact CD2-CB 4.15Å; L20-K119 HydrophobicContact CD2-CD 4.38Å; L20-K119 HydrophobicContact CG-CB 4.16Å; L20-K119 CarbonylContact O-C 3.55Å; L20-K119 WeakPolarHBondContact O-CA 3.5Å; L20-K119 WeakPolarHBondContact O-CB 3.33Å; E22-K119 IonicContact OE1-NZ 3.92Å; E22-K119 WeakPolarHBondContact OE2-CD 3.49Å; E22-K119 WeakPolarHBondContact OE2-CE 3.36Å; E22-K119 IonicContact OE2-NZ 2.63Å; E22-K119 PolarHBondContact OE2-NZ 3.38Å; Q64-K119 WeakPolarHBondContact CA-O 3.38Å; V65-K119 HydrophobicContact CB-CG 4.28Å; V65-K119 PolarHBondContact N-O 3.07Å; V65-K119 PolarHBondContact O-N 3.06Å; L67-K119 HydrophobicContact CD2-CD 3.85Å; L67-K119 HydrophobicContact CD2-CG 3.91Å; K119-I121 HydrophobicContact CD-CD1 3.86Å; K119-I121 HydrophobicContact CD-CG1 3.69Å; K119-I121 HydrophobicContact CG-CD1 4.1Å; K119-I121 HydrophobicContact CG-CG1 3.8Å
120	L	97.4	Very high	92.8	Very high	0 Å²	0	69.8 Å²	69.8	0%	0	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96	125.4	164	-52.4	-175	0	0	0	108	L19 L20 V21 E22 L43 P51 Q64 F122	L19-L120 HydrophobicContact CD1-CD2 4.33Å; L19-L120 HydrophobicContact CD1-CG 4.2Å; L19-L120 HydrophobicContact CD2-CD1 3.73Å; L19-L120 HydrophobicContact CD2-CD2 4.2Å; L19-L120 HydrophobicContact CD2-CG 3.76Å; L19-L120 HydrophobicContact CG-CG 4.12Å; L20-L120 PolarHBondContact O-N 2.79Å; V21-L120 HydrophobicContact CG2-CD1 4.41Å; E22-L120 PolarHBondContact N-O 2.83Å; L43-L120 HydrophobicContact CD1-CD1 4.12Å; L43-L120 HydrophobicContact CD2-CD1 3.61Å; L43-L120 HydrophobicContact CG-CD1 4.48Å; P51-L120 HydrophobicContact CB-CD1 4.17Å; P51-L120 HydrophobicContact CB-CD2 4.25Å; P51-L120 HydrophobicContact CG-CD2 4.12Å; Q64-L120 HydrophobicContact CB-CD2 3.83Å; Q64-L120 HydrophobicContact CG-CD2 3.89Å; L120-F122 HydrophobicContact CB-CE2 3.77Å; L120-F122 HydrophobicContact CB-CZ 4.32Å
121	I	96.8	Very high	91.8	Very high	20 Å²	20	68.5 Å²	68.5	10%	0.103	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.6	123.2	-176.8	-57.4	175.4	0	0	0	109.2	E22 G62 K63 V65 K119 K123	E22-I121 HydrophobicContact CB-CG1 4.49Å; G62-I121 CarbonylContact C-O 3.59Å; G62-I121 WeakPolarHBondContact CA-O 3.12Å; K63-I121 PolarHBondContact N-O 3.18Å; K63-I121 PolarHBondContact O-N 3.28Å; V65-I121 HydrophobicContact CB-CD1 4.03Å; V65-I121 HydrophobicContact CG2-CD1 3.6Å; V65-I121 HydrophobicContact CG2-CG1 4.36Å; K119-I121 HydrophobicContact CD-CD1 3.86Å; K119-I121 HydrophobicContact CD-CG1 3.69Å; K119-I121 HydrophobicContact CG-CD1 4.1Å; K119-I121 HydrophobicContact CG-CG1 3.8Å; I121-K123 HydrophobicContact CG2-CB 4.32Å; I121-K123 HydrophobicContact CG2-CD 3.45Å; I121-K123 VanDerWaalsContact CG2-CD 3.45Å; I121-K123 HydrophobicContact CG2-CG 3.46Å; I121-K123 VanDerWaalsContact CG2-CG 3.46Å
122	F	96.6	Very high	90.3	Very high	1 Å²	1	73.1 Å²	73.1	0%	0.004	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	89	173.6	-56.8	-90.5	0	0	0	109.1	V21 E22 L23 Q24 L43 P51 L53 L60 G62 L120	V21-F122 HydrophobicContact CG1-CD2 4.19Å; V21-F122 HydrophobicContact CG1-CE2 3.97Å; E22-F122 PolarHBondContact O-N 3.12Å; L23-F122 HydrophobicContact CD2-CB 4.02Å; L23-F122 HydrophobicContact CD2-CD2 3.89Å; L23-F122 HydrophobicContact CD2-CG 4.16Å; Q24-F122 PolarHBondContact N-O 3.17Å; L43-F122 HydrophobicContact CD1-CZ 3.79Å; P51-F122 HydrophobicContact CB-CE1 4.36Å; P51-F122 HydrophobicContact CB-CZ 4.01Å; P51-F122 HydrophobicContact CG-CZ 4.37Å; L53-F122 HydrophobicContact CB-CD1 3.98Å; L53-F122 HydrophobicContact CB-CE1 3.44Å; L53-F122 VanDerWaalsContact CB-CE1 3.44Å; L53-F122 HydrophobicContact CB-CE2 4.28Å; L53-F122 HydrophobicContact CB-CZ 3.61Å; L53-F122 HydrophobicContact CD2-CD2 4.31Å; L53-F122 HydrophobicContact CD2-CE2 4.23Å; L53-F122 HydrophobicContact CD2-CZ 4.38Å; L60-F122 HydrophobicContact CB-CB 4.29Å; L60-F122 HydrophobicContact CB-CD1 3.79Å; L60-F122 HydrophobicContact CB-CG 4.36Å; L60-F122 HydrophobicContact CD2-CB 4.11Å; G62-F122 VanDerWaalsContact CA-CD1 3.43Å; L120-F122 HydrophobicContact CB-CE2 3.77Å; L120-F122 HydrophobicContact CB-CZ 4.32Å
123	K	94.3	Very high	88.9	Confident	119 Å²	119	77.1 Å²	77.1	52%	0.517	39%	0.388	S	S	.	.			trans	-101.1	-7	-178.7	-78	171.7	179.6	-174.3	0	114	E22 Q24 I121	E22-K123 WeakPolarHBondContact OE1-CE 3.36Å; E22-K123 IonicContact OE1-NZ 3.74Å; Q24-K123 HydrophobicContact CB-CG 4.45Å; Q24-K123 PolarHBondContact OE1-O 2.84Å; I121-K123 HydrophobicContact CG2-CB 4.32Å; I121-K123 HydrophobicContact CG2-CD 3.45Å; I121-K123 VanDerWaalsContact CG2-CD 3.45Å; I121-K123 HydrophobicContact CG2-CG 3.46Å; I121-K123 VanDerWaalsContact CG2-CG 3.46Å
124	T	91.9	Very high	87.1	Confident	74 Å²	74	81.5 Å²	81.5	45%	0.454	42%	0.416	S	S	.	.	S	Bend	trans	-83	150	-178.3	58.6	0	0	0	0	110.4	Y61	Y61-T124 PolarHBondContact O-OG1 3.28Å; Y61-T124 VanDerWaalsContact O-OG1 3.07Å
125	R	91.5	Very high	85.5	Confident	216 Å²	216	90.8 Å²	90.8	82%	0.815	46%	0.456	S	S	*	.	P	Polyproline II helix	trans	-58.4	131.8	176.3	-174.2	176.8	-175.8	-113.9	1.8	109.5	K127	R125-K127 PolarHBondContact O-N 3.29Å
126	P	92.5	Very high	83.7	Confident	50 Å²	50	98.6 Å²	98.6	33%	0.325	49%	0.488	S	S	.	.	P	Polyproline II helix	trans	-56.4	125.9	176.5	-21.3	30.3	0	0	0	110.7	H58 L60	H58-P126 HydrophobicContact CB-CB 3.79Å; L60-P126 HydrophobicContact CD1-CB 4.45Å; L60-P126 HydrophobicContact CD2-CG 4.09Å; L60-P126 HydrophobicContact CG-CB 4.2Å; L60-P126 HydrophobicContact CG-CG 4.33Å
127	K	93.3	Very high	81.8	Confident	124 Å²	124	107.5 Å²	107.5	54%	0.539	54%	0.543	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.7	137.4	177.8	-67.9	-175.5	177.3	-179.7	0	109.3	H58 I59 Y61 R125	H58-K127 CarbonylContact C-O 3.57Å; H58-K127 VanDerWaalsContact CA-O 3.32Å; H58-K127 WeakPolarHBondContact CA-O 3.12Å; I59-K127 HydrophobicContact CG2-CB 3.79Å; I59-K127 WeakPolarHBondContact CG2-O 3.03Å; I59-K127 PolarHBondContact N-O 3.4Å; I59-K127 PolarHBondContact O-N 2.9Å; Y61-K127 HydrophobicContact CE2-CD 4.34Å; R125-K127 PolarHBondContact O-N 3.29Å
128	P	91.6	Very high	81.1	Confident	87 Å²	87	108.6 Å²	108.6	57%	0.565	55%	0.551	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-67.9	142.5	173.8	28.9	-33.5	0	0	0	110.2	I130	P128-I130 PolarHBondContact O-N 2.99Å
129	I	90	Very high	80.2	Confident	70 Å²	70	108 Å²	108	36%	0.359	56%	0.557	S	S	.	*			trans	-82.4	112	170.4	-60.2	171.6	0	0	0	107.6	I54 H57 I59 T131	I54-I129 HydrophobicContact CG2-CD1 3.84Å; H57-I129 PolarHBondContact O-N 3.5Å; I59-I129 HydrophobicContact CB-CD1 4.44Å; I59-I129 HydrophobicContact CB-CG1 4.1Å; I59-I129 HydrophobicContact CG2-CG1 4.18Å; I129-T131 HydrophobicContact CG2-CG2 4.19Å
130	I	78.1	Confident	79.3	Confident	141 Å²	141	111.9 Å²	111.9	72%	0.723	58%	0.579	S	S	*	*			trans	-91.9	111.7	177.5	-55.2	175.7	0	0	0	107.9	P128 N132	P128-I130 PolarHBondContact O-N 2.99Å; I130-N132 HydrophobicContact CG2-CB 4.22Å
131	T	68.7	Low	78.2	Confident	114 Å²	114	118.5 Å²	118.5	70%	0.699	61%	0.613	S	S	*	*			trans	-94.1	4	-179.5	52.7	0	0	0	0	113.7	I129 V133	I129-T131 HydrophobicContact CG2-CG2 4.19Å; T131-V133 PolarHBondContact O-N 3.35Å
132	N	58.7	Low	77.1	Confident	145 Å²	145	124.7 Å²	124.7	78%	0.775	65%	0.645	S	S	*	*			trans	-72.1	78.7	176.1	-79.9	-2.9	0	0	0	110.9	I130 P134	I130-N132 HydrophobicContact CG2-CB 4.22Å; N132-P134 WeakPolarHBondContact O-CD 3.43Å
133	V	60.5	Low	75.8	Confident	125 Å²	125	132.9 Å²	132.9	76%	0.758	69%	0.687	S	S	*	*			trans	-80.1	114.5	154.5	-90.8	0	0	0	0	107.1	T131 K135	T131-V133 PolarHBondContact O-N 3.35Å; V133-K135 PolarHBondContact O-N 2.95Å; V133-K135 VanDerWaalsContact O-N 3.17Å
134	P	53.8	Low	74.5	Confident	123 Å²	123	133.9 Å²	133.9	80%	0.799	70%	0.7	S	S	*	*			trans	-53.4	125.9	171.4	-21.4	31.8	0	0	0	108.5	N132 K136	N132-P134 WeakPolarHBondContact O-CD 3.43Å; P134-K136 PolarHBondContact O-N 2.95Å; P134-K136 VanDerWaalsContact O-N 3.12Å
135	K	59.3	Low	73.1	Confident	195 Å²	195	138.5 Å²	138.5	85%	0.848	72%	0.718	S	S	*	*			trans	-60.6	119.5	167	-70.3	-178.4	179.7	179.5	0	106	V133 V137	V133-K135 PolarHBondContact O-N 2.95Å; V133-K135 VanDerWaalsContact O-N 3.17Å; K135-V137 PolarHBondContact O-N 3.17Å
136	K	57.2	Low	71.6	Confident	208 Å²	208	132.1 Å²	132.1	90%	0.904	71%	0.71	S	S	*	*			trans	-59.2	107.4	169.3	-169.8	175.1	-179.2	-176.7	0	106.2	P134	P134-K136 PolarHBondContact O-N 2.95Å; P134-K136 VanDerWaalsContact O-N 3.12Å
137	V	55.2	Low	69.7	Low	203 Å²	203	139.5 Å²	139.5	100%	1.23	75%	0.745	S	S	*	*			trans	-68.1	0	169.1	-173.5	0	0	0	0	108	K135	K135-V137 PolarHBondContact O-N 3.17Å

Retrieved 137 of 137 residues in 56.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).