A0A087X7N3_POEFO Loading...

Ribosomal protein L37

Component of the large ribosomal subunit. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell.

AlphaFold DB , UniProt , Accession A0A087X7N3, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 97 aa.

						>A0A087X7N3_POEFO|A0A087X7N3
MTKGTSSFGKRRNKTHTLCRRCGAKAYHLQKSSCGKCGYPEKRKRKYNWSAKAKRRNTTGTGRLRHLKVVYRRFRNGFREGTTPKPRRAAVAASSSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	68.2	Low	90.3	Very high	239 Å²	239	121.8 Å²	121.8	100%	1.177	66%	0.655	S	S	*	*				0	86.4	0	-83.4	-79.6	-87.4	0	0	109.5
2	T	87.1	Confident	90.7	Very high	102 Å²	102	129.1 Å²	129.1	63%	0.626	67%	0.667	S	S	*	*			trans	-88.2	132.5	-179.9	38	0	0	0	0	111	S6 S7	T2-S6 WeakPolarHBondContact CB-OG 3.23Å; T2-S6 PolarHBondContact O-OG 3.09Å; T2-S6 PolarHBondContact OG1-OG 3.28Å; T2-S7 PolarHBondContact O-OG 3.48Å
3	K	90.4	Very high	91.1	Very high	203 Å²	203	129.9 Å²	129.9	88%	0.883	67%	0.673	S	S	*	*			trans	-81.9	161.4	172.3	-63.4	176.6	-177.6	173	0	109.6
4	G	91.3	Very high	91.4	Very high	32 Å²	32	130 Å²	130	33%	0.33	67%	0.665	S	S	.	*	S	Bend	trans	85.8	-120	173.3	0	0	0	0	0	113.2	S6 S7 F8	G4-S6 PolarHBondContact O-N 3.1Å; G4-S7 WeakPolarHBondContact O-CA 3.37Å; G4-S7 WeakPolarHBondContact O-CB 3.48Å; G4-S7 PolarHBondContact O-N 3.26Å; G4-F8 WeakPolarHBondContact O-CD2 3.39Å; G4-F8 PolarHBondContact O-N 3.44Å
5	T	93.7	Very high	91.8	Very high	130 Å²	130	125.9 Å²	125.9	80%	0.798	65%	0.649	S	S	*	*	H	α-helix	trans	-50.4	-52.7	-169	-50.9	0	0	0	0	113.3	S7 F8	T5-S7 PolarHBondContact O-N 3.09Å; T5-F8 PolarHBondContact O-N 3.12Å
6	S	93.1	Very high	92.2	Very high	57 Å²	57	123.2 Å²	123.2	40%	0.399	63%	0.632	S	S	.	*	H	α-helix	trans	-61.9	-28.1	177.9	48.2	0	0	0	0	113.7	T2 G4	T2-S6 WeakPolarHBondContact CB-OG 3.23Å; T2-S6 PolarHBondContact O-OG 3.09Å; T2-S6 PolarHBondContact OG1-OG 3.28Å; G4-S6 PolarHBondContact O-N 3.1Å
7	S	92.3	Very high	92.5	Very high	50 Å²	50	118.7 Å²	118.7	35%	0.35	61%	0.612	S	S	.	*	H	α-helix	trans	-81.2	-31.6	177.2	-48.7	0	0	0	0	112.7	T2 G4 T5 G9 K10	T2-S7 PolarHBondContact O-OG 3.48Å; G4-S7 WeakPolarHBondContact O-CA 3.37Å; G4-S7 WeakPolarHBondContact O-CB 3.48Å; G4-S7 PolarHBondContact O-N 3.26Å; T5-S7 PolarHBondContact O-N 3.09Å; S7-G9 VanDerWaalsContact C-N 3.33Å; S7-G9 PolarHBondContact O-N 3.37Å; S7-K10 PolarHBondContact O-N 3.49Å
8	F	93.9	Very high	92.8	Very high	115 Å²	115	119.1 Å²	119.1	50%	0.504	61%	0.614	S	S	.	*	H	α-helix	trans	-63.8	-36.7	-179.1	-72.9	-68.4	0	0	0	112.4	G4 T5 K10 R11	G4-F8 WeakPolarHBondContact O-CD2 3.39Å; G4-F8 PolarHBondContact O-N 3.44Å; T5-F8 PolarHBondContact O-N 3.12Å; F8-K10 PolarHBondContact O-N 3.02Å; F8-K10 VanDerWaalsContact O-N 3.13Å; F8-R11 WeakPolarHBondContact O-CB 3.49Å; F8-R11 WeakPolarHBondContact O-CG 3.46Å; F8-R11 PolarHBondContact O-N 3.46Å; F8-R11 VanDerWaalsContact O-N 3.14Å
9	G	94.4	Very high	93.1	Very high	75 Å²	75	113 Å²	113	77%	0.773	58%	0.584	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.5	-23.7	176.6	0	0	0	0	0	114.2	S7 R11	S7-G9 VanDerWaalsContact C-N 3.33Å; S7-G9 PolarHBondContact O-N 3.37Å; G9-R11 PolarHBondContact O-N 3.47Å
10	K	94.1	Very high	93.3	Very high	172 Å²	172	117.8 Å²	117.8	75%	0.748	59%	0.594	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.4	-1.8	-179.4	-57.3	-173.1	179.5	-175.7	0	113.9	S7 F8 R12	S7-K10 PolarHBondContact O-N 3.49Å; F8-K10 PolarHBondContact O-N 3.02Å; F8-K10 VanDerWaalsContact O-N 3.13Å; K10-R12 VanDerWaalsContact C-N 3.29Å; K10-R12 PolarHBondContact O-N 3.23Å
11	R	94.7	Very high	93.5	Very high	165 Å²	165	116.3 Å²	116.3	62%	0.623	58%	0.581	S	S	*	*			trans	-81.5	57.6	-172.5	-62.8	-176.1	179.5	-166.8	0.9	114.5	F8 G9 K14	F8-R11 WeakPolarHBondContact O-CB 3.49Å; F8-R11 WeakPolarHBondContact O-CG 3.46Å; F8-R11 PolarHBondContact O-N 3.46Å; F8-R11 VanDerWaalsContact O-N 3.14Å; G9-R11 PolarHBondContact O-N 3.47Å; R11-K14 PolarHBondContact O-NZ 2.88Å
12	R	95.6	Very high	94.8	Very high	209 Å²	209	107.4 Å²	107.4	79%	0.789	54%	0.542	S	S	*	.			trans	-87.3	-30.1	179.2	57.4	-177.7	170.7	163.4	-1.4	114.9	K10 K14	K10-R12 VanDerWaalsContact C-N 3.29Å; K10-R12 PolarHBondContact O-N 3.23Å; R12-K14 WeakPolarHBondContact O-CE 3.14Å
13	N	95.1	Very high	95.3	Very high	140 Å²	140	105.1 Å²	105.1	75%	0.749	54%	0.538	S	S	*	.	S	Bend	trans	-79.4	138.7	180	-61.4	-26.2	0	0	0	111.2
14	K	95.6	Very high	95.6	Very high	131 Å²	131	96.5 Å²	96.5	57%	0.57	51%	0.505	S	S	*	.			trans	-106.9	119.5	-178.8	-51.5	-53.8	174.5	-166	0	110.1	R11 R12 L29	R11-K14 PolarHBondContact O-NZ 2.88Å; R12-K14 WeakPolarHBondContact O-CE 3.14Å; K14-L29 WeakPolarHBondContact O-CD1 3.32Å
15	T	97.6	Very high	95.9	Very high	68 Å²	68	101.9 Å²	101.9	42%	0.417	52%	0.519	S	S	.	.	S	Bend	trans	-80.6	-36.6	175.8	-47.1	0	0	0	0	112	H28 L29	T15-H28 WeakPolarHBondContact CG2-CE1 3.31Å; T15-H28 WeakPolarHBondContact CG2-NE2 3.31Å; T15-H28 WeakPolarHBondContact O-CA 3.48Å; T15-L29 PolarHBondContact O-N 3.35Å
16	H	98	Very high	96.1	Very high	83 Å²	83	96.4 Å²	96.4	38%	0.384	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115	131.2	-174.4	-62.7	96.9	0	0	0	112.7	K25 Y27 H28	H16-K25 VanDerWaalsContact O-CE 3.3Å; H16-K25 WeakPolarHBondContact O-CE 3.42Å; H16-Y27 CarbonylContact C-O 3.49Å; H16-Y27 WeakPolarHBondContact CA-O 3.36Å; H16-H28 AromaticContact NE2-CD2 3.87Å
17	T	97.7	Very high	96.3	Very high	47 Å²	47	95.9 Å²	95.9	29%	0.288	48%	0.477	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	179.9	175.9	62.3	0	0	0	0	111.5	K25 A26 Y27 L29	T17-K25 CarbonylContact O-C 3.36Å; T17-K25 VanDerWaalsContact O-CA 3.28Å; T17-K25 WeakPolarHBondContact O-CA 3.45Å; T17-A26 PolarHBondContact O-N 3.19Å; T17-Y27 PolarHBondContact N-O 3.45Å; T17-Y27 WeakPolarHBondContact O-CB 3.41Å; T17-Y27 PolarHBondContact O-N 3.39Å; T17-L29 HydrophobicContact CG2-CD1 3.75Å; T17-L29 HydrophobicContact CG2-CD2 3.71Å; T17-L29 HydrophobicContact CG2-CG 3.79Å
18	L	98.3	Very high	96.6	Very high	125 Å²	125	94.9 Å²	94.9	65%	0.654	47%	0.467	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-66.7	129.9	178.7	-68.4	174.5	0	0	0	111.2	G23 K25	L18-G23 WeakPolarHBondContact CD2-O 3.02Å; L18-K25 HydrophobicContact CD2-CB 4.22Å
19	C	98.1	Very high	96.8	Very high	4 Å²	4	93.3 Å²	93.3	3%	0.027	46%	0.463	C	S	.	.			trans	-85.1	125.8	175.1	177.5	0	0	0	0	111.2	R21 C22 G23 A24 C34	C19-R21 VanDerWaalsContact C-N 3.25Å; C19-R21 PolarHBondContact O-N 2.99Å; C19-R21 PolarHBondContact SG-N 3.44Å; C19-C22 PolarHBondContact O-N 3.36Å; C19-G23 WeakPolarHBondContact O-CA 3.35Å; C19-G23 PolarHBondContact O-N 3.19Å; C19-A24 WeakPolarHBondContact CB-O 3.25Å; C19-A24 PolarHBondContact N-O 3.22Å; C19-C34 HydrophobicContact CB-CB 4.39Å; C19-C34 VanDerWaalsContact SG-SG 3.62Å
20	R	96.9	Very high	96.9	Very high	209 Å²	209	98 Å²	98	79%	0.789	47%	0.465	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.8	-30.4	177.7	-64.7	-168.4	-73.4	-151.1	-1	114.6	Y39	R20-Y39 PolarHBondContact NH2-OH 2.78Å
21	R	97	Very high	97.1	Very high	86 Å²	86	97 Å²	97	33%	0.325	46%	0.461	S	S	.	.	T	Hydrogen-bonded Turn	trans	-82.2	-45	-177.7	-174.5	-173.8	-67	165.7	-2.1	113.5	C19 Y39 P40 E41	C19-R21 VanDerWaalsContact C-N 3.25Å; C19-R21 PolarHBondContact O-N 2.99Å; C19-R21 PolarHBondContact SG-N 3.44Å; R21-Y39 HydrophobicContact CB-CD2 4.17Å; R21-Y39 HydrophobicContact CB-CG 4.44Å; R21-P40 PolarHBondContact NH2-O 3.34Å; R21-E41 PolarHBondContact NH1-O 3.19Å; R21-E41 PolarHBondContact NH2-O 2.92Å
22	C	96.3	Very high	97.2	Very high	52 Å²	52	92.2 Å²	92.2	35%	0.351	45%	0.453	S	S	.	.	T	Hydrogen-bonded Turn	trans	-113.4	-4.9	-170.6	69.4	0	0	0	0	114.5	C19 A24 C37	C19-C22 PolarHBondContact O-N 3.36Å; C22-A24 PolarHBondContact O-N 2.81Å; C22-A24 VanDerWaalsContact O-N 3.08Å; C22-C37 HydrophobicContact CB-CB 3.85Å
23	G	96.4	Very high	97.3	Very high	54 Å²	54	84.5 Å²	84.5	56%	0.557	43%	0.43	S	S	*	.			trans	70.5	-5.2	-179.3	0	0	0	0	0	115.1	L18 C19	L18-G23 WeakPolarHBondContact CD2-O 3.02Å; C19-G23 WeakPolarHBondContact O-CA 3.35Å; C19-G23 PolarHBondContact O-N 3.19Å
24	A	96.9	Very high	97.5	Very high	22 Å²	22	78 Å²	78	18%	0.182	40%	0.396	C	S	.	.	S	Bend	trans	-79.5	146.6	-179.9	0	0	0	0	0	112	C19 C22 A26 K36	C19-A24 WeakPolarHBondContact CB-O 3.25Å; C19-A24 PolarHBondContact N-O 3.22Å; C22-A24 PolarHBondContact O-N 2.81Å; C22-A24 VanDerWaalsContact O-N 3.08Å; A24-A26 HydrophobicContact CB-CB 4.36Å; A24-A26 PolarHBondContact O-N 3.15Å; A24-K36 HydrophobicContact CB-CB 4.46Å; A24-K36 HydrophobicContact CB-CD 3.88Å; A24-K36 HydrophobicContact CB-CG 4.42Å
25	K	98.1	Very high	97.6	Very high	145 Å²	145	73.9 Å²	73.9	63%	0.63	39%	0.39	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.6	67.7	170.7	-168.1	179.3	179.9	172.6	0	111.4	H16 T17 L18	H16-K25 VanDerWaalsContact O-CE 3.3Å; H16-K25 WeakPolarHBondContact O-CE 3.42Å; T17-K25 CarbonylContact O-C 3.36Å; T17-K25 VanDerWaalsContact O-CA 3.28Å; T17-K25 WeakPolarHBondContact O-CA 3.45Å; L18-K25 HydrophobicContact CD2-CB 4.22Å
26	A	97.8	Very high	97.5	Very high	16 Å²	16	75 Å²	75	13%	0.132	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.1	10.4	-174.4	0	0	0	0	0	112.6	T17 A24 H28 C34 G35 K36	T17-A26 PolarHBondContact O-N 3.19Å; A24-A26 HydrophobicContact CB-CB 4.36Å; A24-A26 PolarHBondContact O-N 3.15Å; A26-H28 PolarHBondContact O-N 3.02Å; A26-C34 CarbonylContact O-C 3.54Å; A26-C34 WeakPolarHBondContact O-CA 3.4Å; A26-G35 PolarHBondContact O-N 3.19Å; A26-K36 HydrophobicContact CB-CB 3.74Å
27	Y	98.4	Very high	97.5	Very high	46 Å²	46	71.6 Å²	71.6	18%	0.18	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.1	113.3	175	-174.4	-108.6	0	0	0	110	H16 T17 L29 S32 C34 Y39	H16-Y27 CarbonylContact C-O 3.49Å; H16-Y27 WeakPolarHBondContact CA-O 3.36Å; T17-Y27 PolarHBondContact N-O 3.45Å; T17-Y27 WeakPolarHBondContact O-CB 3.41Å; T17-Y27 PolarHBondContact O-N 3.39Å; Y27-L29 HydrophobicContact CD1-CD2 4.35Å; Y27-L29 HydrophobicContact CE1-CD2 4.48Å; Y27-S32 VanDerWaalsContact CE2-C 3.47Å; Y27-S32 WeakPolarHBondContact CE2-O 3.3Å; Y27-S32 WeakPolarHBondContact OH-CA 3.47Å; Y27-S32 PolarHBondContact OH-O 3.41Å; Y27-C34 HydrophobicContact CD2-CB 4.19Å; Y27-Y39 AromaticContact CD2-CD1 3.96Å; Y27-Y39 HydrophobicContact CD2-CD1 3.96Å; Y27-Y39 AromaticContact CE2-CD1 3.65Å; Y27-Y39 HydrophobicContact CE2-CD1 3.65Å; Y27-Y39 AromaticContact CE2-CE1 3.99Å; Y27-Y39 HydrophobicContact CE2-CE1 3.99Å
28	H	98.4	Very high	97.5	Very high	28 Å²	28	69.6 Å²	69.6	13%	0.13	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.1	119.1	179.2	-168.4	-50.5	0	0	0	109.5	T15 H16 A26 Q30 K31 S32 S33	T15-H28 WeakPolarHBondContact CG2-CE1 3.31Å; T15-H28 WeakPolarHBondContact CG2-NE2 3.31Å; T15-H28 WeakPolarHBondContact O-CA 3.48Å; H16-H28 AromaticContact NE2-CD2 3.87Å; A26-H28 PolarHBondContact O-N 3.02Å; H28-Q30 PolarHBondContact ND1-N 3.21Å; H28-K31 HydrophobicContact CB-CB 4.26Å; H28-K31 PolarHBondContact ND1-N 3.1Å; H28-S32 WeakPolarHBondContact O-CA 3.48Å; H28-S32 PolarHBondContact O-N 3.41Å; H28-S33 WeakPolarHBondContact CB-O 3.28Å; H28-S33 PolarHBondContact N-O 3.47Å; H28-S33 PolarHBondContact O-N 2.96Å
29	L	97.4	Very high	97.5	Very high	82 Å²	82	66 Å²	66	43%	0.429	34%	0.342	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.3	-55.7	-172.9	-70.1	175.8	0	0	0	112.6	K14 T15 T17 Y27 K31 S32	K14-L29 WeakPolarHBondContact O-CD1 3.32Å; T15-L29 PolarHBondContact O-N 3.35Å; T17-L29 HydrophobicContact CG2-CD1 3.75Å; T17-L29 HydrophobicContact CG2-CD2 3.71Å; T17-L29 HydrophobicContact CG2-CG 3.79Å; Y27-L29 HydrophobicContact CD1-CD2 4.35Å; Y27-L29 HydrophobicContact CE1-CD2 4.48Å; L29-K31 PolarHBondContact O-N 2.58Å; L29-S32 PolarHBondContact O-N 3.01Å
30	Q	97.5	Very high	97.4	Very high	175 Å²	175	69.6 Å²	69.6	82%	0.818	37%	0.365	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.5	-38.2	-175.9	-65.2	170.7	-14	0	0	113.4	H28 S32	H28-Q30 PolarHBondContact ND1-N 3.21Å; Q30-S32 PolarHBondContact O-N 3.18Å
31	K	97.6	Very high	97.4	Very high	151 Å²	151	65.3 Å²	65.3	66%	0.657	35%	0.354	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.6	1.6	179	-63.3	-175.9	180	-173.6	0	112.9	H28 L29 S33	H28-K31 HydrophobicContact CB-CB 4.26Å; H28-K31 PolarHBondContact ND1-N 3.1Å; L29-K31 PolarHBondContact O-N 2.58Å; K31-S33 WeakPolarHBondContact CB-OG 3.33Å; K31-S33 WeakPolarHBondContact O-CB 3.07Å; K31-S33 PolarHBondContact O-N 3.25Å; K31-S33 PolarHBondContact O-OG 2.95Å
32	S	96.8	Very high	97.4	Very high	64 Å²	64	71.3 Å²	71.3	45%	0.448	38%	0.382	S	S	.	.	T	Hydrogen-bonded Turn	trans	44	34.5	-178.3	-63.1	0	0	0	0	114.5	Y27 H28 L29 Q30 P40	Y27-S32 VanDerWaalsContact CE2-C 3.47Å; Y27-S32 WeakPolarHBondContact CE2-O 3.3Å; Y27-S32 WeakPolarHBondContact OH-CA 3.47Å; Y27-S32 PolarHBondContact OH-O 3.41Å; H28-S32 WeakPolarHBondContact O-CA 3.48Å; H28-S32 PolarHBondContact O-N 3.41Å; L29-S32 PolarHBondContact O-N 3.01Å; Q30-S32 PolarHBondContact O-N 3.18Å; S32-P40 WeakPolarHBondContact O-CD 3.17Å
33	S	98.1	Very high	97.4	Very high	46 Å²	46	79.2 Å²	79.2	32%	0.322	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140	142.7	-169.4	52.4	0	0	0	0	112.7	H28 K31 Y39	H28-S33 WeakPolarHBondContact CB-O 3.28Å; H28-S33 PolarHBondContact N-O 3.47Å; H28-S33 PolarHBondContact O-N 2.96Å; K31-S33 WeakPolarHBondContact CB-OG 3.33Å; K31-S33 WeakPolarHBondContact O-CB 3.07Å; K31-S33 PolarHBondContact O-N 3.25Å; K31-S33 PolarHBondContact O-OG 2.95Å; S33-Y39 CarbonylContact C-O 3.43Å; S33-Y39 VanDerWaalsContact CA-O 3.29Å; S33-Y39 WeakPolarHBondContact CA-O 3.41Å
34	C	98.3	Very high	97.4	Very high	5 Å²	5	84.2 Å²	84.2	3%	0.034	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.8	113.4	-179.7	-176.3	0	0	0	0	111.8	C19 A26 Y27 K36 G38 Y39	C19-C34 HydrophobicContact CB-CB 4.39Å; C19-C34 VanDerWaalsContact SG-SG 3.62Å; A26-C34 CarbonylContact O-C 3.54Å; A26-C34 WeakPolarHBondContact O-CA 3.4Å; Y27-C34 HydrophobicContact CD2-CB 4.19Å; C34-K36 PolarHBondContact O-N 3.41Å; C34-K36 PolarHBondContact SG-N 3.02Å; C34-K36 VanDerWaalsContact SG-N 3.4Å; C34-G38 WeakPolarHBondContact O-CA 3.43Å; C34-G38 PolarHBondContact O-N 3.24Å; C34-Y39 PolarHBondContact N-O 2.96Å
35	G	97.1	Very high	97.4	Very high	43 Å²	43	87.8 Å²	87.8	44%	0.443	42%	0.42	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68	1.8	174.7	0	0	0	0	0	115	A26 R45	A26-G35 PolarHBondContact O-N 3.19Å; G35-R45 PolarHBondContact O-NH1 3.4Å; G35-R45 PolarHBondContact O-NH2 3.24Å
36	K	97.3	Very high	97.3	Very high	91 Å²	91	87.8 Å²	87.8	40%	0.396	42%	0.42	S	S	.	.	T	Hydrogen-bonded Turn	trans	-104.7	-65.2	171.9	-177.6	131.1	174.4	-175.6	0	111.6	A24 A26 C34 R45	A24-K36 HydrophobicContact CB-CB 4.46Å; A24-K36 HydrophobicContact CB-CD 3.88Å; A24-K36 HydrophobicContact CB-CG 4.42Å; A26-K36 HydrophobicContact CB-CB 3.74Å; C34-K36 PolarHBondContact O-N 3.41Å; C34-K36 PolarHBondContact SG-N 3.02Å; C34-K36 VanDerWaalsContact SG-N 3.4Å; K36-R45 PolarHBondContact O-NE 2.87Å; K36-R45 VanDerWaalsContact O-NE 3.1Å; K36-R45 PolarHBondContact O-NH2 2.75Å
37	C	97.3	Very high	97.3	Very high	12 Å²	12	91.9 Å²	91.9	8%	0.081	43%	0.433	C	S	.	.	T	Hydrogen-bonded Turn	trans	-104.1	-2.9	-171.4	73.9	0	0	0	0	115.2	C22 R45	C22-C37 HydrophobicContact CB-CB 3.85Å; C37-R45 PolarHBondContact O-N 3.12Å
38	G	97.4	Very high	97.2	Very high	5 Å²	5	96 Å²	96	5%	0.052	46%	0.458	C	S	.	.			trans	81.1	7.2	179.3	0	0	0	0	0	116	C34 E41	C34-G38 WeakPolarHBondContact O-CA 3.43Å; C34-G38 PolarHBondContact O-N 3.24Å; G38-E41 WeakPolarHBondContact O-CB 3.5Å; G38-E41 WeakPolarHBondContact O-CG 3.22Å; G38-E41 PolarHBondContact O-N 3.25Å
39	Y	97.7	Very high	97.2	Very high	51 Å²	51	104.3 Å²	104.3	20%	0.2	49%	0.488	C	S	.	.	T	Hydrogen-bonded Turn	trans	-53.5	130.4	174.7	177.4	-97.5	0	0	0	110.2	R20 R21 Y27 S33 C34	R20-Y39 PolarHBondContact NH2-OH 2.78Å; R21-Y39 HydrophobicContact CB-CD2 4.17Å; R21-Y39 HydrophobicContact CB-CG 4.44Å; Y27-Y39 AromaticContact CD2-CD1 3.96Å; Y27-Y39 HydrophobicContact CD2-CD1 3.96Å; Y27-Y39 AromaticContact CE2-CD1 3.65Å; Y27-Y39 HydrophobicContact CE2-CD1 3.65Å; Y27-Y39 AromaticContact CE2-CE1 3.99Å; Y27-Y39 HydrophobicContact CE2-CE1 3.99Å; S33-Y39 CarbonylContact C-O 3.43Å; S33-Y39 VanDerWaalsContact CA-O 3.29Å; S33-Y39 WeakPolarHBondContact CA-O 3.41Å; C34-Y39 PolarHBondContact N-O 2.96Å
40	P	97	Very high	97.1	Very high	79 Å²	79	102 Å²	102	51%	0.513	48%	0.479	S	S	.	.	T	Hydrogen-bonded Turn	cis	-89	-3.6	17.5	34.3	-38.4	0	0	0	116.8	R21 S32 K42	R21-P40 PolarHBondContact NH2-O 3.34Å; S32-P40 WeakPolarHBondContact O-CD 3.17Å; P40-K42 PolarHBondContact O-N 3.08Å
41	E	97.3	Very high	97.1	Very high	119 Å²	119	97.1 Å²	97.1	56%	0.556	47%	0.468	S	S	*	.	S	Bend	trans	-49.6	140.7	-177.5	-63.9	170.5	-168.4	0	0	112.2	R21 G38 R43	R21-E41 PolarHBondContact NH1-O 3.19Å; R21-E41 PolarHBondContact NH2-O 2.92Å; G38-E41 WeakPolarHBondContact O-CB 3.5Å; G38-E41 WeakPolarHBondContact O-CG 3.22Å; G38-E41 PolarHBondContact O-N 3.25Å; E41-R43 VanDerWaalsContact C-N 3.34Å; E41-R43 PolarHBondContact O-N 3.44Å
42	K	96.8	Very high	97.1	Very high	211 Å²	211	96.8 Å²	96.8	92%	0.917	47%	0.467	S	S	*	.	S	Bend	trans	-61.2	-43.5	-177.9	-63.8	-178.9	-178.6	178.8	0	111.5	P40	P40-K42 PolarHBondContact O-N 3.08Å
43	R	96.4	Very high	97.1	Very high	219 Å²	219	95.5 Å²	95.5	83%	0.826	46%	0.461	S	S	*	.	S	Bend	trans	-80	143.6	178	-67.5	-176.8	175.1	-176.2	-0.8	110.4	E41	E41-R43 VanDerWaalsContact C-N 3.34Å; E41-R43 PolarHBondContact O-N 3.44Å
44	K	95.8	Very high	97.1	Very high	158 Å²	158	96.2 Å²	96.2	69%	0.687	46%	0.458	S	S	*	.	P	Polyproline II helix	trans	-75.6	129.8	172.4	-73.5	-177.1	-179.9	175.9	0	109.3	K46	K44-K46 PolarHBondContact O-N 3.47Å
45	R	96.9	Very high	97	Very high	98 Å²	98	104.3 Å²	104.3	37%	0.37	49%	0.487	S	S	.	.	P	Polyproline II helix	trans	-60.8	123.5	175.4	-166.3	-174.5	73.6	138.7	8.1	111	G35 K36 C37 Y47	G35-R45 PolarHBondContact O-NH1 3.4Å; G35-R45 PolarHBondContact O-NH2 3.24Å; K36-R45 PolarHBondContact O-NE 2.87Å; K36-R45 VanDerWaalsContact O-NE 3.1Å; K36-R45 PolarHBondContact O-NH2 2.75Å; C37-R45 PolarHBondContact O-N 3.12Å; R45-Y47 WeakPolarHBondContact CD-OH 3.36Å; R45-Y47 HydrophobicContact CG-CE2 3.87Å
46	K	96.4	Very high	97	Very high	145 Å²	145	109.7 Å²	109.7	63%	0.63	49%	0.494	S	S	*	.			trans	-142	131.7	177.1	-175.7	-177.8	177.5	-175.8	0	108.6	K44 K54	K44-K46 PolarHBondContact O-N 3.47Å; K46-K54 HydrophobicContact CG-CG 4.15Å
47	Y	97.1	Very high	96.8	Very high	102 Å²	102	110.1 Å²	110.1	40%	0.4	50%	0.501	S	S	.	.			trans	-116.7	141.1	176.5	-64.7	-59.7	0	0	0	111.3	R45 W49 S50 K54	R45-Y47 WeakPolarHBondContact CD-OH 3.36Å; R45-Y47 HydrophobicContact CG-CE2 3.87Å; Y47-W49 AromaticContact CD1-NE1 3.91Å; Y47-W49 AromaticContact CD2-CZ2 3.69Å; Y47-W49 HydrophobicContact CD2-CZ2 3.69Å; Y47-W49 HydrophobicContact CE2-CZ2 4.35Å; Y47-W49 AromaticContact CG-CE2 3.84Å; Y47-W49 AromaticContact CG-CZ2 3.95Å; Y47-W49 HydrophobicContact CG-CZ2 3.95Å; Y47-W49 AromaticContact CG-NE1 3.6Å; Y47-S50 PolarHBondContact O-N 3.23Å; Y47-K54 WeakPolarHBondContact O-CE 3.35Å
48	N	97.1	Very high	96.8	Very high	131 Å²	131	113 Å²	113	70%	0.701	52%	0.518	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.8	-33.6	-174.9	-77.2	-27.6	0	0	0	114.1	S50 K54	N48-S50 PolarHBondContact O-N 3.49Å; N48-K54 VanDerWaalsContact CA-NZ 3.34Å; N48-K54 PolarHBondContact O-NZ 2.84Å; N48-K54 WeakPolarHBondContact OD1-CE 3.29Å; N48-K54 PolarHBondContact OD1-NZ 3.49Å
49	W	97.5	Very high	96.7	Very high	203 Å²	203	118 Å²	118	77%	0.769	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.4	-17.1	177	56.3	-103.9	0	0	0	114	Y47	Y47-W49 AromaticContact CD1-NE1 3.91Å; Y47-W49 AromaticContact CD2-CZ2 3.69Å; Y47-W49 HydrophobicContact CD2-CZ2 3.69Å; Y47-W49 HydrophobicContact CE2-CZ2 4.35Å; Y47-W49 AromaticContact CG-CE2 3.84Å; Y47-W49 AromaticContact CG-CZ2 3.95Å; Y47-W49 HydrophobicContact CG-CZ2 3.95Å; Y47-W49 AromaticContact CG-NE1 3.6Å
50	S	96.6	Very high	96.5	Very high	33 Å²	33	117.7 Å²	117.7	23%	0.231	56%	0.561	C	S	.	*			trans	-105.5	74.1	-178.2	-159.3	0	0	0	0	113.2	Y47 N48 K52 A53 K54	Y47-S50 PolarHBondContact O-N 3.23Å; N48-S50 PolarHBondContact O-N 3.49Å; S50-K52 PolarHBondContact O-N 3.22Å; S50-A53 PolarHBondContact O-N 3.4Å; S50-A53 WeakPolarHBondContact OG-CB 3.48Å; S50-K54 PolarHBondContact O-N 3.46Å; S50-K54 VanDerWaalsContact O-N 3.12Å
51	A	97.5	Very high	96.5	Very high	73 Å²	73	118 Å²	118	60%	0.603	56%	0.561	S	S	*	*	H	α-helix	trans	-57.8	-45	-179.1	0	0	0	0	0	113.2	A53 K54 R55	A51-A53 VanDerWaalsContact C-N 3.32Å; A51-A53 PolarHBondContact O-N 2.94Å; A51-K54 WeakPolarHBondContact O-CB 3.44Å; A51-K54 PolarHBondContact O-N 3.06Å; A51-R55 PolarHBondContact O-N 3.19Å
52	K	97.8	Very high	96.4	Very high	144 Å²	144	114.6 Å²	114.6	63%	0.626	56%	0.558	S	S	*	*	H	α-helix	trans	-63.2	-36.2	178	-68.4	-177.9	-179.2	175.6	0	112.3	S50 R55 R56	S50-K52 PolarHBondContact O-N 3.22Å; K52-R55 PolarHBondContact O-N 3.03Å; K52-R56 WeakPolarHBondContact O-CG 3.04Å; K52-R56 PolarHBondContact O-N 2.87Å; K52-R56 PolarHBondContact O-NH1 3.2Å
53	A	96.7	Very high	96.4	Very high	38 Å²	38	113.2 Å²	113.2	31%	0.314	55%	0.547	S	S	.	.	H	α-helix	trans	-69	-38.1	177.3	0	0	0	0	0	112.2	S50 A51 R56 N57	S50-A53 PolarHBondContact O-N 3.4Å; S50-A53 WeakPolarHBondContact OG-CB 3.48Å; A51-A53 VanDerWaalsContact C-N 3.32Å; A51-A53 PolarHBondContact O-N 2.94Å; A53-R56 PolarHBondContact O-N 3.5Å; A53-N57 PolarHBondContact O-ND2 3.12Å
54	K	96.5	Very high	96.4	Very high	61 Å²	61	105.2 Å²	105.2	27%	0.265	52%	0.52	S	S	.	.	H	α-helix	trans	-58.3	-52.1	171.4	-65.5	176.3	-178.1	175.6	0	110.5	K46 Y47 N48 S50 A51 R56 N57 T58	K46-K54 HydrophobicContact CG-CG 4.15Å; Y47-K54 WeakPolarHBondContact O-CE 3.35Å; N48-K54 VanDerWaalsContact CA-NZ 3.34Å; N48-K54 PolarHBondContact O-NZ 2.84Å; N48-K54 WeakPolarHBondContact OD1-CE 3.29Å; N48-K54 PolarHBondContact OD1-NZ 3.49Å; S50-K54 PolarHBondContact O-N 3.46Å; S50-K54 VanDerWaalsContact O-N 3.12Å; A51-K54 WeakPolarHBondContact O-CB 3.44Å; A51-K54 PolarHBondContact O-N 3.06Å; K54-R56 VanDerWaalsContact C-N 3.27Å; K54-R56 PolarHBondContact O-N 2.86Å; K54-N57 PolarHBondContact O-N 3.38Å; K54-N57 VanDerWaalsContact O-N 3.12Å; K54-T58 WeakPolarHBondContact O-CB 3.41Å; K54-T58 PolarHBondContact O-N 3.24Å
55	R	96.9	Very high	96.4	Very high	174 Å²	174	106.2 Å²	106.2	66%	0.657	52%	0.52	S	S	*	.	H	α-helix	trans	-55.4	-39.2	-178.1	-171.2	179.2	70.3	178.4	4.2	113	A51 K52 N57 T61	A51-R55 PolarHBondContact O-N 3.19Å; K52-R55 PolarHBondContact O-N 3.03Å; R55-N57 VanDerWaalsContact C-N 3.35Å; R55-N57 PolarHBondContact O-N 3.4Å; R55-T61 VanDerWaalsContact O-CG2 3.25Å; R55-T61 WeakPolarHBondContact O-CG2 3.34Å
56	R	96.4	Very high	96.4	Very high	156 Å²	156	108.3 Å²	108.3	59%	0.589	53%	0.533	S	S	*	.	H	α-helix	trans	-70.6	-23.2	-178.7	-69.4	-178	-167.3	107	-9.3	114.9	K52 A53 K54	K52-R56 WeakPolarHBondContact O-CG 3.04Å; K52-R56 PolarHBondContact O-N 2.87Å; K52-R56 PolarHBondContact O-NH1 3.2Å; A53-R56 PolarHBondContact O-N 3.5Å; K54-R56 VanDerWaalsContact C-N 3.27Å; K54-R56 PolarHBondContact O-N 2.86Å
57	N	94.8	Very high	96.4	Very high	100 Å²	100	104.2 Å²	104.2	54%	0.535	52%	0.518	S	S	.	.	H	α-helix	trans	-126.4	5.8	-173.6	-55.9	-68.5	0	0	0	113.8	A53 K54 R55	A53-N57 PolarHBondContact O-ND2 3.12Å; K54-N57 PolarHBondContact O-N 3.38Å; K54-N57 VanDerWaalsContact O-N 3.12Å; R55-N57 VanDerWaalsContact C-N 3.35Å; R55-N57 PolarHBondContact O-N 3.4Å
58	T	95.7	Very high	96.4	Very high	73 Å²	73	105.2 Å²	105.2	45%	0.448	53%	0.525	S	S	.	.	S	Bend	trans	-68.8	156.4	179.7	-166.7	0	0	0	0	111	K54 G60 T61	K54-T58 WeakPolarHBondContact O-CB 3.41Å; K54-T58 PolarHBondContact O-N 3.24Å; T58-G60 PolarHBondContact O-N 3.29Å; T58-T61 HydrophobicContact CG2-CG2 4.22Å; T58-T61 PolarHBondContact O-N 2.9Å; T58-T61 PolarHBondContact O-OG1 3.22Å
59	T	95.2	Very high	96.4	Very high	111 Å²	111	101.7 Å²	101.7	68%	0.681	51%	0.507	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.6	131.3	169.6	-52.7	0	0	0	0	109	L64 L67	T59-L64 HydrophobicContact CG2-CD2 3.96Å; T59-L67 HydrophobicContact CG2-CD1 3.96Å
60	G	94.9	Very high	96.3	Very high	44 Å²	44	94 Å²	94	45%	0.454	48%	0.483	S	S	.	.	T	Hydrogen-bonded Turn	trans	118.8	-39.5	-171.9	0	0	0	0	0	113.2	T58 G62	T58-G60 PolarHBondContact O-N 3.29Å; G60-G62 VanDerWaalsContact C-N 3.33Å; G60-G62 PolarHBondContact O-N 2.81Å
61	T	95.9	Very high	96.3	Very high	85 Å²	85	98.6 Å²	98.6	52%	0.521	50%	0.496	S	S	.	.	S	Bend	trans	-72.2	-24.6	-176	55.8	0	0	0	0	114.3	R55 T58	R55-T61 VanDerWaalsContact O-CG2 3.25Å; R55-T61 WeakPolarHBondContact O-CG2 3.34Å; T58-T61 HydrophobicContact CG2-CG2 4.22Å; T58-T61 PolarHBondContact O-N 2.9Å; T58-T61 PolarHBondContact O-OG1 3.22Å
62	G	95.1	Very high	96.3	Very high	48 Å²	48	102.4 Å²	102.4	50%	0.495	50%	0.495	S	S	.	.	S	Bend	trans	-89.5	-166.5	-179.2	0	0	0	0	0	113.7	G60 L64	G60-G62 VanDerWaalsContact C-N 3.33Å; G60-G62 PolarHBondContact O-N 2.81Å; G62-L64 PolarHBondContact O-N 2.94Å
63	R	96.3	Very high	96.2	Very high	182 Å²	182	99.7 Å²	99.7	69%	0.687	48%	0.481	S	S	*	.			trans	-64.9	-25	-176.3	-65.7	180	175.3	173.5	-3.1	114.3	R65 K68	R63-R65 HydrophobicContact CB-CG 3.97Å; R63-R65 PolarHBondContact O-N 3.13Å; R63-K68 WeakPolarHBondContact O-CE 3.48Å; R63-K68 PolarHBondContact O-NZ 3.48Å; R63-K68 VanDerWaalsContact O-NZ 3.1Å
64	L	96.8	Very high	96.2	Very high	50 Å²	50	104.3 Å²	104.3	26%	0.262	49%	0.494	S	S	.	.			trans	48.9	37.3	-176.7	-69.1	176	0	0	0	113.6	T59 G62 H66 L67 K68	T59-L64 HydrophobicContact CG2-CD2 3.96Å; G62-L64 PolarHBondContact O-N 2.94Å; L64-H66 VanDerWaalsContact C-N 3.34Å; L64-H66 PolarHBondContact O-N 2.82Å; L64-L67 HydrophobicContact CD2-CB 4.29Å; L64-L67 HydrophobicContact CD2-CD1 3.86Å; L64-L67 PolarHBondContact O-N 3.33Å; L64-K68 HydrophobicContact CB-CD 4.06Å; L64-K68 HydrophobicContact CB-CG 3.86Å; L64-K68 VanDerWaalsContact O-CB 3.31Å; L64-K68 WeakPolarHBondContact O-CB 3.4Å; L64-K68 VanDerWaalsContact O-CG 3.31Å; L64-K68 WeakPolarHBondContact O-CG 3.13Å; L64-K68 PolarHBondContact O-N 3.14Å
65	R	96.6	Very high	96.2	Very high	180 Å²	180	111.2 Å²	111.2	68%	0.679	52%	0.518	S	S	*	.	H	α-helix	trans	-51.4	-49.6	-172.3	-70.7	-177.5	173.9	172.8	-6.5	112.9	R63	R63-R65 HydrophobicContact CB-CG 3.97Å; R63-R65 PolarHBondContact O-N 3.13Å
66	H	97	Very high	96.1	Very high	142 Å²	142	107.8 Å²	107.8	66%	0.657	51%	0.513	S	S	*	.	H	α-helix	trans	-75.1	-53.9	-179.5	-178.2	68.4	0	0	0	112.1	L64 K68 V69 V70	L64-H66 VanDerWaalsContact C-N 3.34Å; L64-H66 PolarHBondContact O-N 2.82Å; H66-K68 VanDerWaalsContact C-N 3.31Å; H66-K68 PolarHBondContact O-N 2.97Å; H66-V69 WeakPolarHBondContact O-CB 3.34Å; H66-V69 PolarHBondContact O-N 3.44Å; H66-V70 WeakPolarHBondContact NE2-CG2 3.43Å; H66-V70 WeakPolarHBondContact O-CG2 3.37Å; H66-V70 PolarHBondContact O-N 2.81Å
67	L	96.9	Very high	96	Very high	59 Å²	59	103.1 Å²	103.1	31%	0.309	51%	0.513	S	S	.	.	H	α-helix	trans	-59.9	-36.3	-175.4	-70.6	177.3	0	0	0	113.4	T59 L64 V69 V70 Y71	T59-L67 HydrophobicContact CG2-CD1 3.96Å; L64-L67 HydrophobicContact CD2-CB 4.29Å; L64-L67 HydrophobicContact CD2-CD1 3.86Å; L64-L67 PolarHBondContact O-N 3.33Å; L67-V69 VanDerWaalsContact C-N 3.31Å; L67-V69 PolarHBondContact O-N 3.18Å; L67-V70 PolarHBondContact O-N 2.85Å; L67-Y71 HydrophobicContact CB-CD2 4.42Å; L67-Y71 HydrophobicContact CB-CE2 3.98Å; L67-Y71 WeakPolarHBondContact O-CD2 3.35Å; L67-Y71 PolarHBondContact O-N 3.4Å
68	K	96.3	Very high	96.1	Very high	123 Å²	123	103 Å²	103	54%	0.535	51%	0.508	S	S	.	.	H	α-helix	trans	-59.1	-42.5	174.6	-77.6	173.1	174.1	171.8	0	112.2	R63 L64 H66 R72	R63-K68 WeakPolarHBondContact O-CE 3.48Å; R63-K68 PolarHBondContact O-NZ 3.48Å; R63-K68 VanDerWaalsContact O-NZ 3.1Å; L64-K68 HydrophobicContact CB-CD 4.06Å; L64-K68 HydrophobicContact CB-CG 3.86Å; L64-K68 VanDerWaalsContact O-CB 3.31Å; L64-K68 WeakPolarHBondContact O-CB 3.4Å; L64-K68 VanDerWaalsContact O-CG 3.31Å; L64-K68 WeakPolarHBondContact O-CG 3.13Å; L64-K68 PolarHBondContact O-N 3.14Å; H66-K68 VanDerWaalsContact C-N 3.31Å; H66-K68 PolarHBondContact O-N 2.97Å; K68-R72 PolarHBondContact O-N 2.73Å
69	V	96.5	Very high	95.9	Very high	56 Å²	56	108.7 Å²	108.7	34%	0.339	52%	0.521	S	S	.	.	H	α-helix	trans	-68.6	-43.1	176.8	175.2	0	0	0	0	110.4	H66 L67 Y71 R72 R73	H66-V69 WeakPolarHBondContact O-CB 3.34Å; H66-V69 PolarHBondContact O-N 3.44Å; L67-V69 VanDerWaalsContact C-N 3.31Å; L67-V69 PolarHBondContact O-N 3.18Å; V69-Y71 PolarHBondContact O-N 3.02Å; V69-R72 PolarHBondContact O-N 3.24Å; V69-R73 HydrophobicContact CG1-CG 4.28Å; V69-R73 WeakPolarHBondContact O-CG 3.39Å; V69-R73 PolarHBondContact O-N 3.5Å
70	V	96.8	Very high	95.8	Very high	41 Å²	41	109.8 Å²	109.8	25%	0.248	52%	0.519	C	S	.	.	H	α-helix	trans	-58.3	-47.2	176.7	173.8	0	0	0	0	111.1	H66 L67 R72 R73 F74 F78	H66-V70 WeakPolarHBondContact NE2-CG2 3.43Å; H66-V70 WeakPolarHBondContact O-CG2 3.37Å; H66-V70 PolarHBondContact O-N 2.81Å; L67-V70 PolarHBondContact O-N 2.85Å; V70-R72 VanDerWaalsContact C-N 3.33Å; V70-R72 PolarHBondContact O-N 2.72Å; V70-R73 PolarHBondContact O-N 3.32Å; V70-F74 WeakPolarHBondContact O-CB 3.33Å; V70-F74 PolarHBondContact O-N 3.03Å; V70-F78 HydrophobicContact CG1-CE1 4.22Å
71	Y	96.6	Very high	95.6	Very high	131 Å²	131	112 Å²	112	51%	0.514	54%	0.542	S	S	.	.	H	α-helix	trans	-63.8	-36.5	178.3	-66.5	-49.1	0	0	0	113	L67 V69 R75	L67-Y71 HydrophobicContact CB-CD2 4.42Å; L67-Y71 HydrophobicContact CB-CE2 3.98Å; L67-Y71 WeakPolarHBondContact O-CD2 3.35Å; L67-Y71 PolarHBondContact O-N 3.4Å; V69-Y71 PolarHBondContact O-N 3.02Å; Y71-R75 WeakPolarHBondContact O-CG 3.17Å; Y71-R75 PolarHBondContact O-N 2.74Å
72	R	96	Very high	95.2	Very high	152 Å²	152	112.6 Å²	112.6	57%	0.574	55%	0.545	S	S	*	.	H	α-helix	trans	-64.7	-45.3	173.1	-178	-178.3	65.2	-160	1.6	111.3	K68 V69 V70 R75 N76	K68-R72 PolarHBondContact O-N 2.73Å; V69-R72 PolarHBondContact O-N 3.24Å; V70-R72 VanDerWaalsContact C-N 3.33Å; V70-R72 PolarHBondContact O-N 2.72Å; R72-R75 PolarHBondContact O-N 3.42Å; R72-N76 PolarHBondContact O-N 2.65Å
73	R	95.9	Very high	94.9	Very high	88 Å²	88	116.5 Å²	116.5	33%	0.332	56%	0.56	S	S	.	*	H	α-helix	trans	-63.7	-41.7	177.1	-73	-178.6	58.6	-178.6	-11.1	111.8	V69 V70 R75 N76 G77 F78 E80	V69-R73 HydrophobicContact CG1-CG 4.28Å; V69-R73 WeakPolarHBondContact O-CG 3.39Å; V69-R73 PolarHBondContact O-N 3.5Å; V70-R73 PolarHBondContact O-N 3.32Å; R73-R75 PolarHBondContact O-N 3.47Å; R73-N76 CarbonylContact O-C 3.28Å; R73-N76 VanDerWaalsContact O-C 3.28Å; R73-N76 WeakPolarHBondContact O-CA 3.34Å; R73-N76 PolarHBondContact O-N 3.31Å; R73-G77 PolarHBondContact O-N 3.2Å; R73-G77 VanDerWaalsContact O-N 3.15Å; R73-F78 HydrophobicContact CB-CD1 3.88Å; R73-F78 HydrophobicContact CB-CE1 4.32Å; R73-F78 WeakPolarHBondContact O-CA 3.46Å; R73-F78 PolarHBondContact O-N 3.1Å; R73-E80 IonicContact CZ-OE1 3.1Å; R73-E80 IonicContact NH1-OE1 3.01Å; R73-E80 PolarHBondContact NH1-OE1 3.48Å; R73-E80 IonicContact NH2-OE1 2.58Å; R73-E80 PolarHBondContact NH2-OE1 3.24Å
74	F	97.2	Very high	94.5	Very high	134 Å²	134	113.7 Å²	113.7	59%	0.588	57%	0.565	S	S	*	*	H	α-helix	trans	-55.9	-47.8	176.7	174.9	-96.4	0	0	0	111.6	V70 N76 G77 F78	V70-F74 WeakPolarHBondContact O-CB 3.33Å; V70-F74 PolarHBondContact O-N 3.03Å; F74-N76 PolarHBondContact O-N 2.95Å; F74-G77 PolarHBondContact O-N 2.99Å; F74-F78 HydrophobicContact CB-CE1 4.09Å; F74-F78 HydrophobicContact CB-CE2 4.18Å; F74-F78 HydrophobicContact CB-CZ 3.71Å; F74-F78 AromaticContact CD2-CE2 3.52Å; F74-F78 HydrophobicContact CD2-CE2 3.52Å; F74-F78 AromaticContact CD2-CZ 3.63Å; F74-F78 HydrophobicContact CD2-CZ 3.63Å; F74-F78 HydrophobicContact CE2-CE2 4.39Å; F74-F78 HydrophobicContact CG-CE2 4.32Å; F74-F78 HydrophobicContact CG-CZ 4.17Å
75	R	96.7	Very high	94.1	Very high	206 Å²	206	119.8 Å²	119.8	78%	0.777	59%	0.589	S	S	*	*	H	α-helix	trans	-61.6	-25.8	175.8	-69.8	177.8	-171.2	144.8	1.2	113.5	Y71 R72 R73	Y71-R75 WeakPolarHBondContact O-CG 3.17Å; Y71-R75 PolarHBondContact O-N 2.74Å; R72-R75 PolarHBondContact O-N 3.42Å; R73-R75 PolarHBondContact O-N 3.47Å
76	N	94	Very high	93.7	Very high	103 Å²	103	116.5 Å²	116.5	55%	0.551	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.2	15.6	176.7	-63.2	-14.4	0	0	0	112.3	R72 R73 F74 F78 R79	R72-N76 PolarHBondContact O-N 2.65Å; R73-N76 CarbonylContact O-C 3.28Å; R73-N76 VanDerWaalsContact O-C 3.28Å; R73-N76 WeakPolarHBondContact O-CA 3.34Å; R73-N76 PolarHBondContact O-N 3.31Å; F74-N76 PolarHBondContact O-N 2.95Å; N76-F78 VanDerWaalsContact C-N 3.33Å; N76-F78 PolarHBondContact O-N 3.3Å; N76-R79 VanDerWaalsContact O-CD 3.23Å; N76-R79 WeakPolarHBondContact O-CD 3.19Å; N76-R79 WeakPolarHBondContact O-CG 3.34Å; N76-R79 PolarHBondContact O-N 3.48Å
77	G	95.3	Very high	93	Very high	57 Å²	57	121.5 Å²	121.5	59%	0.588	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	68.2	27.1	177.7	0	0	0	0	0	114.6	R73 F74 R79	R73-G77 PolarHBondContact O-N 3.2Å; R73-G77 VanDerWaalsContact O-N 3.15Å; F74-G77 PolarHBondContact O-N 2.99Å; G77-R79 PolarHBondContact O-N 3.25Å
78	F	95.4	Very high	92.2	Very high	98 Å²	98	129.5 Å²	129.5	43%	0.43	63%	0.63	S	S	.	*	T	Hydrogen-bonded Turn	trans	52.3	23.5	-175	-61.1	-75.7	0	0	0	115.2	V70 R73 F74 N76 E80	V70-F78 HydrophobicContact CG1-CE1 4.22Å; R73-F78 HydrophobicContact CB-CD1 3.88Å; R73-F78 HydrophobicContact CB-CE1 4.32Å; R73-F78 WeakPolarHBondContact O-CA 3.46Å; R73-F78 PolarHBondContact O-N 3.1Å; F74-F78 HydrophobicContact CB-CE1 4.09Å; F74-F78 HydrophobicContact CB-CE2 4.18Å; F74-F78 HydrophobicContact CB-CZ 3.71Å; F74-F78 AromaticContact CD2-CE2 3.52Å; F74-F78 HydrophobicContact CD2-CE2 3.52Å; F74-F78 AromaticContact CD2-CZ 3.63Å; F74-F78 HydrophobicContact CD2-CZ 3.63Å; F74-F78 HydrophobicContact CE2-CE2 4.39Å; F74-F78 HydrophobicContact CG-CE2 4.32Å; F74-F78 HydrophobicContact CG-CZ 4.17Å; N76-F78 VanDerWaalsContact C-N 3.33Å; N76-F78 PolarHBondContact O-N 3.3Å; F78-E80 PolarHBondContact O-N 3.42Å
79	R	92.1	Very high	91.3	Very high	192 Å²	192	127.9 Å²	127.9	73%	0.725	64%	0.64	S	S	*	*			trans	-52.1	132	178.5	-66.6	169.9	89.5	-179	8.2	111	N76 G77	N76-R79 VanDerWaalsContact O-CD 3.23Å; N76-R79 WeakPolarHBondContact O-CD 3.19Å; N76-R79 WeakPolarHBondContact O-CG 3.34Å; N76-R79 PolarHBondContact O-N 3.48Å; G77-R79 PolarHBondContact O-N 3.25Å
80	E	92.9	Very high	90.1	Very high	135 Å²	135	130.1 Å²	130.1	63%	0.631	66%	0.664	S	S	*	*			trans	-130.6	164	177.9	-74.9	-174.6	158.5	0	0	109.6	R73 F78 T82	R73-E80 IonicContact CZ-OE1 3.1Å; R73-E80 IonicContact NH1-OE1 3.01Å; R73-E80 PolarHBondContact NH1-OE1 3.48Å; R73-E80 IonicContact NH2-OE1 2.58Å; R73-E80 PolarHBondContact NH2-OE1 3.24Å; F78-E80 PolarHBondContact O-N 3.42Å; E80-T82 PolarHBondContact O-N 3.31Å
81	G	90.3	Very high	88.6	Confident	91 Å²	91	134.8 Å²	134.8	94%	0.938	69%	0.693	S	S	*	*	S	Bend	trans	68.2	3.8	171.6	0	0	0	0	0	116.9
82	T	89.5	Confident	87.2	Confident	97 Å²	97	132.8 Å²	132.8	60%	0.595	70%	0.703	S	S	*	*	P	Polyproline II helix	trans	-104	139.7	178.8	54.4	0	0	0	0	111.4	E80	E80-T82 PolarHBondContact O-N 3.31Å
83	T	87.9	Confident	85.7	Confident	129 Å²	129	130.3 Å²	130.3	79%	0.791	72%	0.715	S	S	*	*	P	Polyproline II helix	trans	-96.2	143.8	170.4	54.1	0	0	0	0	110.3	K85	T83-K85 PolarHBondContact O-N 3.02Å
84	P	87	Confident	84.1	Confident	123 Å²	123	131.6 Å²	131.6	80%	0.799	74%	0.737	S	S	*	*	P	Polyproline II helix	trans	-57.5	140.2	172.7	-21.7	32.6	0	0	0	111.1
85	K	88.5	Confident	82.5	Confident	179 Å²	179	130.9 Å²	130.9	78%	0.778	75%	0.749	S	S	*	*	P	Polyproline II helix	trans	-58.4	131.8	173.1	-174.9	177	180	175.3	0	109	T83 R87	T83-K85 PolarHBondContact O-N 3.02Å; K85-R87 PolarHBondContact O-N 3.36Å
86	P	88.5	Confident	81	Confident	110 Å²	110	126.4 Å²	126.4	71%	0.714	75%	0.749	S	S	*	*	P	Polyproline II helix	trans	-60.4	139.1	178.2	24.8	-33.9	0	0	0	110.2	R88	P86-R88 PolarHBondContact O-N 3.45Å
87	R	83	Confident	79.2	Confident	248 Å²	248	130.9 Å²	130.9	94%	0.936	79%	0.789	S	S	*	*	P	Polyproline II helix	trans	-71.9	121.2	175.7	-62	-179.3	87.9	-172.4	5.2	108	K85	K85-R87 PolarHBondContact O-N 3.36Å
88	R	80.5	Confident	78.4	Confident	226 Å²	226	134.6 Å²	134.6	85%	0.853	80%	0.799	S	S	*	*	P	Polyproline II helix	trans	-75.9	136.2	168.4	-66.9	-173.3	174.8	-157.7	-2.4	108.2	P86 A90	P86-R88 PolarHBondContact O-N 3.45Å; R88-A90 PolarHBondContact O-N 2.98Å
89	A	75.9	Confident	77.5	Confident	90 Å²	90	136.5 Å²	136.5	74%	0.744	82%	0.819	S	S	*	*	P	Polyproline II helix	trans	-56.8	135.6	170.7	0	0	0	0	0	108.7	V91	A89-V91 PolarHBondContact O-N 2.77Å; A89-V91 VanDerWaalsContact O-N 3.12Å
90	A	71.4	Confident	76.7	Confident	102 Å²	102	133.4 Å²	133.4	84%	0.843	82%	0.824	S	S	*	*	P	Polyproline II helix	trans	-62.3	116.7	173	0	0	0	0	0	107.5	R88 A92	R88-A90 PolarHBondContact O-N 2.98Å; A90-A92 PolarHBondContact O-N 3.29Å
91	V	66.3	Low	75.7	Confident	140 Å²	140	133.4 Å²	133.4	85%	0.848	84%	0.835	S	S	*	*	P	Polyproline II helix	trans	-67	119.2	169.1	-172.3	0	0	0	0	105.4	A89 A93	A89-V91 PolarHBondContact O-N 2.77Å; A89-V91 VanDerWaalsContact O-N 3.12Å; V91-A93 PolarHBondContact O-N 2.92Å
92	A	66	Low	74.8	Confident	88 Å²	88	136 Å²	136	73%	0.727	83%	0.829	S	S	*	*	P	Polyproline II helix	trans	-54.7	129.2	172.9	0	0	0	0	0	108.1	A90 S94	A90-A92 PolarHBondContact O-N 3.29Å; A92-S94 PolarHBondContact O-N 2.95Å; A92-S94 VanDerWaalsContact O-N 3.09Å
93	A	65	Low	73.8	Confident	100 Å²	100	138.6 Å²	138.6	83%	0.826	84%	0.844	S	S	*	*	P	Polyproline II helix	trans	-58.2	118.7	173.4	0	0	0	0	0	107.7	V91 S95	V91-A93 PolarHBondContact O-N 2.92Å; A93-S95 PolarHBondContact O-N 2.91Å; A93-S95 VanDerWaalsContact O-N 3.1Å
94	S	63.5	Low	72.8	Confident	115 Å²	115	139.3 Å²	139.3	80%	0.804	85%	0.848	S	S	*	*			trans	-60.7	112.8	172.8	41.4	0	0	0	0	108	A92 S96	A92-S94 PolarHBondContact O-N 2.95Å; A92-S94 VanDerWaalsContact O-N 3.09Å; S94-S96 PolarHBondContact O-N 2.88Å; S94-S96 VanDerWaalsContact O-N 3.09Å
95	S	62.6	Low	71.7	Confident	119 Å²	119	140.5 Å²	140.5	83%	0.832	85%	0.852	S	S	*	*			trans	-60.4	109.5	168.8	41.8	0	0	0	0	108	A93 S97	A93-S95 PolarHBondContact O-N 2.91Å; A93-S95 VanDerWaalsContact O-N 3.1Å; S95-S97 PolarHBondContact O-N 3.31Å
96	S	66.1	Low	70.3	Confident	112 Å²	112	137.3 Å²	137.3	78%	0.783	86%	0.858	S	S	*	*			trans	-71.6	120.9	168.6	45.1	0	0	0	0	109	S94	S94-S96 PolarHBondContact O-N 2.88Å; S94-S96 VanDerWaalsContact O-N 3.09Å
97	S	54.9	Low	68.7	Low	198 Å²	198	139.8 Å²	139.8	100%	1.385	87%	0.871	S	S	*	*			trans	27.1	0	162.9	-50	0	0	0	0	119.3	S95	S95-S97 PolarHBondContact O-N 3.31Å

Retrieved 97 of 97 residues in 81.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).