A0A087X7L7_POEFO Loading...

Alpha-ketoglutarate dehydrogenase subunit 4

AlphaFold DB , UniProt , Accession A0A087X7L7, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 109 aa.

						>A0A087X7L7_POEFO|A0A087X7L7
MGSKVSSKMAAPTARVIQAVRPHAPLIKFPNRQDIPRPNVQEALKLLGLNVPQHNAPSSASTSSRPQVPLTPSLGTPDSLASVQQLPARYRRRPLTLDEMDYIQRGGPE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.5	Very low	59.2	Low	245 Å²	245	137.5 Å²	137.5	100%	1.207	82%	0.82	S	S	*	*				0	100.3	0	-70.5	154.6	96.8	0	0	106.2
2	G	57.6	Low	59.2	Low	79 Å²	79	136.6 Å²	136.6	81%	0.814	82%	0.82	S	S	*	*				60.9	118	81.1	0	0	0	0	0	109.6
3	S	51	Low	59.5	Low	107 Å²	107	136.2 Å²	136.2	75%	0.748	82%	0.819	S	S	*	*			cis	-162.7	150.7	12.3	39.4	0	0	0	0	108.4
4	K	61.3	Low	59.9	Low	214 Å²	214	132.6 Å²	132.6	93%	0.93	81%	0.812	S	S	*	*			trans	-65.9	126.3	171.5	-55.7	173.8	-177.4	175.5	0	109.1
5	V	59.3	Low	60.4	Low	129 Å²	129	139.4 Å²	139.4	78%	0.782	82%	0.816	S	S	*	*			trans	-124.7	98.4	163.9	-41.1	0	0	0	0	108.7	S7	V5-S7 PolarHBondContact O-N 3.39Å
6	S	62	Low	60.7	Low	99 Å²	99	139.3 Å²	139.3	69%	0.692	82%	0.818	S	S	*	*			trans	-78.5	108.2	168.8	176.6	0	0	0	0	106.7	K8	S6-K8 PolarHBondContact O-N 3.07Å
7	S	60	Low	61.2	Low	108 Å²	108	140.2 Å²	140.2	76%	0.755	82%	0.816	S	S	*	*			trans	-71.8	98.1	171.9	-173.4	0	0	0	0	108.5	V5	V5-S7 PolarHBondContact O-N 3.39Å
8	K	62.8	Low	61.9	Low	187 Å²	187	141.6 Å²	141.6	81%	0.813	81%	0.814	S	S	*	*			trans	-92.6	92.5	166.9	-66.5	-136.3	179.7	-175.7	0	108.1	S6 A10	S6-K8 PolarHBondContact O-N 3.07Å; K8-A10 PolarHBondContact O-N 3.24Å
9	M	61.5	Low	62.6	Low	171 Å²	171	139.3 Å²	139.3	84%	0.842	81%	0.813	S	S	*	*			trans	-75.3	101.5	166.2	-80.4	-92.9	-54.4	0	0	108.5	A11	M9-A11 PolarHBondContact O-N 3.39Å
10	A	64.8	Low	63.6	Low	94 Å²	94	138.3 Å²	138.3	78%	0.777	81%	0.808	S	S	*	*			trans	-76	109.9	166.9	0	0	0	0	0	108.4	K8	K8-A10 PolarHBondContact O-N 3.24Å
11	A	64.4	Low	64.7	Low	80 Å²	80	142.3 Å²	142.3	66%	0.661	81%	0.81	S	S	*	*			trans	-67.7	135.7	171.3	0	0	0	0	0	109.5	M9 T13	M9-A11 PolarHBondContact O-N 3.39Å; A11-T13 PolarHBondContact O-N 2.91Å
12	P	59	Low	66.6	Low	126 Å²	126	136 Å²	136	82%	0.818	79%	0.787	S	S	*	*			trans	-74.1	101.5	174.3	29.4	-29.5	0	0	0	108.3	A14	P12-A14 VanDerWaalsContact C-N 3.33Å; P12-A14 PolarHBondContact O-N 3.04Å
13	T	63.3	Low	68.1	Low	132 Å²	132	140 Å²	140	81%	0.81	79%	0.785	S	S	*	*			trans	-65.1	95.5	167.6	-51.7	0	0	0	0	108.1	A11 R15	A11-T13 PolarHBondContact O-N 2.91Å; T13-R15 PolarHBondContact O-N 3.27Å
14	A	64.5	Low	69.8	Low	86 Å²	86	138.6 Å²	138.6	71%	0.711	78%	0.779	S	S	*	*			trans	-61.3	116.4	176.2	0	0	0	0	0	109.3	P12 V16	P12-A14 VanDerWaalsContact C-N 3.33Å; P12-A14 PolarHBondContact O-N 3.04Å; A14-V16 PolarHBondContact O-N 3.14Å
15	R	67.6	Low	71.1	Confident	234 Å²	234	133.6 Å²	133.6	88%	0.883	77%	0.768	S	S	*	*			trans	-72.6	113.3	174.2	-66	-178.8	-179.3	-174.9	-0.1	108.2	T13 I17	T13-R15 PolarHBondContact O-N 3.27Å; R15-I17 PolarHBondContact O-N 3.17Å; R15-I17 VanDerWaalsContact O-N 3.14Å
16	V	65.2	Low	72.6	Confident	138 Å²	138	134.8 Å²	134.8	84%	0.836	77%	0.77	S	S	*	*			trans	-69.7	105.1	172.5	179	0	0	0	0	107.8	A14 Q18	A14-V16 PolarHBondContact O-N 3.14Å; V16-Q18 PolarHBondContact O-N 3.29Å
17	I	70.1	Confident	73.9	Confident	154 Å²	154	136.7 Å²	136.7	79%	0.79	77%	0.77	S	S	*	*			trans	-81.5	102.8	172.9	-58.6	175.9	0	0	0	106.9	R15 A19	R15-I17 PolarHBondContact O-N 3.17Å; R15-I17 VanDerWaalsContact O-N 3.14Å; I17-A19 PolarHBondContact O-N 3.11Å; I17-A19 VanDerWaalsContact O-N 3.11Å
18	Q	72.9	Confident	75.4	Confident	166 Å²	166	141 Å²	141	78%	0.776	78%	0.776	S	S	*	*			trans	-71.2	104	170.4	-172.3	175.4	-17.3	0	0	108.2	V16 V20	V16-Q18 PolarHBondContact O-N 3.29Å; Q18-V20 PolarHBondContact O-N 3.08Å; Q18-V20 VanDerWaalsContact O-N 3.08Å
19	A	76.3	Confident	76.5	Confident	97 Å²	97	139.9 Å²	139.9	80%	0.802	77%	0.771	S	S	*	*			trans	-70.1	102.8	175.5	0	0	0	0	0	109.5	I17	I17-A19 PolarHBondContact O-N 3.11Å; I17-A19 VanDerWaalsContact O-N 3.11Å
20	V	82.6	Confident	77.8	Confident	119 Å²	119	136.3 Å²	136.3	72%	0.721	76%	0.761	S	S	*	*	P	Polyproline II helix	trans	-82.9	121.5	172.4	179.2	0	0	0	0	108.5	Q18 P22	Q18-V20 PolarHBondContact O-N 3.08Å; Q18-V20 VanDerWaalsContact O-N 3.08Å; V20-P22 WeakPolarHBondContact O-CD 3.44Å
21	R	85.1	Confident	78.8	Confident	224 Å²	224	136.5 Å²	136.5	85%	0.845	75%	0.748	S	S	*	*	P	Polyproline II helix	trans	-70.2	121.8	176.1	-177.1	177.6	177.1	175.7	0.1	109.3
22	P	86.6	Confident	79.7	Confident	111 Å²	111	141.5 Å²	141.5	72%	0.721	75%	0.75	S	S	*	*	P	Polyproline II helix	trans	-64.4	139.5	175.1	26.8	-33.3	0	0	0	110.3	V20 A24	V20-P22 WeakPolarHBondContact O-CD 3.44Å; P22-A24 PolarHBondContact O-N 3.47Å
23	H	88.9	Confident	80.8	Confident	165 Å²	165	143.3 Å²	143.3	76%	0.764	75%	0.748	S	S	*	*	P	Polyproline II helix	trans	-70.8	125.4	178.4	178.8	70.5	0	0	0	110.6
24	A	87.4	Confident	81.6	Confident	76 Å²	76	144 Å²	144	63%	0.628	75%	0.746	S	S	*	*			trans	-92	113.7	172.8	0	0	0	0	0	109.2	P22	P22-A24 PolarHBondContact O-N 3.47Å
25	P	88.4	Confident	82.1	Confident	109 Å²	109	144.6 Å²	144.6	71%	0.708	74%	0.737	S	S	*	*	P	Polyproline II helix	trans	-67.6	146.6	-178.8	28	-34.2	0	0	0	111.3
26	L	91.4	Very high	82.4	Confident	155 Å²	155	138.8 Å²	138.8	81%	0.812	73%	0.73	S	S	*	*	P	Polyproline II helix	trans	-70.2	148.9	174.7	-62.1	175.4	0	0	0	111.1
27	I	89	Confident	82.8	Confident	138 Å²	138	143.5 Å²	143.5	71%	0.708	73%	0.732	S	S	*	*	P	Polyproline II helix	trans	-61.8	139.5	171.4	60.5	171	0	0	0	110.2	F29	I27-F29 HydrophobicContact CD1-CE1 4.48Å; I27-F29 HydrophobicContact CD1-CE2 4.31Å; I27-F29 HydrophobicContact CD1-CZ 3.89Å
28	K	90.8	Very high	82.7	Confident	198 Å²	198	141.1 Å²	141.1	86%	0.861	73%	0.727	S	S	*	*			trans	-104.3	130.7	175.6	-63.4	-179.3	-177.3	178.8	0	109
29	F	87.7	Confident	82.9	Confident	165 Å²	165	137.3 Å²	137.3	72%	0.724	71%	0.712	S	S	*	*	P	Polyproline II helix	trans	-84.5	140.9	172.2	-68	-78.1	0	0	0	110.3	I27	I27-F29 HydrophobicContact CD1-CE1 4.48Å; I27-F29 HydrophobicContact CD1-CE2 4.31Å; I27-F29 HydrophobicContact CD1-CZ 3.89Å
30	P	87.1	Confident	82.7	Confident	95 Å²	95	137.6 Å²	137.6	62%	0.617	70%	0.703	S	S	*	*	P	Polyproline II helix	trans	-59.8	142.4	174.3	-23.5	33.5	0	0	0	111.9	R32	P30-R32 PolarHBondContact O-N 2.94Å
31	N	85.9	Confident	82.4	Confident	98 Å²	98	138.1 Å²	138.1	52%	0.524	70%	0.698	S	S	.	*	P	Polyproline II helix	trans	-66.5	122.7	170.5	-172.2	-7	0	0	0	108.9	Q33	N31-Q33 PolarHBondContact ND2-OE1 2.82Å; N31-Q33 VanDerWaalsContact OD1-CB 3.3Å; N31-Q33 WeakPolarHBondContact OD1-CB 3.46Å; N31-Q33 VanDerWaalsContact OD1-CD 3.26Å; N31-Q33 WeakPolarHBondContact OD1-CG 3.14Å; N31-Q33 PolarHBondContact OD1-N 3.23Å
32	R	83	Confident	81.7	Confident	186 Å²	186	131.8 Å²	131.8	70%	0.702	68%	0.678	S	S	*	*			trans	-102.4	13.7	-178.4	-58.1	-173.4	-179.3	-173	-1	113.2	P30 D34 I35	P30-R32 PolarHBondContact O-N 2.94Å; R32-D34 VanDerWaalsContact C-N 3.33Å; R32-I35 HydrophobicContact CG-CD1 4.43Å; R32-I35 PolarHBondContact O-N 3.38Å
33	Q	82.3	Confident	81	Confident	163 Å²	163	128.6 Å²	128.6	76%	0.762	66%	0.661	S	S	*	*	S	Bend	trans	-64.6	-36.6	-179.6	-74	165.5	11.9	0	0	112.4	N31	N31-Q33 PolarHBondContact ND2-OE1 2.82Å; N31-Q33 VanDerWaalsContact OD1-CB 3.3Å; N31-Q33 WeakPolarHBondContact OD1-CB 3.46Å; N31-Q33 VanDerWaalsContact OD1-CD 3.26Å; N31-Q33 WeakPolarHBondContact OD1-CG 3.14Å; N31-Q33 PolarHBondContact OD1-N 3.23Å
34	D	81	Confident	80.2	Confident	146 Å²	146	123.9 Å²	123.9	78%	0.781	64%	0.641	S	S	*	*	S	Bend	trans	-93	-4.2	-178.9	-51.9	-48.3	0	0	0	113.5	R32 P36	R32-D34 VanDerWaalsContact C-N 3.33Å; D34-P36 WeakPolarHBondContact O-CD 3.42Å
35	I	75.3	Confident	79.4	Confident	100 Å²	100	126.4 Å²	126.4	51%	0.513	64%	0.638	S	S	.	*	S	Bend	trans	-91.6	110.4	179	-58.4	172.9	0	0	0	107.3	R32 R37	R32-I35 HydrophobicContact CG-CD1 4.43Å; R32-I35 PolarHBondContact O-N 3.38Å; I35-R37 PolarHBondContact O-N 3.18Å
36	P	72.5	Confident	78.6	Confident	112 Å²	112	128.9 Å²	128.9	73%	0.727	64%	0.644	S	S	*	*	P	Polyproline II helix	trans	-57.5	129.1	175.5	23.9	-32	0	0	0	108.4	D34 P38	D34-P36 WeakPolarHBondContact O-CD 3.42Å; P36-P38 WeakPolarHBondContact O-CD 3.1Å; P36-P38 VanDerWaalsContact O-N 3.1Å
37	R	73.6	Confident	77.6	Confident	237 Å²	237	127.6 Å²	127.6	89%	0.894	64%	0.637	S	S	*	*	P	Polyproline II helix	trans	-54.1	122.3	176.8	-71.7	-175.1	178.5	-176	0.2	107.5	I35 N39	I35-R37 PolarHBondContact O-N 3.18Å; R37-N39 PolarHBondContact O-N 2.84Å; R37-N39 VanDerWaalsContact O-N 3.13Å
38	P	68.4	Low	76.3	Confident	104 Å²	104	124 Å²	124	68%	0.675	64%	0.635	S	S	*	*	P	Polyproline II helix	trans	-59.7	125.1	179.6	23.2	-31.8	0	0	0	108	P36 V40	P36-P38 WeakPolarHBondContact O-CD 3.1Å; P36-P38 VanDerWaalsContact O-N 3.1Å; P38-V40 PolarHBondContact O-N 2.8Å; P38-V40 VanDerWaalsContact O-N 3.14Å
39	N	76.9	Confident	74.9	Confident	86 Å²	86	119.4 Å²	119.4	46%	0.46	62%	0.619	S	S	.	*	P	Polyproline II helix	trans	-57.9	121.8	174.7	179.6	-2.7	0	0	0	107.3	R37 Q41 E42 A43	R37-N39 PolarHBondContact O-N 2.84Å; R37-N39 VanDerWaalsContact O-N 3.13Å; N39-Q41 PolarHBondContact O-N 3.19Å; N39-Q41 VanDerWaalsContact O-N 3.1Å; N39-Q41 PolarHBondContact OD1-N 3.27Å; N39-Q41 VanDerWaalsContact OD1-N 3.1Å; N39-E42 HydrophobicContact CB-CB 4.3Å; N39-E42 HydrophobicContact CB-CG 4.07Å; N39-E42 PolarHBondContact O-N 3.03Å; N39-A43 PolarHBondContact O-N 3.44Å
40	V	72.5	Confident	73.6	Confident	102 Å²	102	118.6 Å²	118.6	62%	0.618	62%	0.622	S	S	*	*	H	α-helix	trans	-53.2	-36.1	-177.8	-179.3	0	0	0	0	110.2	P38 A43 L44	P38-V40 PolarHBondContact O-N 2.8Å; P38-V40 VanDerWaalsContact O-N 3.14Å; V40-A43 PolarHBondContact O-N 3.3Å; V40-L44 HydrophobicContact CG1-CD1 3.5Å; V40-L44 WeakPolarHBondContact O-CB 3.3Å; V40-L44 WeakPolarHBondContact O-CD1 3.34Å; V40-L44 PolarHBondContact O-N 3.45Å
41	Q	75.9	Confident	72.4	Confident	131 Å²	131	119.3 Å²	119.3	61%	0.612	63%	0.625	S	S	*	*	H	α-helix	trans	-66.2	-41	177.8	-57.8	-168.8	21.6	0	0	113.1	N39 L44 K45	N39-Q41 PolarHBondContact O-N 3.19Å; N39-Q41 VanDerWaalsContact O-N 3.1Å; N39-Q41 PolarHBondContact OD1-N 3.27Å; N39-Q41 VanDerWaalsContact OD1-N 3.1Å; Q41-L44 PolarHBondContact O-N 3.32Å; Q41-K45 VanDerWaalsContact O-CG 3.29Å; Q41-K45 WeakPolarHBondContact O-CG 3.46Å; Q41-K45 PolarHBondContact O-N 3.23Å
42	E	71.1	Confident	71	Confident	90 Å²	90	119.4 Å²	119.4	42%	0.421	63%	0.631	S	S	.	*	H	α-helix	trans	-71.5	-36.6	177	-63.4	-56.3	141.6	0	0	111.3	N39 L44 K45 L46	N39-E42 HydrophobicContact CB-CB 4.3Å; N39-E42 HydrophobicContact CB-CG 4.07Å; N39-E42 PolarHBondContact O-N 3.03Å; E42-L44 PolarHBondContact O-N 3Å; E42-K45 PolarHBondContact O-N 3.12Å; E42-K45 IonicContact OE1-NZ 2.74Å; E42-K45 PolarHBondContact OE1-NZ 3.37Å; E42-K45 IonicContact OE2-NZ 3.68Å; E42-L46 WeakPolarHBondContact O-CG 3.3Å; E42-L46 PolarHBondContact O-N 3.46Å
43	A	72.1	Confident	69.9	Low	45 Å²	45	119.2 Å²	119.2	37%	0.372	64%	0.638	S	S	.	*	H	α-helix	trans	-63.6	-39.7	173.7	0	0	0	0	0	112.2	N39 V40 L46 L47	N39-A43 PolarHBondContact O-N 3.44Å; V40-A43 PolarHBondContact O-N 3.3Å; A43-L46 PolarHBondContact O-N 3.45Å; A43-L47 WeakPolarHBondContact O-CB 3.33Å; A43-L47 PolarHBondContact O-N 3.42Å; A43-L47 VanDerWaalsContact O-N 3.08Å
44	L	72.6	Confident	68.1	Low	65 Å²	65	119.2 Å²	119.2	34%	0.34	64%	0.637	S	S	.	*	H	α-helix	trans	-66	-38.4	173.9	-94.8	112.6	0	0	0	112.6	V40 Q41 E42 L47 G48 L49	V40-L44 HydrophobicContact CG1-CD1 3.5Å; V40-L44 WeakPolarHBondContact O-CB 3.3Å; V40-L44 WeakPolarHBondContact O-CD1 3.34Å; V40-L44 PolarHBondContact O-N 3.45Å; Q41-L44 PolarHBondContact O-N 3.32Å; E42-L44 PolarHBondContact O-N 3Å; L44-L47 CarbonylContact O-C 3.6Å; L44-L47 PolarHBondContact O-N 3.46Å; L44-G48 PolarHBondContact O-N 3.14Å; L44-L49 HydrophobicContact CD2-CB 4.09Å; L44-L49 HydrophobicContact CD2-CD1 4.45Å; L44-L49 PolarHBondContact O-N 3.32Å
45	K	70.6	Confident	66.9	Low	129 Å²	129	119.5 Å²	119.5	56%	0.561	64%	0.639	S	S	*	*	H	α-helix	trans	-62.8	-44.7	174.5	-71.5	170.3	-169.7	174.2	0	111.7	Q41 E42 L47 G48	Q41-K45 VanDerWaalsContact O-CG 3.29Å; Q41-K45 WeakPolarHBondContact O-CG 3.46Å; Q41-K45 PolarHBondContact O-N 3.23Å; E42-K45 PolarHBondContact O-N 3.12Å; E42-K45 IonicContact OE1-NZ 2.74Å; E42-K45 PolarHBondContact OE1-NZ 3.37Å; E42-K45 IonicContact OE2-NZ 3.68Å; K45-L47 PolarHBondContact O-N 3.15Å; K45-G48 PolarHBondContact O-N 2.85Å; K45-G48 VanDerWaalsContact O-N 3.1Å
46	L	70.5	Confident	65.3	Low	161 Å²	161	118.5 Å²	118.5	84%	0.843	65%	0.645	S	S	*	*	H	α-helix	trans	-63.3	-31.5	175.5	-71.7	175	0	0	0	112.6	E42 A43 G48	E42-L46 WeakPolarHBondContact O-CG 3.3Å; E42-L46 PolarHBondContact O-N 3.46Å; A43-L46 PolarHBondContact O-N 3.45Å; L46-G48 PolarHBondContact O-N 2.97Å
47	L	70.5	Confident	64	Low	128 Å²	128	119 Å²	119	67%	0.67	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.6	2.3	177	-158.6	60.3	0	0	0	113.1	A43 L44 K45 L49	A43-L47 WeakPolarHBondContact O-CB 3.33Å; A43-L47 PolarHBondContact O-N 3.42Å; A43-L47 VanDerWaalsContact O-N 3.08Å; L44-L47 CarbonylContact O-C 3.6Å; L44-L47 PolarHBondContact O-N 3.46Å; K45-L47 PolarHBondContact O-N 3.15Å; L47-L49 HydrophobicContact CB-CG 4.39Å; L47-L49 HydrophobicContact CD2-CD1 3.84Å; L47-L49 HydrophobicContact CD2-CG 4.38Å; L47-L49 HydrophobicContact CG-CD1 4.28Å; L47-L49 HydrophobicContact CG-CG 4.27Å; L47-L49 PolarHBondContact O-N 2.92Å
48	G	61.5	Low	62.9	Low	63 Å²	63	113.6 Å²	113.6	65%	0.649	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	67.2	13.8	177.6	0	0	0	0	0	114.6	L44 K45 L46 N50	L44-G48 PolarHBondContact O-N 3.14Å; K45-G48 PolarHBondContact O-N 2.85Å; K45-G48 VanDerWaalsContact O-N 3.1Å; L46-G48 PolarHBondContact O-N 2.97Å; G48-N50 PolarHBondContact O-N 3.25Å; G48-N50 VanDerWaalsContact O-N 3.11Å
49	L	61.1	Low	61.8	Low	101 Å²	101	114.1 Å²	114.1	53%	0.529	65%	0.654	S	S	.	*			trans	-86.3	79.3	-179.7	-63.8	-178.7	0	0	0	109.8	L44 L47 V51	L44-L49 HydrophobicContact CD2-CB 4.09Å; L44-L49 HydrophobicContact CD2-CD1 4.45Å; L44-L49 PolarHBondContact O-N 3.32Å; L47-L49 HydrophobicContact CB-CG 4.39Å; L47-L49 HydrophobicContact CD2-CD1 3.84Å; L47-L49 HydrophobicContact CD2-CG 4.38Å; L47-L49 HydrophobicContact CG-CD1 4.28Å; L47-L49 HydrophobicContact CG-CG 4.27Å; L47-L49 PolarHBondContact O-N 2.92Å; L49-V51 PolarHBondContact O-N 3.44Å
50	N	61.9	Low	60.1	Low	149 Å²	149	114.8 Å²	114.8	80%	0.797	67%	0.671	S	S	*	*			trans	-74	101.8	166.3	-169.2	34.7	0	0	0	108.6	G48 P52	G48-N50 PolarHBondContact O-N 3.25Å; G48-N50 VanDerWaalsContact O-N 3.11Å; N50-P52 WeakPolarHBondContact O-CD 3.35Å
51	V	60.9	Low	59.2	Low	110 Å²	110	115.7 Å²	115.7	67%	0.667	68%	0.682	S	S	*	*			trans	-79.5	114.8	170.5	179.3	0	0	0	0	107.4	L49 Q53	L49-V51 PolarHBondContact O-N 3.44Å; V51-Q53 PolarHBondContact O-N 3.18Å
52	P	57.4	Low	58	Low	100 Å²	100	115.4 Å²	115.4	65%	0.649	69%	0.689	S	S	*	*			trans	-70.6	122.2	178.1	25.3	-26.6	0	0	0	109.4	N50 H54	N50-P52 WeakPolarHBondContact O-CD 3.35Å; P52-H54 PolarHBondContact O-N 2.87Å
53	Q	58.7	Low	57.1	Low	182 Å²	182	117 Å²	117	85%	0.85	71%	0.71	S	S	*	*			trans	-69.5	96.9	167.8	-174.7	159.2	-41.6	0	0	108.1	V51 N55	V51-Q53 PolarHBondContact O-N 3.18Å; Q53-N55 PolarHBondContact O-N 3.33Å
54	H	44.5	Very low	55.9	Low	162 Å²	162	120.2 Å²	120.2	75%	0.75	73%	0.73	S	S	*	*			trans	-76.5	109.6	179.5	80.4	-83	0	0	0	109.8	P52	P52-H54 PolarHBondContact O-N 2.87Å
55	N	56.6	Low	55.2	Low	152 Å²	152	126.8 Å²	126.8	81%	0.813	75%	0.75	S	S	*	*			trans	-103.9	103.5	155.1	-92.7	46.8	0	0	0	106.2	Q53	Q53-N55 PolarHBondContact O-N 3.33Å
56	A	41.5	Very low	54.2	Low	79 Å²	79	125.2 Å²	125.2	65%	0.653	75%	0.753	S	S	*	*			trans	-137.2	138.4	170.7	0	0	0	0	0	110.1
57	P	46	Very low	53.5	Low	122 Å²	122	126.6 Å²	126.6	79%	0.792	76%	0.755	S	S	*	*			trans	-76.1	142.5	-176.5	30.7	-32.5	0	0	0	111.7	S59	P57-S59 PolarHBondContact O-N 3.43Å
58	S	50.4	Low	52.8	Low	124 Å²	124	125.3 Å²	125.3	87%	0.867	75%	0.753	S	S	*	*			trans	-53.3	123.1	179.7	-45.3	0	0	0	0	112.2
59	S	43.9	Very low	52.5	Low	116 Å²	116	127.3 Å²	127.3	81%	0.811	75%	0.754	S	S	*	*			trans	-140.1	121	163.4	-78.5	0	0	0	0	110.2	P57	P57-S59 PolarHBondContact O-N 3.43Å
60	A	42.6	Very low	52.4	Low	100 Å²	100	130.5 Å²	130.5	83%	0.826	77%	0.771	S	S	*	*			trans	38.1	117	160	0	0	0	0	0	119.6	T62	A60-T62 PolarHBondContact O-N 2.9Å
61	S	53.1	Low	52.2	Low	121 Å²	121	128.9 Å²	128.9	85%	0.846	77%	0.767	S	S	*	*			trans	-56.4	111.6	168.7	47.1	0	0	0	0	114.6
62	T	49.4	Very low	52.2	Low	125 Å²	125	129.1 Å²	129.1	77%	0.767	77%	0.77	S	S	*	*	S	Bend	trans	-128.9	115.2	139.4	47.8	0	0	0	0	106.1	A60 S64	A60-T62 PolarHBondContact O-N 2.9Å; T62-S64 PolarHBondContact O-N 3.34Å
63	S	53	Low	52.2	Low	123 Å²	123	128.8 Å²	128.8	86%	0.86	77%	0.77	S	S	*	*			trans	-13.4	91	-176.5	59.1	0	0	0	0	114.7	R65	S63-R65 VanDerWaalsContact C-N 3.25Å; S63-R65 PolarHBondContact O-N 2.82Å
64	S	46.9	Very low	52.2	Low	112 Å²	112	129.1 Å²	129.1	78%	0.783	78%	0.777	S	S	*	*			trans	-77	79	177.3	50.7	0	0	0	0	109.1	T62 P66	T62-S64 PolarHBondContact O-N 3.34Å; S64-P66 WeakPolarHBondContact O-CD 3.21Å
65	R	58.1	Low	53.2	Low	203 Å²	203	123.7 Å²	123.7	77%	0.766	77%	0.765	S	S	*	*			trans	-54.6	125.4	150.1	-174.5	175.9	180	175.1	0.7	104.8	S63 Q67	S63-R65 VanDerWaalsContact C-N 3.25Å; S63-R65 PolarHBondContact O-N 2.82Å; R65-Q67 PolarHBondContact O-N 3.47Å
66	P	49.3	Very low	53.9	Low	97 Å²	97	122.5 Å²	122.5	63%	0.63	76%	0.763	S	S	*	*			trans	-53.8	117.9	171	21.6	-29.5	0	0	0	105	S64 V68	S64-P66 WeakPolarHBondContact O-CD 3.21Å; P66-V68 HydrophobicContact CB-CG2 4.47Å; P66-V68 HydrophobicContact CG-CG2 4.42Å; P66-V68 PolarHBondContact O-N 2.69Å
67	Q	55.1	Low	55.4	Low	190 Å²	190	124 Å²	124	89%	0.888	77%	0.766	S	S	*	*			trans	-65.3	82.9	164.4	-67.5	-152.4	-19.7	0	0	104.1	R65 P69	R65-Q67 PolarHBondContact O-N 3.47Å; Q67-P69 WeakPolarHBondContact O-CD 3.43Å
68	V	56.6	Low	56.9	Low	101 Å²	101	123 Å²	123	61%	0.612	75%	0.754	S	S	*	*			trans	-53.9	115.8	168.2	179.4	0	0	0	0	102.2	P66 L70	P66-V68 HydrophobicContact CB-CG2 4.47Å; P66-V68 HydrophobicContact CG-CG2 4.42Å; P66-V68 PolarHBondContact O-N 2.69Å; V68-L70 PolarHBondContact O-N 2.98Å
69	P	56.4	Low	58.5	Low	104 Å²	104	120.3 Å²	120.3	68%	0.675	74%	0.735	S	S	*	*			trans	-50.2	117.7	171.2	-21.5	32.1	0	0	0	104.5	Q67 T71	Q67-P69 WeakPolarHBondContact O-CD 3.43Å; P69-T71 PolarHBondContact O-N 3.22Å
70	L	59	Low	60.4	Low	168 Å²	168	121.5 Å²	121.5	88%	0.88	73%	0.732	S	S	*	*			trans	-61.5	90.8	172.4	-73	164	0	0	0	103.5	V68 P72	V68-L70 PolarHBondContact O-N 2.98Å; L70-P72 WeakPolarHBondContact O-CD 3.39Å
71	T	57.4	Low	62.4	Low	116 Å²	116	119.3 Å²	119.3	71%	0.712	71%	0.714	S	S	*	*			trans	-52.6	119.3	167.8	33.6	0	0	0	0	103.1	P69 S73	P69-T71 PolarHBondContact O-N 3.22Å; T71-S73 VanDerWaalsContact C-N 3.33Å; T71-S73 PolarHBondContact O-N 3.44Å
72	P	60.2	Low	64	Low	114 Å²	114	115.7 Å²	115.7	74%	0.74	69%	0.689	S	S	*	*			trans	-54.2	112	174.7	20.8	-29.5	0	0	0	104.4	L70 L74	L70-P72 WeakPolarHBondContact O-CD 3.39Å; P72-L74 PolarHBondContact O-N 2.96Å
73	S	57.8	Low	65.9	Low	93 Å²	93	110.8 Å²	110.8	65%	0.65	66%	0.658	S	S	*	*			trans	-52.6	120.9	179.2	53.2	0	0	0	0	104.8	T71 G75	T71-S73 VanDerWaalsContact C-N 3.33Å; T71-S73 PolarHBondContact O-N 3.44Å; S73-G75 PolarHBondContact O-N 3.17Å
74	L	58.3	Low	67.6	Low	189 Å²	189	111.4 Å²	111.4	99%	0.99	65%	0.648	S	S	*	*	S	Bend	trans	-73.3	58.3	-176.2	-152.6	93.1	0	0	0	109.1	P72	P72-L74 PolarHBondContact O-N 2.96Å
75	G	65.2	Low	69.7	Low	48 Å²	48	113.8 Å²	113.8	50%	0.495	65%	0.646	S	S	.	*	S	Bend	trans	-160.9	152.1	-167.7	0	0	0	0	0	109.7	S73	S73-G75 PolarHBondContact O-N 3.17Å
76	T	70.9	Confident	71.2	Confident	127 Å²	127	108 Å²	108	78%	0.779	63%	0.63	S	S	*	*	P	Polyproline II helix	trans	-56	128.5	179.6	-39.8	0	0	0	0	109.1	D78	T76-D78 PolarHBondContact O-N 3.4Å
77	P	73.5	Confident	73.5	Confident	111 Å²	111	106.8 Å²	106.8	72%	0.721	62%	0.622	S	S	*	*	P	Polyproline II helix	trans	-57.7	127.1	176	23.5	-32.5	0	0	0	108.8	S79	P77-S79 PolarHBondContact O-N 3.21Å
78	D	76.8	Confident	75.2	Confident	102 Å²	102	101.1 Å²	101.1	55%	0.545	61%	0.608	S	S	.	*	P	Polyproline II helix	trans	-61	123.1	178.8	-74.1	-27.2	0	0	0	109	T76 R92	T76-D78 PolarHBondContact O-N 3.4Å; D78-R92 IonicContact OD2-CZ 3.16Å; D78-R92 IonicContact OD2-NH1 2.69Å; D78-R92 PolarHBondContact OD2-NH1 2.88Å; D78-R92 IonicContact OD2-NH2 2.82Å; D78-R92 PolarHBondContact OD2-NH2 2.92Å
79	S	85.3	Confident	77.1	Confident	66 Å²	66	106.1 Å²	106.1	46%	0.462	62%	0.616	S	S	.	*			trans	-113.5	153.6	176.7	174.5	0	0	0	0	109.6	P77 A81 S82 V83	P77-S79 PolarHBondContact O-N 3.21Å; S79-A81 PolarHBondContact O-N 3.45Å; S79-A81 VanDerWaalsContact O-N 3.14Å; S79-S82 PolarHBondContact N-OG 2.83Å; S79-S82 PolarHBondContact O-N 3.19Å; S79-S82 PolarHBondContact O-OG 2.96Å; S79-V83 PolarHBondContact O-N 3.26Å; S79-V83 VanDerWaalsContact O-N 3.15Å
80	L	82.9	Confident	78.8	Confident	142 Å²	142	108.5 Å²	108.5	74%	0.743	61%	0.612	S	S	*	*	H	α-helix	trans	-59	-31.8	179.4	-60.6	-151.1	0	0	0	111.8	V83 Q84	L80-V83 PolarHBondContact O-N 3.45Å; L80-Q84 WeakPolarHBondContact O-CG 3.26Å; L80-Q84 PolarHBondContact O-N 2.78Å; L80-Q84 VanDerWaalsContact O-N 3.12Å
81	A	84.9	Confident	80.4	Confident	54 Å²	54	106.2 Å²	106.2	45%	0.446	59%	0.592	S	S	.	*	H	α-helix	trans	-64.8	-39.5	174.8	0	0	0	0	0	112.6	S79 Q84 Q85	S79-A81 PolarHBondContact O-N 3.45Å; S79-A81 VanDerWaalsContact O-N 3.14Å; A81-Q84 PolarHBondContact O-N 2.97Å; A81-Q85 WeakPolarHBondContact O-CG 3.44Å; A81-Q85 PolarHBondContact O-N 2.9Å
82	S	87.4	Confident	82	Confident	45 Å²	45	108.4 Å²	108.4	32%	0.315	59%	0.587	S	S	.	*	H	α-helix	trans	-70.2	-36.9	178.5	67.6	0	0	0	0	111.4	S79 Q84 Q85	S79-S82 PolarHBondContact N-OG 2.83Å; S79-S82 PolarHBondContact O-N 3.19Å; S79-S82 PolarHBondContact O-OG 2.96Å; S82-Q84 VanDerWaalsContact C-N 3.34Å; S82-Q84 PolarHBondContact O-N 2.66Å; S82-Q85 PolarHBondContact O-N 2.68Å
83	V	88.2	Confident	83.3	Confident	22 Å²	22	113.6 Å²	113.6	13%	0.133	59%	0.592	C	S	.	*	H	α-helix	trans	-65.7	-36.6	176.3	179.7	0	0	0	0	111.6	S79 L80 Q85 L86 R91 R92	S79-V83 PolarHBondContact O-N 3.26Å; S79-V83 VanDerWaalsContact O-N 3.15Å; L80-V83 PolarHBondContact O-N 3.45Å; V83-Q85 VanDerWaalsContact C-N 3.27Å; V83-Q85 PolarHBondContact O-N 3.21Å; V83-L86 PolarHBondContact O-N 2.69Å; V83-R91 HydrophobicContact CG1-CB 4.36Å; V83-R91 WeakPolarHBondContact O-CG 3.28Å; V83-R92 HydrophobicContact CG1-CG 4.03Å; V83-R92 HydrophobicContact CG2-CG 4.34Å
84	Q	88.8	Confident	84.7	Confident	136 Å²	136	114.7 Å²	114.7	64%	0.636	60%	0.597	S	S	*	*	H	α-helix	trans	-64.7	-31.1	177.8	-75.9	178.3	1	0	0	113	L80 A81 S82 L86 R91	L80-Q84 WeakPolarHBondContact O-CG 3.26Å; L80-Q84 PolarHBondContact O-N 2.78Å; L80-Q84 VanDerWaalsContact O-N 3.12Å; A81-Q84 PolarHBondContact O-N 2.97Å; S82-Q84 VanDerWaalsContact C-N 3.34Å; S82-Q84 PolarHBondContact O-N 2.66Å; Q84-L86 VanDerWaalsContact C-N 3.29Å; Q84-L86 PolarHBondContact O-N 3.45Å; Q84-R91 PolarHBondContact O-NE 3.1Å; Q84-R91 PolarHBondContact O-NH2 3.14Å
85	Q	91.3	Very high	86.2	Confident	162 Å²	162	110.5 Å²	110.5	76%	0.757	58%	0.575	S	S	*	*	H	α-helix	trans	-71.4	-22.6	178.8	-67.9	169.4	-6.6	0	0	113.1	A81 S82 V83	A81-Q85 WeakPolarHBondContact O-CG 3.44Å; A81-Q85 PolarHBondContact O-N 2.9Å; S82-Q85 PolarHBondContact O-N 2.68Å; V83-Q85 VanDerWaalsContact C-N 3.27Å; V83-Q85 PolarHBondContact O-N 3.21Å
86	L	90.4	Very high	87.5	Confident	80 Å²	80	112.1 Å²	112.1	42%	0.419	58%	0.576	S	S	.	*	S	Bend	trans	-71	149.2	179.8	-64.7	175.6	0	0	0	111.9	V83 Q84 R91	V83-L86 PolarHBondContact O-N 2.69Å; Q84-L86 VanDerWaalsContact C-N 3.29Å; Q84-L86 PolarHBondContact O-N 3.45Å; L86-R91 HydrophobicContact CB-CG 4.35Å; L86-R91 PolarHBondContact O-NE 3.1Å; L86-R91 PolarHBondContact O-NH2 2.96Å
87	P	96	Very high	88.6	Confident	72 Å²	72	112.7 Å²	112.7	47%	0.468	57%	0.573	S	S	.	*			trans	-55.8	146.8	170.7	-24.5	32.8	0	0	0	112.1	R89 Y90 R91	P87-R89 HydrophobicContact CB-CG 4.28Å; P87-R89 PolarHBondContact O-N 2.91Å; P87-Y90 HydrophobicContact CB-CD2 3.92Å; P87-Y90 HydrophobicContact CB-CE2 4.39Å; P87-Y90 HydrophobicContact CG-CD2 4Å; P87-Y90 HydrophobicContact CG-CE2 4.38Å; P87-Y90 PolarHBondContact O-N 3.5Å; P87-R91 PolarHBondContact O-N 2.96Å
88	A	92.2	Very high	89.5	Confident	72 Å²	72	112.9 Å²	112.9	60%	0.595	57%	0.568	S	S	*	*	G	3₁₀ helix	trans	-51.2	-37.8	-173.2	0	0	0	0	0	114.1	Y90 R91	A88-Y90 PolarHBondContact O-N 3.46Å; A88-R91 PolarHBondContact O-N 3.4Å
89	R	95.4	Very high	90.3	Very high	206 Å²	206	112.3 Å²	112.3	78%	0.777	56%	0.562	S	S	*	*	G	3₁₀ helix	trans	-63.2	-16.4	177.6	69.2	-149.8	-67	-171.8	-2	115.1	P87	P87-R89 HydrophobicContact CB-CG 4.28Å; P87-R89 PolarHBondContact O-N 2.91Å
90	Y	93.3	Very high	90.7	Very high	153 Å²	153	112.8 Å²	112.8	60%	0.6	56%	0.558	S	S	*	*	G	3₁₀ helix	trans	-114.4	-0.2	179.8	-55.5	-62	0	0	0	112.9	P87 A88 R92	P87-Y90 HydrophobicContact CB-CD2 3.92Å; P87-Y90 HydrophobicContact CB-CE2 4.39Å; P87-Y90 HydrophobicContact CG-CD2 4Å; P87-Y90 HydrophobicContact CG-CE2 4.38Å; P87-Y90 PolarHBondContact O-N 3.5Å; A88-Y90 PolarHBondContact O-N 3.46Å; Y90-R92 PolarHBondContact O-N 3.13Å
91	R	92.9	Very high	91.2	Very high	120 Å²	120	109.5 Å²	109.5	45%	0.453	54%	0.541	S	S	.	.	P	Polyproline II helix	trans	-76.1	123.4	177.2	-63.9	-170.9	-178.1	116.8	-0.3	109.6	V83 Q84 L86 P87 A88	V83-R91 HydrophobicContact CG1-CB 4.36Å; V83-R91 WeakPolarHBondContact O-CG 3.28Å; Q84-R91 PolarHBondContact O-NE 3.1Å; Q84-R91 PolarHBondContact O-NH2 3.14Å; L86-R91 HydrophobicContact CB-CG 4.35Å; L86-R91 PolarHBondContact O-NE 3.1Å; L86-R91 PolarHBondContact O-NH2 2.96Å; P87-R91 PolarHBondContact O-N 2.96Å; A88-R91 PolarHBondContact O-N 3.4Å
92	R	89.8	Confident	91.7	Very high	162 Å²	162	111.9 Å²	111.9	61%	0.611	54%	0.54	S	S	*	.	P	Polyproline II helix	trans	-73.1	154.9	171.3	51.5	175.9	76.6	150.7	12.4	111.3	D78 V83 Y90	D78-R92 IonicContact OD2-CZ 3.16Å; D78-R92 IonicContact OD2-NH1 2.69Å; D78-R92 PolarHBondContact OD2-NH1 2.88Å; D78-R92 IonicContact OD2-NH2 2.82Å; D78-R92 PolarHBondContact OD2-NH2 2.92Å; V83-R92 HydrophobicContact CG1-CG 4.03Å; V83-R92 HydrophobicContact CG2-CG 4.34Å; Y90-R92 PolarHBondContact O-N 3.13Å
93	R	87.9	Confident	91.9	Very high	223 Å²	223	114.6 Å²	114.6	84%	0.842	55%	0.549	S	S	*	.	P	Polyproline II helix	trans	-79.2	145.7	176.5	-67.6	-71.3	-179.5	151.7	0.1	110.4
94	P	87.1	Confident	92.1	Very high	116 Å²	116	120 Å²	120	75%	0.753	57%	0.573	S	S	*	*	P	Polyproline II helix	trans	-63.3	136.4	168.3	-16.4	30	0	0	0	110.3
95	L	89.7	Confident	92.4	Very high	102 Å²	102	120.3 Å²	120.3	53%	0.534	57%	0.568	S	S	.	*	P	Polyproline II helix	trans	-84.1	134.7	173.1	-79.8	165.6	0	0	0	109.9	E99 M100 I103	L95-E99 HydrophobicContact CD2-CB 4.43Å; L95-E99 HydrophobicContact CD2-CG 3.76Å; L95-M100 HydrophobicContact CB-CG 4.07Å; L95-I103 HydrophobicContact CD2-CD1 3.93Å
96	T	93.8	Very high	92.4	Very high	82 Å²	82	115.9 Å²	115.9	50%	0.503	57%	0.566	S	S	.	*	P	Polyproline II helix	trans	-84.5	158.5	171.4	66.1	0	0	0	0	110.4	D98 E99 M100	T96-D98 VanDerWaalsContact C-N 3.34Å; T96-D98 PolarHBondContact O-N 3.36Å; T96-E99 PolarHBondContact O-N 2.89Å; T96-E99 VanDerWaalsContact OG1-CB 3.3Å; T96-E99 WeakPolarHBondContact OG1-CB 3.48Å; T96-E99 PolarHBondContact OG1-N 3.19Å; T96-M100 WeakPolarHBondContact O-CG 3.38Å; T96-M100 PolarHBondContact O-N 3.11Å
97	L	93.3	Very high	92.3	Very high	138 Å²	138	112.7 Å²	112.7	72%	0.723	55%	0.553	S	S	*	*	H	α-helix	trans	-61	-42.4	179.5	-67.2	177.2	0	0	0	112.3	E99 M100 D101	L97-E99 VanDerWaalsContact C-N 3.31Å; L97-E99 PolarHBondContact O-N 3.2Å; L97-M100 HydrophobicContact CD2-SD 4.16Å; L97-M100 WeakPolarHBondContact O-CB 3.33Å; L97-M100 PolarHBondContact O-N 3.28Å; L97-M100 VanDerWaalsContact O-N 3.17Å; L97-D101 PolarHBondContact O-N 3.1Å
98	D	92.9	Very high	91.9	Very high	116 Å²	116	114 Å²	114	62%	0.62	56%	0.562	S	S	*	*	H	α-helix	trans	-61.1	-40.5	177.1	-176.3	49	0	0	0	112	T96 D101 Y102	T96-D98 VanDerWaalsContact C-N 3.34Å; T96-D98 PolarHBondContact O-N 3.36Å; D98-D101 PolarHBondContact O-N 3.41Å; D98-Y102 WeakPolarHBondContact O-CB 3.19Å; D98-Y102 PolarHBondContact O-N 3.38Å
99	E	92.3	Very high	91.2	Very high	89 Å²	89	122.2 Å²	122.2	42%	0.416	59%	0.588	S	S	.	*	H	α-helix	trans	-66.7	-40.3	175	-173.7	176.2	-172.9	0	0	111.7	L95 T96 L97 D101 Y102 I103	L95-E99 HydrophobicContact CD2-CB 4.43Å; L95-E99 HydrophobicContact CD2-CG 3.76Å; T96-E99 PolarHBondContact O-N 2.89Å; T96-E99 VanDerWaalsContact OG1-CB 3.3Å; T96-E99 WeakPolarHBondContact OG1-CB 3.48Å; T96-E99 PolarHBondContact OG1-N 3.19Å; L97-E99 VanDerWaalsContact C-N 3.31Å; L97-E99 PolarHBondContact O-N 3.2Å; E99-D101 VanDerWaalsContact C-N 3.3Å; E99-D101 PolarHBondContact O-N 3.08Å; E99-Y102 PolarHBondContact O-N 3.26Å; E99-I103 HydrophobicContact CG-CD1 3.87Å; E99-I103 HydrophobicContact CG-CG1 4.42Å; E99-I103 WeakPolarHBondContact O-CB 3.49Å; E99-I103 WeakPolarHBondContact O-CG1 3.45Å; E99-I103 PolarHBondContact O-N 3.2Å
100	M	93.6	Very high	90.9	Very high	77 Å²	77	118.1 Å²	118.1	38%	0.379	58%	0.578	S	S	.	*	H	α-helix	trans	-57.5	-46.3	173.8	-70.1	177	67.5	0	0	110.8	L95 T96 L97 I103 Q104	L95-M100 HydrophobicContact CB-CG 4.07Å; T96-M100 WeakPolarHBondContact O-CG 3.38Å; T96-M100 PolarHBondContact O-N 3.11Å; L97-M100 HydrophobicContact CD2-SD 4.16Å; L97-M100 WeakPolarHBondContact O-CB 3.33Å; L97-M100 PolarHBondContact O-N 3.28Å; L97-M100 VanDerWaalsContact O-N 3.17Å; M100-I103 PolarHBondContact O-N 3.06Å; M100-Q104 WeakPolarHBondContact O-CB 3.12Å; M100-Q104 VanDerWaalsContact O-CG 3.26Å; M100-Q104 WeakPolarHBondContact O-CG 3.32Å; M100-Q104 PolarHBondContact O-N 3.29Å
101	D	94.3	Very high	90.8	Very high	72 Å²	72	116.2 Å²	116.2	39%	0.385	58%	0.577	S	S	.	*	H	α-helix	trans	-69.5	-39.2	-179.4	-60.9	-27.7	0	0	0	111.5	L97 D98 E99 Q104 R105	L97-D101 PolarHBondContact O-N 3.1Å; D98-D101 PolarHBondContact O-N 3.41Å; E99-D101 VanDerWaalsContact C-N 3.3Å; E99-D101 PolarHBondContact O-N 3.08Å; D101-Q104 PolarHBondContact O-N 2.98Å; D101-R105 WeakPolarHBondContact O-CB 3.35Å; D101-R105 VanDerWaalsContact O-CG 3.28Å; D101-R105 WeakPolarHBondContact O-CG 3.29Å; D101-R105 PolarHBondContact O-N 3.26Å
102	Y	94.3	Very high	90.7	Very high	105 Å²	105	116 Å²	116	41%	0.412	58%	0.584	S	S	.	*	H	α-helix	trans	-61.5	-43.4	175.2	-177.1	-94	0	0	0	112.2	D98 E99 Q104 R105 G106 G107 P108	D98-Y102 WeakPolarHBondContact O-CB 3.19Å; D98-Y102 PolarHBondContact O-N 3.38Å; E99-Y102 PolarHBondContact O-N 3.26Å; Y102-Q104 VanDerWaalsContact C-N 3.35Å; Y102-R105 PolarHBondContact O-N 2.74Å; Y102-G106 PolarHBondContact O-N 3.37Å; Y102-G107 VanDerWaalsContact CE2-C 3.4Å; Y102-G107 PolarHBondContact O-N 3.28Å; Y102-P108 HydrophobicContact CE2-CB 4.29Å; Y102-P108 HydrophobicContact CE2-CG 4.34Å; Y102-P108 WeakPolarHBondContact OH-CD 3.43Å; Y102-P108 WeakPolarHBondContact OH-CG 3.49Å
103	I	93	Very high	90.8	Very high	101 Å²	101	113.3 Å²	113.3	52%	0.518	58%	0.582	S	S	.	*	H	α-helix	trans	-64.6	-40.6	175.2	-68.3	167	0	0	0	110.9	L95 E99 M100 G106	L95-I103 HydrophobicContact CD2-CD1 3.93Å; E99-I103 HydrophobicContact CG-CD1 3.87Å; E99-I103 HydrophobicContact CG-CG1 4.42Å; E99-I103 WeakPolarHBondContact O-CB 3.49Å; E99-I103 WeakPolarHBondContact O-CG1 3.45Å; E99-I103 PolarHBondContact O-N 3.2Å; M100-I103 PolarHBondContact O-N 3.06Å; I103-G106 PolarHBondContact O-N 3.04Å
104	Q	92.3	Very high	90.9	Very high	135 Å²	135	106.4 Å²	106.4	63%	0.631	57%	0.566	S	S	*	*	H	α-helix	trans	-68.7	-39.3	178.6	-75.3	-178.7	17.8	0	0	112.7	M100 D101 Y102 G106	M100-Q104 WeakPolarHBondContact O-CB 3.12Å; M100-Q104 VanDerWaalsContact O-CG 3.26Å; M100-Q104 WeakPolarHBondContact O-CG 3.32Å; M100-Q104 PolarHBondContact O-N 3.29Å; D101-Q104 PolarHBondContact O-N 2.98Å; Y102-Q104 VanDerWaalsContact C-N 3.35Å; Q104-G106 VanDerWaalsContact C-N 3.32Å
105	R	93.8	Very high	91.2	Very high	143 Å²	143	105.8 Å²	105.8	54%	0.54	55%	0.553	S	S	.	*	H	α-helix	trans	-69.4	-29.3	175.4	-71.9	-173.2	-55.6	-99.5	-0.8	112.6	D101 Y102	D101-R105 WeakPolarHBondContact O-CB 3.35Å; D101-R105 VanDerWaalsContact O-CG 3.28Å; D101-R105 WeakPolarHBondContact O-CG 3.29Å; D101-R105 PolarHBondContact O-N 3.26Å; Y102-R105 PolarHBondContact O-N 2.74Å
106	G	93.2	Very high	91.3	Very high	69 Å²	69	106.1 Å²	106.1	71%	0.711	56%	0.555	S	S	*	*	T	Hydrogen-bonded Turn	trans	98.3	17	174.8	0	0	0	0	0	115	Y102 I103 Q104	Y102-G106 PolarHBondContact O-N 3.37Å; I103-G106 PolarHBondContact O-N 3.04Å; Q104-G106 VanDerWaalsContact C-N 3.32Å
107	G	88.3	Confident	91.1	Very high	13 Å²	13	107.9 Å²	107.9	13%	0.134	56%	0.559	C	S	.	*	S	Bend	trans	124.4	-166.3	177.9	0	0	0	0	0	113.8	Y102	Y102-G107 VanDerWaalsContact CE2-C 3.4Å; Y102-G107 PolarHBondContact O-N 3.28Å
108	P	87.6	Confident	90.9	Very high	101 Å²	101	105.4 Å²	105.4	66%	0.656	55%	0.545	S	S	*	.			trans	-81.6	152.2	173.4	23.7	-8.2	0	0	0	110.6	Y102	Y102-P108 HydrophobicContact CE2-CB 4.29Å; Y102-P108 HydrophobicContact CE2-CG 4.34Å; Y102-P108 WeakPolarHBondContact OH-CD 3.43Å; Y102-P108 WeakPolarHBondContact OH-CG 3.49Å
109	E	75.6	Confident	90.7	Very high	244 Å²	244	104.5 Å²	104.5	100%	1.14	54%	0.538	S	S	*	.			trans	-72.3	0	173	-57.5	-68.4	140.9	0	0	112.5

Retrieved 109 of 109 residues in 135.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).