A0A087X7P1_POEFO Loading...

BLOC-1 related complex subunit 8

AlphaFold DB , UniProt , Accession A0A087X7P1, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 130 aa.

						>A0A087X7P1_POEFO|A0A087X7P1
MDDQEMQLKVRRVSDKFTESMYVLANEPSVALYRLQEHVRRSLPELVQHKTDMQSWEEQSQGAIYTVEYACSAVKSMTNSSVYFKNIDTLLRQAITMKEQISNYNGRRQNDATSSPAPSAPAPQNSPASS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.9	Low	86.8	Confident	209 Å²	209	125.1 Å²	125.1	100%	1.03	60%	0.604	S	S	*	*				0	-35.1	0	-166.5	171.5	-96.4	0	0	109.9	D3	M1-D3 PolarHBondContact O-N 3.31Å
2	D	73.5	Confident	87.4	Confident	127 Å²	127	130.3 Å²	130.3	68%	0.679	61%	0.613	S	S	*	*	H	α-helix	trans	-67.6	-34.4	-176.4	-47.7	-77.2	0	0	0	115.2	Q4 E5 M6	D2-Q4 PolarHBondContact O-N 3.5Å; D2-E5 PolarHBondContact O-N 3.42Å; D2-M6 WeakPolarHBondContact O-CB 3.39Å; D2-M6 PolarHBondContact O-N 3.2Å
3	D	83.6	Confident	87.9	Confident	104 Å²	104	128.4 Å²	128.4	56%	0.556	62%	0.615	S	S	*	*	H	α-helix	trans	-67.3	-37.2	-177.3	-162.8	53.9	0	0	0	112.3	M1 M6 Q7	M1-D3 PolarHBondContact O-N 3.31Å; D3-M6 WeakPolarHBondContact O-CB 3.44Å; D3-M6 PolarHBondContact O-N 3.18Å; D3-M6 WeakPolarHBondContact OD1-CE 3.33Å; D3-Q7 VanDerWaalsContact O-CG 3.32Å; D3-Q7 WeakPolarHBondContact O-CG 3.45Å; D3-Q7 PolarHBondContact O-N 3.15Å
4	Q	88.5	Confident	88.2	Confident	149 Å²	149	123.9 Å²	123.9	70%	0.696	60%	0.604	S	S	*	*	H	α-helix	trans	-71.2	-35.6	177.6	-171.7	158.5	9.7	0	0	112.3	D2 Q7 L8	D2-Q4 PolarHBondContact O-N 3.5Å; Q4-Q7 PolarHBondContact O-N 3.11Å; Q4-L8 WeakPolarHBondContact O-CG 3.38Å; Q4-L8 PolarHBondContact O-N 3.43Å; Q4-L8 VanDerWaalsContact O-N 3.11Å
5	E	90	Very high	88.6	Confident	96 Å²	96	121.6 Å²	121.6	45%	0.449	60%	0.595	S	S	.	*	H	α-helix	trans	-66.8	-40.1	173.1	-169	-174.3	156.3	0	0	111.2	D2 L8 K9	D2-E5 PolarHBondContact O-N 3.42Å; E5-L8 PolarHBondContact O-N 3.12Å; E5-K9 WeakPolarHBondContact O-CG 3.42Å; E5-K9 PolarHBondContact O-N 3.03Å; E5-K9 WeakPolarHBondContact OE1-CE 3.42Å; E5-K9 IonicContact OE1-NZ 2.66Å; E5-K9 PolarHBondContact OE1-NZ 3.2Å
6	M	91.6	Very high	88.7	Confident	102 Å²	102	122.6 Å²	122.6	50%	0.502	60%	0.595	S	S	.	*	H	α-helix	trans	-61.2	-46.1	175.1	-177.5	171	63.1	0	0	111.5	D2 D3 L8 K9 V10	D2-M6 WeakPolarHBondContact O-CB 3.39Å; D2-M6 PolarHBondContact O-N 3.2Å; D3-M6 WeakPolarHBondContact O-CB 3.44Å; D3-M6 PolarHBondContact O-N 3.18Å; D3-M6 WeakPolarHBondContact OD1-CE 3.33Å; M6-L8 VanDerWaalsContact C-N 3.31Å; M6-L8 PolarHBondContact O-N 3.46Å; M6-K9 PolarHBondContact O-N 3.14Å; M6-K9 VanDerWaalsContact O-N 3.16Å; M6-V10 HydrophobicContact CG-CG2 4.49Å; M6-V10 WeakPolarHBondContact O-CG2 3.15Å; M6-V10 PolarHBondContact O-N 3.37Å
7	Q	92.1	Very high	88.8	Confident	112 Å²	112	123.5 Å²	123.5	52%	0.523	60%	0.596	S	S	.	*	H	α-helix	trans	-60.7	-40.2	176.8	-70.3	-63.3	-15.3	0	0	112.4	D3 Q4 V10 R11	D3-Q7 VanDerWaalsContact O-CG 3.32Å; D3-Q7 WeakPolarHBondContact O-CG 3.45Å; D3-Q7 PolarHBondContact O-N 3.15Å; Q4-Q7 PolarHBondContact O-N 3.11Å; Q7-V10 PolarHBondContact O-N 3.48Å; Q7-R11 WeakPolarHBondContact O-CB 3.43Å; Q7-R11 PolarHBondContact O-N 3.35Å
8	L	94.2	Very high	88.8	Confident	110 Å²	110	121.7 Å²	121.7	58%	0.576	59%	0.594	S	S	*	*	H	α-helix	trans	-63.6	-40.6	175.3	-78.9	164.2	0	0	0	112.2	Q4 E5 M6 R12	Q4-L8 WeakPolarHBondContact O-CG 3.38Å; Q4-L8 PolarHBondContact O-N 3.43Å; Q4-L8 VanDerWaalsContact O-N 3.11Å; E5-L8 PolarHBondContact O-N 3.12Å; M6-L8 VanDerWaalsContact C-N 3.31Å; M6-L8 PolarHBondContact O-N 3.46Å; L8-R12 WeakPolarHBondContact O-CB 3.28Å; L8-R12 PolarHBondContact O-N 3.17Å
9	K	92.2	Very high	88.6	Confident	124 Å²	124	122.2 Å²	122.2	54%	0.539	60%	0.595	S	S	.	*	H	α-helix	trans	-66.3	-45.7	176.5	-73.5	174.2	-176.3	166.9	0	111.8	E5 M6 R12 V13	E5-K9 WeakPolarHBondContact O-CG 3.42Å; E5-K9 PolarHBondContact O-N 3.03Å; E5-K9 WeakPolarHBondContact OE1-CE 3.42Å; E5-K9 IonicContact OE1-NZ 2.66Å; E5-K9 PolarHBondContact OE1-NZ 3.2Å; M6-K9 PolarHBondContact O-N 3.14Å; M6-K9 VanDerWaalsContact O-N 3.16Å; K9-R12 PolarHBondContact O-N 3.31Å; K9-V13 WeakPolarHBondContact O-CG2 3.36Å; K9-V13 PolarHBondContact O-N 3.32Å
10	V	94.7	Very high	88.1	Confident	79 Å²	79	120 Å²	120	48%	0.479	59%	0.592	S	S	.	*	H	α-helix	trans	-59.7	-48.3	177.4	170.6	0	0	0	0	110.6	M6 Q7 R12 V13 S14	M6-V10 HydrophobicContact CG-CG2 4.49Å; M6-V10 WeakPolarHBondContact O-CG2 3.15Å; M6-V10 PolarHBondContact O-N 3.37Å; Q7-V10 PolarHBondContact O-N 3.48Å; V10-R12 VanDerWaalsContact C-N 3.32Å; V10-R12 PolarHBondContact O-N 3.35Å; V10-V13 PolarHBondContact O-N 2.92Å; V10-S14 PolarHBondContact O-N 3.33Å
11	R	93.1	Very high	87.7	Confident	164 Å²	164	118.7 Å²	118.7	62%	0.619	59%	0.586	S	S	*	*	H	α-helix	trans	-57.6	-45.7	176.6	-177.2	176.4	176.9	-174.4	2.6	111.8	Q7 V13 S14 D15	Q7-R11 WeakPolarHBondContact O-CB 3.43Å; Q7-R11 PolarHBondContact O-N 3.35Å; R11-V13 VanDerWaalsContact C-N 3.31Å; R11-V13 PolarHBondContact O-N 3.28Å; R11-S14 PolarHBondContact O-N 2.75Å; R11-D15 IonicContact NE-OD2 3.54Å; R11-D15 WeakPolarHBondContact O-CB 3.34Å; R11-D15 PolarHBondContact O-N 3.39Å
12	R	93.9	Very high	88.5	Confident	188 Å²	188	116.8 Å²	116.8	71%	0.709	57%	0.569	S	S	*	*	H	α-helix	trans	-61.7	-37.8	179.6	-164.7	177.6	-153.1	155.4	5.2	113	L8 K9 V10 K16	L8-R12 WeakPolarHBondContact O-CB 3.28Å; L8-R12 PolarHBondContact O-N 3.17Å; K9-R12 PolarHBondContact O-N 3.31Å; V10-R12 VanDerWaalsContact C-N 3.32Å; V10-R12 PolarHBondContact O-N 3.35Å; R12-K16 PolarHBondContact O-N 3.5Å
13	V	94.9	Very high	88.4	Confident	105 Å²	105	114.6 Å²	114.6	64%	0.636	56%	0.56	S	S	*	*	H	α-helix	trans	-70.4	-45.8	176.6	173.2	0	0	0	0	110.8	K9 V10 R11 D15 K16 F17	K9-V13 WeakPolarHBondContact O-CG2 3.36Å; K9-V13 PolarHBondContact O-N 3.32Å; V10-V13 PolarHBondContact O-N 2.92Å; R11-V13 VanDerWaalsContact C-N 3.31Å; R11-V13 PolarHBondContact O-N 3.28Å; V13-D15 PolarHBondContact O-N 2.93Å; V13-K16 PolarHBondContact O-N 3.4Å; V13-F17 WeakPolarHBondContact O-CB 3.34Å; V13-F17 PolarHBondContact O-N 3.3Å
14	S	92.3	Very high	87.8	Confident	66 Å²	66	115.1 Å²	115.1	46%	0.462	56%	0.562	S	S	.	*	H	α-helix	trans	-59.1	-46.8	175.7	-81.4	0	0	0	0	112.2	V10 R11 K16 F17 T18	V10-S14 PolarHBondContact O-N 3.33Å; R11-S14 PolarHBondContact O-N 2.75Å; S14-K16 PolarHBondContact O-N 3Å; S14-F17 PolarHBondContact O-N 2.87Å; S14-F17 VanDerWaalsContact O-N 3.16Å; S14-T18 PolarHBondContact O-N 3.18Å; S14-T18 PolarHBondContact O-OG1 3.28Å
15	D	93.3	Very high	86.9	Confident	89 Å²	89	110.7 Å²	110.7	48%	0.476	55%	0.55	S	S	.	*	H	α-helix	trans	-60.9	-44.8	-179.5	-69	-16.1	0	0	0	111	R11 V13 F17 T18 E19	R11-D15 IonicContact NE-OD2 3.54Å; R11-D15 WeakPolarHBondContact O-CB 3.34Å; R11-D15 PolarHBondContact O-N 3.39Å; V13-D15 PolarHBondContact O-N 2.93Å; D15-F17 VanDerWaalsContact C-N 3.35Å; D15-F17 PolarHBondContact O-N 3.06Å; D15-T18 PolarHBondContact O-N 3.41Å; D15-E19 WeakPolarHBondContact O-CB 3.25Å; D15-E19 PolarHBondContact O-N 2.87Å
16	K	91	Very high	85.9	Confident	137 Å²	137	109.1 Å²	109.1	60%	0.596	55%	0.545	S	S	*	.	H	α-helix	trans	-64.3	-37.4	175.4	-83.2	-155.1	171.6	-162.3	0	113.3	R12 V13 S14 S20	R12-K16 PolarHBondContact O-N 3.5Å; V13-K16 PolarHBondContact O-N 3.4Å; S14-K16 PolarHBondContact O-N 3Å; K16-S20 WeakPolarHBondContact O-CB 3.44Å; K16-S20 PolarHBondContact O-N 2.98Å; K16-S20 PolarHBondContact O-OG 3.34Å
17	F	90.3	Very high	85.1	Confident	138 Å²	138	109.9 Å²	109.9	61%	0.605	55%	0.548	S	S	*	.	H	α-helix	trans	-66.6	-44.8	178	-177.4	-98.5	0	0	0	111	V13 S14 D15 S20 M21	V13-F17 WeakPolarHBondContact O-CB 3.34Å; V13-F17 PolarHBondContact O-N 3.3Å; S14-F17 PolarHBondContact O-N 2.87Å; S14-F17 VanDerWaalsContact O-N 3.16Å; D15-F17 VanDerWaalsContact C-N 3.35Å; D15-F17 PolarHBondContact O-N 3.06Å; F17-S20 PolarHBondContact O-N 3.38Å; F17-M21 HydrophobicContact CD1-CG 4.41Å; F17-M21 HydrophobicContact CE1-CG 4Å; F17-M21 HydrophobicContact CZ-CG 4.09Å; F17-M21 WeakPolarHBondContact O-CG 3.48Å; F17-M21 PolarHBondContact O-N 3.4Å
18	T	89.3	Confident	84.1	Confident	92 Å²	92	107.5 Å²	107.5	56%	0.564	54%	0.542	S	S	*	.	H	α-helix	trans	-61.9	-43.9	175.6	-61.7	0	0	0	0	112.1	S14 D15 M21 Y22	S14-T18 PolarHBondContact O-N 3.18Å; S14-T18 PolarHBondContact O-OG1 3.28Å; D15-T18 PolarHBondContact O-N 3.41Å; T18-M21 PolarHBondContact O-N 3.18Å; T18-Y22 PolarHBondContact O-N 3.4Å
19	E	84	Confident	83.5	Confident	131 Å²	131	105.7 Å²	105.7	61%	0.612	54%	0.539	S	S	*	.	H	α-helix	trans	-61.7	-45.7	176.1	-175.3	178.7	-162.2	0	0	111.8	D15 M21 Y22 V23	D15-E19 WeakPolarHBondContact O-CB 3.25Å; D15-E19 PolarHBondContact O-N 2.87Å; E19-M21 VanDerWaalsContact C-N 3.33Å; E19-M21 PolarHBondContact O-N 3.03Å; E19-Y22 WeakPolarHBondContact O-CB 3.42Å; E19-Y22 PolarHBondContact O-N 2.89Å; E19-Y22 VanDerWaalsContact O-N 3.14Å; E19-V23 WeakPolarHBondContact O-CG2 3.47Å; E19-V23 PolarHBondContact O-N 3.47Å
20	S	78.4	Confident	83	Confident	77 Å²	77	102.5 Å²	102.5	54%	0.538	53%	0.529	S	S	.	.	H	α-helix	trans	-62.5	-40.7	178.4	-58	0	0	0	0	111.9	K16 F17 Y22 V23 L24	K16-S20 WeakPolarHBondContact O-CB 3.44Å; K16-S20 PolarHBondContact O-N 2.98Å; K16-S20 PolarHBondContact O-OG 3.34Å; F17-S20 PolarHBondContact O-N 3.38Å; S20-Y22 VanDerWaalsContact C-N 3.34Å; S20-V23 PolarHBondContact O-N 3.2Å; S20-L24 VanDerWaalsContact O-CB 3.26Å; S20-L24 WeakPolarHBondContact O-CB 3.4Å; S20-L24 PolarHBondContact O-N 3Å
21	M	80.1	Confident	82.4	Confident	93 Å²	93	101 Å²	101	46%	0.458	53%	0.525	S	S	.	.	H	α-helix	trans	-65.4	-36.4	174.6	-79	-61.3	-60.6	0	0	112.5	F17 T18 E19 L24 A25	F17-M21 HydrophobicContact CD1-CG 4.41Å; F17-M21 HydrophobicContact CE1-CG 4Å; F17-M21 HydrophobicContact CZ-CG 4.09Å; F17-M21 WeakPolarHBondContact O-CG 3.48Å; F17-M21 PolarHBondContact O-N 3.4Å; T18-M21 PolarHBondContact O-N 3.18Å; E19-M21 VanDerWaalsContact C-N 3.33Å; E19-M21 PolarHBondContact O-N 3.03Å; M21-L24 PolarHBondContact O-N 2.81Å; M21-L24 HydrophobicContact SD-CD2 4.3Å; M21-A25 VanDerWaalsContact O-CB 3.31Å; M21-A25 WeakPolarHBondContact O-CB 3.36Å; M21-A25 PolarHBondContact O-N 3.19Å
22	Y	76.8	Confident	82.1	Confident	169 Å²	169	98.6 Å²	98.6	66%	0.663	52%	0.524	S	S	*	.	H	α-helix	trans	-66.7	-43.5	177.3	-167.4	-94.8	0	0	0	111.9	T18 E19 S20 N26	T18-Y22 PolarHBondContact O-N 3.4Å; E19-Y22 WeakPolarHBondContact O-CB 3.42Å; E19-Y22 PolarHBondContact O-N 2.89Å; E19-Y22 VanDerWaalsContact O-N 3.14Å; S20-Y22 VanDerWaalsContact C-N 3.34Å; Y22-N26 WeakPolarHBondContact CD1-ND2 3.49Å; Y22-N26 WeakPolarHBondContact CE1-ND2 3.45Å; Y22-N26 WeakPolarHBondContact CE2-ND2 3.3Å; Y22-N26 VanDerWaalsContact CZ-ND2 3.27Å; Y22-N26 WeakPolarHBondContact O-CB 3.12Å; Y22-N26 PolarHBondContact O-N 3.36Å; Y22-N26 PolarHBondContact O-ND2 2.89Å
23	V	72.9	Confident	81.8	Confident	81 Å²	81	96.5 Å²	96.5	49%	0.491	52%	0.517	S	S	.	.	H	α-helix	trans	-62.6	-46.2	173.7	175	0	0	0	0	110.3	E19 S20 A25 N26 E27	E19-V23 WeakPolarHBondContact O-CG2 3.47Å; E19-V23 PolarHBondContact O-N 3.47Å; S20-V23 PolarHBondContact O-N 3.2Å; V23-A25 VanDerWaalsContact C-N 3.34Å; V23-A25 PolarHBondContact O-N 2.99Å; V23-N26 PolarHBondContact O-N 2.91Å; V23-E27 HydrophobicContact CG1-CG 3.98Å; V23-E27 WeakPolarHBondContact O-CB 3.24Å; V23-E27 PolarHBondContact O-N 3.35Å
24	L	69.8	Low	81.5	Confident	116 Å²	116	99.7 Å²	99.7	61%	0.607	52%	0.518	S	S	*	.	H	α-helix	trans	-64.8	-33.3	-178.9	-174.2	65.9	0	0	0	113.3	S20 M21 P28	S20-L24 VanDerWaalsContact O-CB 3.26Å; S20-L24 WeakPolarHBondContact O-CB 3.4Å; S20-L24 PolarHBondContact O-N 3Å; M21-L24 PolarHBondContact O-N 2.81Å; M21-L24 HydrophobicContact SD-CD2 4.3Å; L24-P28 WeakPolarHBondContact O-CD 3.34Å; L24-P28 WeakPolarHBondContact O-CG 3.48Å
25	A	69.9	Low	81.5	Confident	55 Å²	55	101.7 Å²	101.7	46%	0.455	52%	0.523	S	S	.	.	H	α-helix	trans	-79.6	-32.1	179.4	0	0	0	0	0	113	M21 V23 S29	M21-A25 VanDerWaalsContact O-CB 3.31Å; M21-A25 WeakPolarHBondContact O-CB 3.36Å; M21-A25 PolarHBondContact O-N 3.19Å; V23-A25 VanDerWaalsContact C-N 3.34Å; V23-A25 PolarHBondContact O-N 2.99Å; A25-S29 PolarHBondContact O-OG 3.5Å
26	N	69.8	Low	81.6	Confident	63 Å²	63	103.8 Å²	103.8	34%	0.337	53%	0.529	S	S	.	.	H	α-helix	trans	-94.7	-40.7	-171.8	-68.8	-52.5	0	0	0	113.3	Y22 V23 S29 V30	Y22-N26 WeakPolarHBondContact CD1-ND2 3.49Å; Y22-N26 WeakPolarHBondContact CE1-ND2 3.45Å; Y22-N26 WeakPolarHBondContact CE2-ND2 3.3Å; Y22-N26 VanDerWaalsContact CZ-ND2 3.27Å; Y22-N26 WeakPolarHBondContact O-CB 3.12Å; Y22-N26 PolarHBondContact O-N 3.36Å; Y22-N26 PolarHBondContact O-ND2 2.89Å; V23-N26 PolarHBondContact O-N 2.91Å; N26-S29 PolarHBondContact O-N 3.45Å; N26-V30 WeakPolarHBondContact O-CB 3.49Å; N26-V30 VanDerWaalsContact O-CG2 3.27Å; N26-V30 WeakPolarHBondContact O-CG2 3.45Å; N26-V30 PolarHBondContact O-N 3.29Å
27	E	73.9	Confident	81.9	Confident	119 Å²	119	98.9 Å²	98.9	56%	0.556	51%	0.509	S	S	*	.	H	α-helix	trans	-65	-44.1	-176.8	-72.3	-63.5	137.4	0	0	113.4	V23 S29 V30 A31	V23-E27 HydrophobicContact CG1-CG 3.98Å; V23-E27 WeakPolarHBondContact O-CB 3.24Å; V23-E27 PolarHBondContact O-N 3.35Å; E27-S29 VanDerWaalsContact C-N 3.34Å; E27-S29 PolarHBondContact O-N 3Å; E27-V30 PolarHBondContact O-N 3.48Å; E27-A31 WeakPolarHBondContact O-CB 3.49Å; E27-A31 PolarHBondContact O-N 3.34Å
28	P	71.6	Confident	82.2	Confident	62 Å²	62	98.2 Å²	98.2	40%	0.403	51%	0.507	S	S	.	.	H	α-helix	trans	-64.2	-37.9	174.2	-23.6	36.9	0	0	0	112.7	L24 A31 L32	L24-P28 WeakPolarHBondContact O-CD 3.34Å; L24-P28 WeakPolarHBondContact O-CG 3.48Å; P28-A31 PolarHBondContact O-N 3.46Å; P28-L32 WeakPolarHBondContact O-CB 3.49Å; P28-L32 VanDerWaalsContact O-CG 3.3Å; P28-L32 WeakPolarHBondContact O-CG 3.34Å; P28-L32 PolarHBondContact O-N 2.82Å
29	S	81	Confident	82.6	Confident	72 Å²	72	97.6 Å²	97.6	50%	0.503	50%	0.503	S	S	.	.	H	α-helix	trans	-66	-41.6	178.2	-59.4	0	0	0	0	111.8	A25 N26 E27 L32 Y33	A25-S29 PolarHBondContact O-OG 3.5Å; N26-S29 PolarHBondContact O-N 3.45Å; E27-S29 VanDerWaalsContact C-N 3.34Å; E27-S29 PolarHBondContact O-N 3Å; S29-L32 PolarHBondContact O-N 3.44Å; S29-Y33 WeakPolarHBondContact O-CB 3.46Å; S29-Y33 PolarHBondContact O-N 2.94Å
30	V	82.9	Confident	83.2	Confident	56 Å²	56	97.9 Å²	97.9	34%	0.339	50%	0.499	S	S	.	.	H	α-helix	trans	-68.1	-39.6	175.8	171.7	0	0	0	0	111.3	N26 E27 Y33 R34	N26-V30 WeakPolarHBondContact O-CB 3.49Å; N26-V30 VanDerWaalsContact O-CG2 3.27Å; N26-V30 WeakPolarHBondContact O-CG2 3.45Å; N26-V30 PolarHBondContact O-N 3.29Å; E27-V30 PolarHBondContact O-N 3.48Å; V30-Y33 PolarHBondContact O-N 2.99Å; V30-R34 WeakPolarHBondContact O-CG 3.39Å; V30-R34 PolarHBondContact O-N 2.95Å
31	A	82.2	Confident	84.1	Confident	48 Å²	48	102 Å²	102	40%	0.397	50%	0.502	S	S	.	.	H	α-helix	trans	-61.5	-46	174.8	0	0	0	0	0	111.7	E27 P28 Y33 R34 L35	E27-A31 WeakPolarHBondContact O-CB 3.49Å; E27-A31 PolarHBondContact O-N 3.34Å; P28-A31 PolarHBondContact O-N 3.46Å; A31-Y33 PolarHBondContact O-N 2.97Å; A31-R34 PolarHBondContact O-N 3.34Å; A31-L35 WeakPolarHBondContact O-CG 3.39Å; A31-L35 PolarHBondContact O-N 3.3Å
32	L	85.3	Confident	84.9	Confident	114 Å²	114	99.6 Å²	99.6	60%	0.597	50%	0.495	S	S	*	.	H	α-helix	trans	-63.1	-40.2	175.6	-71.9	172.8	0	0	0	112.2	P28 S29 R34 L35 Q36	P28-L32 WeakPolarHBondContact O-CB 3.49Å; P28-L32 VanDerWaalsContact O-CG 3.3Å; P28-L32 WeakPolarHBondContact O-CG 3.34Å; P28-L32 PolarHBondContact O-N 2.82Å; S29-L32 PolarHBondContact O-N 3.44Å; L32-R34 PolarHBondContact O-N 2.97Å; L32-L35 PolarHBondContact O-N 3.4Å; L32-Q36 WeakPolarHBondContact O-CB 3.48Å; L32-Q36 PolarHBondContact O-N 2.95Å
33	Y	88.4	Confident	86	Confident	143 Å²	143	95.8 Å²	95.8	56%	0.561	49%	0.485	S	S	*	.	H	α-helix	trans	-61.3	-43.3	174.8	176.2	-101.4	0	0	0	112.2	S29 V30 A31 L35 Q36 E37	S29-Y33 WeakPolarHBondContact O-CB 3.46Å; S29-Y33 PolarHBondContact O-N 2.94Å; V30-Y33 PolarHBondContact O-N 2.99Å; A31-Y33 PolarHBondContact O-N 2.97Å; Y33-L35 VanDerWaalsContact C-N 3.34Å; Y33-L35 PolarHBondContact O-N 3.38Å; Y33-Q36 PolarHBondContact O-N 2.91Å; Y33-E37 VanDerWaalsContact O-CB 3.29Å; Y33-E37 WeakPolarHBondContact O-CB 3.4Å; Y33-E37 PolarHBondContact O-N 2.97Å
34	R	88.9	Confident	87.2	Confident	173 Å²	173	95.7 Å²	95.7	65%	0.653	49%	0.487	S	S	*	.	H	α-helix	trans	-63.2	-39.8	176.2	-72.2	174.9	179.8	165.5	3.3	112	V30 A31 L32 H38	V30-R34 WeakPolarHBondContact O-CG 3.39Å; V30-R34 PolarHBondContact O-N 2.95Å; A31-R34 PolarHBondContact O-N 3.34Å; L32-R34 PolarHBondContact O-N 2.97Å; R34-H38 WeakPolarHBondContact O-CB 3.26Å; R34-H38 PolarHBondContact O-N 3.47Å
35	L	92.4	Very high	88.5	Confident	108 Å²	108	96.6 Å²	96.6	57%	0.565	49%	0.488	S	S	*	.	H	α-helix	trans	-64.6	-48.3	174.6	-73.4	171.3	0	0	0	111.5	A31 L32 Y33 E37 H38 V39	A31-L35 WeakPolarHBondContact O-CG 3.39Å; A31-L35 PolarHBondContact O-N 3.3Å; L32-L35 PolarHBondContact O-N 3.4Å; Y33-L35 VanDerWaalsContact C-N 3.34Å; Y33-L35 PolarHBondContact O-N 3.38Å; L35-E37 VanDerWaalsContact C-N 3.31Å; L35-E37 PolarHBondContact O-N 3.36Å; L35-H38 PolarHBondContact O-N 3Å; L35-V39 WeakPolarHBondContact O-CG2 3.43Å; L35-V39 PolarHBondContact O-N 2.89Å
36	Q	95.1	Very high	89.9	Confident	132 Å²	132	99.5 Å²	99.5	62%	0.617	50%	0.495	S	S	*	.	H	α-helix	trans	-58	-45.8	177.3	180	-176.8	-17	0	0	111	L32 Y33 V39 R40	L32-Q36 WeakPolarHBondContact O-CB 3.48Å; L32-Q36 PolarHBondContact O-N 2.95Å; Y33-Q36 PolarHBondContact O-N 2.91Å; Q36-V39 PolarHBondContact O-N 3.21Å; Q36-R40 VanDerWaalsContact O-CB 3.27Å; Q36-R40 WeakPolarHBondContact O-CB 3.48Å; Q36-R40 PolarHBondContact O-N 2.81Å
37	E	96.2	Very high	91.2	Very high	35 Å²	35	100.3 Å²	100.3	16%	0.164	50%	0.502	C	S	.	.	H	α-helix	trans	-67.3	-37.9	-179.4	-174.5	63	-172	0	0	111.9	Y33 L35 R40 R41	Y33-E37 VanDerWaalsContact O-CB 3.29Å; Y33-E37 WeakPolarHBondContact O-CB 3.4Å; Y33-E37 PolarHBondContact O-N 2.97Å; L35-E37 VanDerWaalsContact C-N 3.31Å; L35-E37 PolarHBondContact O-N 3.36Å; E37-R40 PolarHBondContact O-N 3.39Å; E37-R40 IonicContact OE1-CZ 3.39Å; E37-R40 IonicContact OE1-NE 3.8Å; E37-R40 IonicContact OE1-NH2 2.82Å; E37-R40 PolarHBondContact OE1-NH2 3.35Å; E37-R40 IonicContact OE2-CZ 3.6Å; E37-R40 IonicContact OE2-NE 3.68Å; E37-R40 PolarHBondContact OE2-NE 3.4Å; E37-R40 IonicContact OE2-NH2 2.7Å; E37-R40 PolarHBondContact OE2-NH2 3.17Å; E37-R41 WeakPolarHBondContact O-CB 3.37Å; E37-R41 VanDerWaalsContact O-CG 3.29Å; E37-R41 WeakPolarHBondContact O-CG 3.49Å; E37-R41 PolarHBondContact O-N 2.97Å; E37-R41 IonicContact OE1-CZ 3.27Å; E37-R41 VanDerWaalsContact OE1-CZ 3.27Å; E37-R41 IonicContact OE1-NE 2.8Å; E37-R41 PolarHBondContact OE1-NE 3.35Å; E37-R41 IonicContact OE1-NH2 2.86Å; E37-R41 PolarHBondContact OE1-NH2 2.86Å
38	H	96.6	Very high	92.4	Very high	124 Å²	124	99.5 Å²	99.5	57%	0.574	50%	0.498	S	S	*	.	H	α-helix	trans	-60.9	-51.5	172.4	176.9	76.8	0	0	0	111.3	R34 L35 R40 R41 S42	R34-H38 WeakPolarHBondContact O-CB 3.26Å; R34-H38 PolarHBondContact O-N 3.47Å; L35-H38 PolarHBondContact O-N 3Å; H38-R40 VanDerWaalsContact C-N 3.31Å; H38-R40 PolarHBondContact O-N 3.43Å; H38-R41 PolarHBondContact O-N 3.49Å; H38-R41 VanDerWaalsContact O-N 3.15Å; H38-S42 PolarHBondContact O-N 3.44Å; H38-S42 PolarHBondContact O-OG 3.43Å
39	V	97.9	Very high	93.7	Very high	78 Å²	78	102.3 Å²	102.3	47%	0.473	51%	0.506	S	S	.	.	H	α-helix	trans	-57.8	-45.3	177.5	171.6	0	0	0	0	110.7	L35 Q36 R41 S42 L43	L35-V39 WeakPolarHBondContact O-CG2 3.43Å; L35-V39 PolarHBondContact O-N 2.89Å; Q36-V39 PolarHBondContact O-N 3.21Å; V39-R41 VanDerWaalsContact C-N 3.26Å; V39-R41 PolarHBondContact O-N 2.88Å; V39-S42 PolarHBondContact O-N 3.07Å; V39-L43 WeakPolarHBondContact O-CB 3.36Å; V39-L43 PolarHBondContact O-N 3.36Å
40	R	97.4	Very high	94.5	Very high	138 Å²	138	105.1 Å²	105.1	52%	0.521	51%	0.509	S	S	.	.	H	α-helix	trans	-60.7	-35	179.4	-168	-166.2	66.5	71	-2.3	112.4	Q36 E37 H38 P44	Q36-R40 VanDerWaalsContact O-CB 3.27Å; Q36-R40 WeakPolarHBondContact O-CB 3.48Å; Q36-R40 PolarHBondContact O-N 2.81Å; E37-R40 PolarHBondContact O-N 3.39Å; E37-R40 IonicContact OE1-CZ 3.39Å; E37-R40 IonicContact OE1-NE 3.8Å; E37-R40 IonicContact OE1-NH2 2.82Å; E37-R40 PolarHBondContact OE1-NH2 3.35Å; E37-R40 IonicContact OE2-CZ 3.6Å; E37-R40 IonicContact OE2-NE 3.68Å; E37-R40 PolarHBondContact OE2-NE 3.4Å; E37-R40 IonicContact OE2-NH2 2.7Å; E37-R40 PolarHBondContact OE2-NH2 3.17Å; H38-R40 VanDerWaalsContact C-N 3.31Å; H38-R40 PolarHBondContact O-N 3.43Å; R40-P44 WeakPolarHBondContact O-CD 3.3Å; R40-P44 WeakPolarHBondContact O-CG 3.3Å
41	R	97.1	Very high	95.3	Very high	162 Å²	162	105.7 Å²	105.7	61%	0.611	51%	0.513	S	S	*	.	H	α-helix	trans	-81.8	-41.4	179.4	-70.9	179.7	-172.4	-152.5	3.2	113	E37 H38 V39	E37-R41 WeakPolarHBondContact O-CB 3.37Å; E37-R41 VanDerWaalsContact O-CG 3.29Å; E37-R41 WeakPolarHBondContact O-CG 3.49Å; E37-R41 PolarHBondContact O-N 2.97Å; E37-R41 IonicContact OE1-CZ 3.27Å; E37-R41 VanDerWaalsContact OE1-CZ 3.27Å; E37-R41 IonicContact OE1-NE 2.8Å; E37-R41 PolarHBondContact OE1-NE 3.35Å; E37-R41 IonicContact OE1-NH2 2.86Å; E37-R41 PolarHBondContact OE1-NH2 2.86Å; H38-R41 PolarHBondContact O-N 3.49Å; H38-R41 VanDerWaalsContact O-N 3.15Å; V39-R41 VanDerWaalsContact C-N 3.26Å; V39-R41 PolarHBondContact O-N 2.88Å
42	S	97.8	Very high	96	Very high	43 Å²	43	106.2 Å²	106.2	30%	0.301	51%	0.509	S	S	.	.	H	α-helix	trans	-84.3	-29.2	-174.4	61.8	0	0	0	0	113.8	H38 V39 E45 L46	H38-S42 PolarHBondContact O-N 3.44Å; H38-S42 PolarHBondContact O-OG 3.43Å; V39-S42 PolarHBondContact O-N 3.07Å; S42-E45 PolarHBondContact O-N 3.29Å; S42-L46 WeakPolarHBondContact O-CB 3.19Å; S42-L46 PolarHBondContact O-N 3.14Å
43	L	98.4	Very high	96.7	Very high	89 Å²	89	107.4 Å²	107.4	47%	0.466	51%	0.513	S	S	.	.	H	α-helix	trans	-63.7	-42.8	-176.1	-174.4	64.4	0	0	0	113.7	V39 E45 L46 V47	V39-L43 WeakPolarHBondContact O-CB 3.36Å; V39-L43 PolarHBondContact O-N 3.36Å; L43-E45 PolarHBondContact O-N 3.14Å; L43-L46 PolarHBondContact O-N 3.48Å; L43-V47 HydrophobicContact CD1-CG2 4.32Å; L43-V47 HydrophobicContact CG-CG2 4.43Å; L43-V47 VanDerWaalsContact O-CG2 3.32Å; L43-V47 WeakPolarHBondContact O-CG2 3.32Å; L43-V47 PolarHBondContact O-N 2.93Å
44	P	98.1	Very high	97.1	Very high	80 Å²	80	105 Å²	105	52%	0.519	51%	0.506	S	S	.	.	H	α-helix	trans	-60.4	-42.4	177	-24.3	35.2	0	0	0	113.1	R40 V47 Q48	R40-P44 WeakPolarHBondContact O-CD 3.3Å; R40-P44 WeakPolarHBondContact O-CG 3.3Å; P44-V47 PolarHBondContact O-N 3.45Å; P44-Q48 PolarHBondContact O-N 3Å
45	E	97.9	Very high	97.6	Very high	135 Å²	135	99.6 Å²	99.6	63%	0.631	50%	0.495	S	S	*	.	H	α-helix	trans	-64.1	-43.2	177	-66.1	179.2	177.2	0	0	111.3	S42 L43 V47 Q48 H49	S42-E45 PolarHBondContact O-N 3.29Å; L43-E45 PolarHBondContact O-N 3.14Å; E45-V47 VanDerWaalsContact C-N 3.34Å; E45-V47 PolarHBondContact O-N 3.01Å; E45-Q48 PolarHBondContact O-N 2.92Å; E45-H49 PolarHBondContact O-N 3.34Å
46	L	98.3	Very high	97.9	Very high	116 Å²	116	102.5 Å²	102.5	61%	0.607	50%	0.499	S	S	*	.	H	α-helix	trans	-62.5	-41.2	176.9	-178.1	62.1	0	0	0	112.2	S42 L43 K50	S42-L46 WeakPolarHBondContact O-CB 3.19Å; S42-L46 PolarHBondContact O-N 3.14Å; L43-L46 PolarHBondContact O-N 3.48Å; L46-K50 WeakPolarHBondContact O-CB 3.25Å; L46-K50 PolarHBondContact O-N 3.44Å
47	V	98.6	Very high	98	Very high	79 Å²	79	101.6 Å²	101.6	48%	0.479	50%	0.495	S	S	.	.	H	α-helix	trans	-64.1	-45.9	176	169.7	0	0	0	0	110.3	L43 P44 E45 K50 T51	L43-V47 HydrophobicContact CD1-CG2 4.32Å; L43-V47 HydrophobicContact CG-CG2 4.43Å; L43-V47 VanDerWaalsContact O-CG2 3.32Å; L43-V47 WeakPolarHBondContact O-CG2 3.32Å; L43-V47 PolarHBondContact O-N 2.93Å; P44-V47 PolarHBondContact O-N 3.45Å; E45-V47 VanDerWaalsContact C-N 3.34Å; E45-V47 PolarHBondContact O-N 3.01Å; V47-K50 WeakPolarHBondContact O-CB 3.41Å; V47-K50 PolarHBondContact O-N 3.31Å; V47-T51 PolarHBondContact O-N 2.87Å; V47-T51 PolarHBondContact O-OG1 3.24Å
48	Q	98.4	Very high	98.1	Very high	103 Å²	103	106.8 Å²	106.8	48%	0.481	52%	0.519	S	S	.	.	H	α-helix	trans	-59.2	-50.4	177.9	-174.7	61	47.4	0	0	111.4	P44 E45 K50 T51 D52	P44-Q48 PolarHBondContact O-N 3Å; E45-Q48 PolarHBondContact O-N 2.92Å; Q48-K50 VanDerWaalsContact C-N 3.27Å; Q48-K50 PolarHBondContact O-N 3.43Å; Q48-T51 PolarHBondContact O-N 3.49Å; Q48-T51 VanDerWaalsContact O-N 3.11Å; Q48-D52 PolarHBondContact NE2-OD1 3.47Å; Q48-D52 VanDerWaalsContact O-CG 3.24Å; Q48-D52 PolarHBondContact O-N 2.84Å
49	H	98.4	Very high	98.2	Very high	121 Å²	121	107 Å²	107	56%	0.56	52%	0.52	S	S	*	.	H	α-helix	trans	-58.7	-40.3	177.8	-77.2	-163.2	0	0	0	112.1	E45 D52 M53	E45-H49 PolarHBondContact O-N 3.34Å; H49-D52 PolarHBondContact O-N 3.48Å; H49-M53 WeakPolarHBondContact O-CB 3.37Å; H49-M53 VanDerWaalsContact O-CG 3.25Å; H49-M53 WeakPolarHBondContact O-CG 3.41Å; H49-M53 PolarHBondContact O-N 3.46Å
50	K	98.4	Very high	98.2	Very high	130 Å²	130	106.3 Å²	106.3	57%	0.565	52%	0.519	S	S	*	.	H	α-helix	trans	-62.1	-45.8	175.9	-178.6	179.3	177.9	178.2	0	111.4	L46 V47 Q48 M53 Q54	L46-K50 WeakPolarHBondContact O-CB 3.25Å; L46-K50 PolarHBondContact O-N 3.44Å; V47-K50 WeakPolarHBondContact O-CB 3.41Å; V47-K50 PolarHBondContact O-N 3.31Å; Q48-K50 VanDerWaalsContact C-N 3.27Å; Q48-K50 PolarHBondContact O-N 3.43Å; K50-M53 PolarHBondContact O-N 3.27Å; K50-Q54 WeakPolarHBondContact O-CG 3.45Å; K50-Q54 PolarHBondContact O-N 3.45Å
51	T	98.4	Very high	98.3	Very high	69 Å²	69	105.2 Å²	105.2	42%	0.423	52%	0.52	S	S	.	.	H	α-helix	trans	-62.9	-43.1	177.5	-64.1	0	0	0	0	111.4	V47 Q48 M53 Q54 S55	V47-T51 PolarHBondContact O-N 2.87Å; V47-T51 PolarHBondContact O-OG1 3.24Å; Q48-T51 PolarHBondContact O-N 3.49Å; Q48-T51 VanDerWaalsContact O-N 3.11Å; T51-M53 PolarHBondContact O-N 2.98Å; T51-Q54 PolarHBondContact O-N 3.27Å; T51-S55 PolarHBondContact O-N 3.41Å
52	D	98.4	Very high	98.3	Very high	59 Å²	59	99.3 Å²	99.3	32%	0.316	51%	0.509	S	S	.	.	H	α-helix	trans	-60.2	-49.9	176.4	-64.2	-20.9	0	0	0	110	Q48 H49 Q54 S55 W56	Q48-D52 PolarHBondContact NE2-OD1 3.47Å; Q48-D52 VanDerWaalsContact O-CG 3.24Å; Q48-D52 PolarHBondContact O-N 2.84Å; H49-D52 PolarHBondContact O-N 3.48Å; D52-Q54 VanDerWaalsContact C-N 3.29Å; D52-Q54 PolarHBondContact O-N 2.9Å; D52-S55 PolarHBondContact O-N 3.34Å; D52-S55 PolarHBondContact O-OG 3Å; D52-W56 PolarHBondContact O-N 2.98Å
53	M	98.5	Very high	98.3	Very high	138 Å²	138	99.8 Å²	99.8	68%	0.68	52%	0.516	S	S	*	.	H	α-helix	trans	-56.9	-40.8	177.5	-74.9	-178.4	71.2	0	0	112.7	H49 K50 T51 W56 E57	H49-M53 WeakPolarHBondContact O-CB 3.37Å; H49-M53 VanDerWaalsContact O-CG 3.25Å; H49-M53 WeakPolarHBondContact O-CG 3.41Å; H49-M53 PolarHBondContact O-N 3.46Å; K50-M53 PolarHBondContact O-N 3.27Å; T51-M53 PolarHBondContact O-N 2.98Å; M53-W56 PolarHBondContact O-N 2.9Å; M53-E57 WeakPolarHBondContact O-CB 3.35Å; M53-E57 PolarHBondContact O-N 3.31Å
54	Q	98.5	Very high	98.3	Very high	92 Å²	92	99.8 Å²	99.8	43%	0.43	52%	0.515	S	S	.	.	H	α-helix	trans	-63.2	-43.4	175.3	-74.1	178.7	-33.5	0	0	111.8	K50 T51 D52 W56 E57 E58	K50-Q54 WeakPolarHBondContact O-CG 3.45Å; K50-Q54 PolarHBondContact O-N 3.45Å; T51-Q54 PolarHBondContact O-N 3.27Å; D52-Q54 VanDerWaalsContact C-N 3.29Å; D52-Q54 PolarHBondContact O-N 2.9Å; Q54-W56 VanDerWaalsContact C-N 3.34Å; Q54-W56 PolarHBondContact O-N 2.87Å; Q54-E57 PolarHBondContact O-N 2.85Å; Q54-E58 WeakPolarHBondContact O-CG 3.48Å; Q54-E58 PolarHBondContact O-N 2.98Å
55	S	98.4	Very high	98.4	Very high	60 Å²	60	103.6 Å²	103.6	42%	0.42	52%	0.521	S	S	.	.	H	α-helix	trans	-63.8	-39.6	177.3	75.1	0	0	0	0	112.5	T51 D52 E57 E58 Q59	T51-S55 PolarHBondContact O-N 3.41Å; D52-S55 PolarHBondContact O-N 3.34Å; D52-S55 PolarHBondContact O-OG 3Å; S55-E57 VanDerWaalsContact C-N 3.35Å; S55-E58 PolarHBondContact O-N 3.24Å; S55-Q59 WeakPolarHBondContact O-CB 3.49Å; S55-Q59 PolarHBondContact O-N 3.19Å
56	W	98.1	Very high	98.4	Very high	170 Å²	170	101.5 Å²	101.5	64%	0.644	52%	0.517	S	S	*	.	H	α-helix	trans	-64.6	-39.9	175	-75.5	112.5	0	0	0	111.9	D52 M53 Q54 S60	D52-W56 PolarHBondContact O-N 2.98Å; M53-W56 PolarHBondContact O-N 2.9Å; Q54-W56 VanDerWaalsContact C-N 3.34Å; Q54-W56 PolarHBondContact O-N 2.87Å; W56-S60 WeakPolarHBondContact O-CB 3.37Å; W56-S60 PolarHBondContact O-N 3.15Å
57	E	98.4	Very high	98.4	Very high	113 Å²	113	100.6 Å²	100.6	53%	0.528	52%	0.516	S	S	.	.	H	α-helix	trans	-63	-49.7	176.8	-177.5	176.2	-167.5	0	0	111.3	M53 Q54 S55 Q59 S60 Q61	M53-E57 WeakPolarHBondContact O-CB 3.35Å; M53-E57 PolarHBondContact O-N 3.31Å; Q54-E57 PolarHBondContact O-N 2.85Å; S55-E57 VanDerWaalsContact C-N 3.35Å; E57-Q59 PolarHBondContact O-N 2.79Å; E57-S60 PolarHBondContact O-N 3.33Å; E57-Q61 WeakPolarHBondContact O-CG 3.49Å; E57-Q61 PolarHBondContact O-N 3.49Å; E57-Q61 PolarHBondContact OE1-NE2 3.43Å
58	E	98.1	Very high	98.4	Very high	144 Å²	144	102.3 Å²	102.3	67%	0.673	52%	0.519	S	S	*	.	H	α-helix	trans	-59.6	-45.4	178.1	-72.4	177.5	-173.5	0	0	111.8	Q54 S55 S60 Q61 G62	Q54-E58 WeakPolarHBondContact O-CG 3.48Å; Q54-E58 PolarHBondContact O-N 2.98Å; S55-E58 PolarHBondContact O-N 3.24Å; E58-S60 PolarHBondContact O-N 3Å; E58-Q61 PolarHBondContact O-N 3.32Å; E58-G62 PolarHBondContact O-N 3.08Å
59	Q	98.4	Very high	98.4	Very high	128 Å²	128	105.1 Å²	105.1	60%	0.598	53%	0.526	S	S	*	.	H	α-helix	trans	-63	-43.3	177.3	-174.9	179	57.9	0	0	111.8	S55 E57 G62 A63	S55-Q59 WeakPolarHBondContact O-CB 3.49Å; S55-Q59 PolarHBondContact O-N 3.19Å; E57-Q59 PolarHBondContact O-N 2.79Å; Q59-G62 PolarHBondContact O-N 3.47Å; Q59-A63 PolarHBondContact O-N 2.92Å
60	S	98.4	Very high	98.4	Very high	64 Å²	64	101.8 Å²	101.8	45%	0.448	52%	0.52	S	S	.	.	H	α-helix	trans	-61.4	-45.3	178.4	-176.8	0	0	0	0	111.4	W56 E57 E58 G62 A63 I64	W56-S60 WeakPolarHBondContact O-CB 3.37Å; W56-S60 PolarHBondContact O-N 3.15Å; E57-S60 PolarHBondContact O-N 3.33Å; E58-S60 PolarHBondContact O-N 3Å; S60-G62 PolarHBondContact O-N 2.97Å; S60-A63 PolarHBondContact O-N 2.86Å; S60-I64 VanDerWaalsContact O-CG1 3.3Å; S60-I64 WeakPolarHBondContact O-CG1 3.2Å; S60-I64 PolarHBondContact O-N 2.91Å
61	Q	98.6	Very high	98.4	Very high	114 Å²	114	99.5 Å²	99.5	53%	0.533	52%	0.519	S	S	.	.	H	α-helix	trans	-62.6	-41.9	177	-70.7	-179.3	15.2	0	0	112.1	E57 E58 A63 I64 Y65	E57-Q61 WeakPolarHBondContact O-CG 3.49Å; E57-Q61 PolarHBondContact O-N 3.49Å; E57-Q61 PolarHBondContact OE1-NE2 3.43Å; E58-Q61 PolarHBondContact O-N 3.32Å; Q61-A63 VanDerWaalsContact C-N 3.35Å; Q61-A63 PolarHBondContact O-N 3.48Å; Q61-I64 PolarHBondContact O-N 3.25Å; Q61-Y65 PolarHBondContact O-N 3.03Å
62	G	98.1	Very high	98.4	Very high	38 Å²	38	99.9 Å²	99.9	39%	0.392	53%	0.525	S	S	.	.	H	α-helix	trans	-61.7	-40.4	174.7	0	0	0	0	0	113.2	E58 Q59 S60 T66	E58-G62 PolarHBondContact O-N 3.08Å; Q59-G62 PolarHBondContact O-N 3.47Å; S60-G62 PolarHBondContact O-N 2.97Å; G62-T66 PolarHBondContact O-N 3.41Å; G62-T66 VanDerWaalsContact O-N 3.08Å; G62-T66 PolarHBondContact O-OG1 3.3Å
63	A	98.3	Very high	98.4	Very high	54 Å²	54	99.1 Å²	99.1	45%	0.446	53%	0.527	S	S	.	.	H	α-helix	trans	-65.1	-43.4	175	0	0	0	0	0	111.9	Q59 S60 Q61 T66 V67	Q59-A63 PolarHBondContact O-N 2.92Å; S60-A63 PolarHBondContact O-N 2.86Å; Q61-A63 VanDerWaalsContact C-N 3.35Å; Q61-A63 PolarHBondContact O-N 3.48Å; A63-T66 PolarHBondContact O-N 2.93Å; A63-V67 WeakPolarHBondContact O-CG2 3.32Å; A63-V67 PolarHBondContact O-N 3.49Å
64	I	98.4	Very high	98.4	Very high	88 Å²	88	96.9 Å²	96.9	45%	0.451	52%	0.521	S	S	.	.	H	α-helix	trans	-58.1	-50.6	175.5	-70.1	164.9	0	0	0	110.2	S60 Q61 T66 V67 E68	S60-I64 VanDerWaalsContact O-CG1 3.3Å; S60-I64 WeakPolarHBondContact O-CG1 3.2Å; S60-I64 PolarHBondContact O-N 2.91Å; Q61-I64 PolarHBondContact O-N 3.25Å; I64-T66 VanDerWaalsContact C-N 3.3Å; I64-T66 PolarHBondContact O-N 2.96Å; I64-V67 PolarHBondContact O-N 2.91Å; I64-V67 VanDerWaalsContact O-N 3.15Å; I64-E68 HydrophobicContact CG2-CG 4.19Å; I64-E68 WeakPolarHBondContact O-CB 3.29Å; I64-E68 WeakPolarHBondContact O-CG 3.48Å; I64-E68 PolarHBondContact O-N 3.46Å
65	Y	98.5	Very high	98.4	Very high	161 Å²	161	99 Å²	99	63%	0.631	53%	0.529	S	S	*	.	H	α-helix	trans	-58.7	-42.2	180	-177.4	-97.4	0	0	0	112.3	Q61 V67 E68 Y69	Q61-Y65 PolarHBondContact O-N 3.03Å; Y65-V67 PolarHBondContact O-N 3.24Å; Y65-E68 PolarHBondContact O-N 2.67Å; Y65-Y69 VanDerWaalsContact O-CB 3.3Å; Y65-Y69 WeakPolarHBondContact O-CB 3.4Å; Y65-Y69 PolarHBondContact O-N 2.93Å
66	T	98.4	Very high	98.3	Very high	90 Å²	90	99.5 Å²	99.5	55%	0.552	53%	0.532	S	S	*	.	H	α-helix	trans	-62.4	-44.2	177.8	-56.8	0	0	0	0	111.5	G62 A63 I64 Y69 A70	G62-T66 PolarHBondContact O-N 3.41Å; G62-T66 VanDerWaalsContact O-N 3.08Å; G62-T66 PolarHBondContact O-OG1 3.3Å; A63-T66 PolarHBondContact O-N 2.93Å; I64-T66 VanDerWaalsContact C-N 3.3Å; I64-T66 PolarHBondContact O-N 2.96Å; T66-Y69 PolarHBondContact O-N 3.01Å; T66-A70 WeakPolarHBondContact O-CB 3.29Å; T66-A70 PolarHBondContact O-N 3.42Å
67	V	98.6	Very high	98.3	Very high	98 Å²	98	97.2 Å²	97.2	59%	0.594	53%	0.53	S	S	*	.	H	α-helix	trans	-66.9	-44.2	178.3	170.6	0	0	0	0	111.2	A63 I64 Y65 Y69 A70 C71	A63-V67 WeakPolarHBondContact O-CG2 3.32Å; A63-V67 PolarHBondContact O-N 3.49Å; I64-V67 PolarHBondContact O-N 2.91Å; I64-V67 VanDerWaalsContact O-N 3.15Å; Y65-V67 PolarHBondContact O-N 3.24Å; V67-Y69 VanDerWaalsContact C-N 3.31Å; V67-Y69 PolarHBondContact O-N 3.44Å; V67-A70 PolarHBondContact O-N 2.83Å; V67-C71 VanDerWaalsContact O-CB 3.26Å; V67-C71 WeakPolarHBondContact O-CB 3.27Å; V67-C71 PolarHBondContact O-N 3Å
68	E	98.3	Very high	98.3	Very high	114 Å²	114	95.9 Å²	95.9	53%	0.533	53%	0.53	S	S	.	.	H	α-helix	trans	-61.8	-40.5	177.3	-73.7	-176.6	155.4	0	0	111.8	I64 Y65 C71 S72	I64-E68 HydrophobicContact CG2-CG 4.19Å; I64-E68 WeakPolarHBondContact O-CB 3.29Å; I64-E68 WeakPolarHBondContact O-CG 3.48Å; I64-E68 PolarHBondContact O-N 3.46Å; Y65-E68 PolarHBondContact O-N 2.67Å; E68-C71 PolarHBondContact O-N 3.23Å; E68-S72 VanDerWaalsContact O-CB 3.32Å; E68-S72 WeakPolarHBondContact O-CB 3.38Å; E68-S72 PolarHBondContact O-N 3.42Å; E68-S72 PolarHBondContact O-OG 3.07Å
69	Y	98.5	Very high	98.2	Very high	162 Å²	162	94.5 Å²	94.5	64%	0.635	53%	0.527	S	S	*	.	H	α-helix	trans	-62.7	-49.1	174.9	-179.5	-103.9	0	0	0	111.6	Y65 T66 V67 C71 S72 A73	Y65-Y69 VanDerWaalsContact O-CB 3.3Å; Y65-Y69 WeakPolarHBondContact O-CB 3.4Å; Y65-Y69 PolarHBondContact O-N 2.93Å; T66-Y69 PolarHBondContact O-N 3.01Å; V67-Y69 VanDerWaalsContact C-N 3.31Å; V67-Y69 PolarHBondContact O-N 3.44Å; Y69-C71 PolarHBondContact O-N 3.3Å; Y69-S72 PolarHBondContact O-N 2.9Å; Y69-A73 PolarHBondContact O-N 3.3Å
70	A	98.6	Very high	98.2	Very high	52 Å²	52	90 Å²	90	43%	0.43	51%	0.51	S	S	.	.	H	α-helix	trans	-61.2	-43.7	177.2	0	0	0	0	0	111.9	T66 V67 S72 A73 V74	T66-A70 WeakPolarHBondContact O-CB 3.29Å; T66-A70 PolarHBondContact O-N 3.42Å; V67-A70 PolarHBondContact O-N 2.83Å; A70-S72 VanDerWaalsContact C-N 3.34Å; A70-S72 PolarHBondContact O-N 2.99Å; A70-A73 PolarHBondContact O-N 3.4Å; A70-V74 WeakPolarHBondContact O-CG2 3.47Å; A70-V74 PolarHBondContact O-N 3.5Å
71	C	98.3	Very high	98.2	Very high	81 Å²	81	89.2 Å²	89.2	55%	0.547	50%	0.504	S	S	.	.	H	α-helix	trans	-60.9	-43.5	176.8	-173.3	0	0	0	0	111.4	V67 E68 Y69 A73 V74 K75	V67-C71 VanDerWaalsContact O-CB 3.26Å; V67-C71 WeakPolarHBondContact O-CB 3.27Å; V67-C71 PolarHBondContact O-N 3Å; E68-C71 PolarHBondContact O-N 3.23Å; Y69-C71 PolarHBondContact O-N 3.3Å; C71-A73 PolarHBondContact O-N 3.39Å; C71-V74 PolarHBondContact O-N 3Å; C71-K75 WeakPolarHBondContact O-CB 3.46Å; C71-K75 PolarHBondContact O-N 3.46Å
72	S	98.4	Very high	98.1	Very high	77 Å²	77	87.9 Å²	87.9	54%	0.538	50%	0.503	S	S	.	.	H	α-helix	trans	-62.4	-41.5	176.8	-62.1	0	0	0	0	112	E68 Y69 A70 K75 S76	E68-S72 VanDerWaalsContact O-CB 3.32Å; E68-S72 WeakPolarHBondContact O-CB 3.38Å; E68-S72 PolarHBondContact O-N 3.42Å; E68-S72 PolarHBondContact O-OG 3.07Å; Y69-S72 PolarHBondContact O-N 2.9Å; A70-S72 VanDerWaalsContact C-N 3.34Å; A70-S72 PolarHBondContact O-N 2.99Å; S72-K75 PolarHBondContact O-N 3.29Å; S72-S76 WeakPolarHBondContact O-CB 3.47Å; S72-S76 PolarHBondContact O-N 3.27Å
73	A	98.3	Very high	98.1	Very high	44 Å²	44	93.5 Å²	93.5	36%	0.364	51%	0.514	S	S	.	.	H	α-helix	trans	-62.8	-48	175.2	0	0	0	0	0	111.8	Y69 A70 C71 K75 S76 M77	Y69-A73 PolarHBondContact O-N 3.3Å; A70-A73 PolarHBondContact O-N 3.4Å; C71-A73 PolarHBondContact O-N 3.39Å; A73-K75 VanDerWaalsContact C-N 3.32Å; A73-K75 PolarHBondContact O-N 2.92Å; A73-S76 WeakPolarHBondContact O-CB 3.37Å; A73-S76 PolarHBondContact O-N 2.99Å; A73-M77 WeakPolarHBondContact O-CG 3.07Å; A73-M77 PolarHBondContact O-N 2.98Å
74	V	98.3	Very high	98.1	Very high	91 Å²	91	96.3 Å²	96.3	55%	0.552	52%	0.516	S	S	*	.	H	α-helix	trans	-60.5	-42.3	177	171.6	0	0	0	0	111.4	A70 C71 M77 T78	A70-V74 WeakPolarHBondContact O-CG2 3.47Å; A70-V74 PolarHBondContact O-N 3.5Å; C71-V74 PolarHBondContact O-N 3Å; V74-M77 PolarHBondContact O-N 3.49Å; V74-T78 WeakPolarHBondContact O-CB 3.4Å; V74-T78 PolarHBondContact O-N 3.45Å; V74-T78 PolarHBondContact O-OG1 3.03Å
75	K	98.3	Very high	98.1	Very high	137 Å²	137	98.8 Å²	98.8	60%	0.596	52%	0.524	S	S	*	.	H	α-helix	trans	-63.4	-42.9	176.3	-170.8	174	-176.3	175.5	0	111.5	C71 S72 A73 M77 T78 N79	C71-K75 WeakPolarHBondContact O-CB 3.46Å; C71-K75 PolarHBondContact O-N 3.46Å; S72-K75 PolarHBondContact O-N 3.29Å; A73-K75 VanDerWaalsContact C-N 3.32Å; A73-K75 PolarHBondContact O-N 2.92Å; K75-M77 PolarHBondContact O-N 2.86Å; K75-T78 PolarHBondContact O-N 3.11Å; K75-N79 WeakPolarHBondContact O-CB 3.45Å; K75-N79 PolarHBondContact O-N 3.4Å; K75-N79 PolarHBondContact O-OD1 3.37Å
76	S	98	Very high	98.1	Very high	69 Å²	69	95.2 Å²	95.2	48%	0.483	52%	0.516	S	S	.	.	H	α-helix	trans	-60.8	-43.1	175.3	-173.5	0	0	0	0	112.2	S72 A73 T78 N79 S80	S72-S76 WeakPolarHBondContact O-CB 3.47Å; S72-S76 PolarHBondContact O-N 3.27Å; A73-S76 WeakPolarHBondContact O-CB 3.37Å; A73-S76 PolarHBondContact O-N 2.99Å; S76-T78 VanDerWaalsContact C-N 3.35Å; S76-T78 PolarHBondContact O-N 2.86Å; S76-N79 PolarHBondContact O-N 3.45Å; S76-S80 WeakPolarHBondContact O-CB 3.38Å; S76-S80 PolarHBondContact O-N 2.93Å; S76-S80 PolarHBondContact O-OG 2.94Å
77	M	97.3	Very high	98.1	Very high	122 Å²	122	95.4 Å²	95.4	60%	0.601	51%	0.512	S	S	*	.	H	α-helix	trans	-62.3	-42.6	174.5	-69.9	178.5	67.5	0	0	111.8	A73 V74 K75 S80 S81	A73-M77 WeakPolarHBondContact O-CG 3.07Å; A73-M77 PolarHBondContact O-N 2.98Å; V74-M77 PolarHBondContact O-N 3.49Å; K75-M77 PolarHBondContact O-N 2.86Å; M77-S80 PolarHBondContact O-N 3.3Å; M77-S80 VanDerWaalsContact O-N 3.14Å; M77-S81 PolarHBondContact O-N 3.45Å
78	T	97.6	Very high	98	Very high	86 Å²	86	94 Å²	94	53%	0.528	50%	0.502	S	S	.	.	H	α-helix	trans	-63.1	-44.1	177.5	-56.5	0	0	0	0	111.2	V74 K75 S76 S80 S81	V74-T78 WeakPolarHBondContact O-CB 3.4Å; V74-T78 PolarHBondContact O-N 3.45Å; V74-T78 PolarHBondContact O-OG1 3.03Å; K75-T78 PolarHBondContact O-N 3.11Å; S76-T78 VanDerWaalsContact C-N 3.35Å; S76-T78 PolarHBondContact O-N 2.86Å; T78-S80 PolarHBondContact O-N 2.8Å; T78-S81 WeakPolarHBondContact O-CB 3.38Å; T78-S81 PolarHBondContact O-N 2.94Å; T78-S81 VanDerWaalsContact O-N 3.07Å; T78-S81 PolarHBondContact O-OG 2.94Å
79	N	97.6	Very high	98	Very high	114 Å²	114	91.7 Å²	91.7	61%	0.61	50%	0.495	S	S	*	.	H	α-helix	trans	-62.8	-28.7	175.4	-70.1	-9.7	0	0	0	112.3	K75 S76 S81	K75-N79 WeakPolarHBondContact O-CB 3.45Å; K75-N79 PolarHBondContact O-N 3.4Å; K75-N79 PolarHBondContact O-OD1 3.37Å; S76-N79 PolarHBondContact O-N 3.45Å; N79-S81 VanDerWaalsContact C-N 3.26Å; N79-S81 PolarHBondContact O-N 2.96Å
80	S	98	Very high	98	Very high	34 Å²	34	89.2 Å²	89.2	24%	0.238	49%	0.492	C	S	.	.	T	Hydrogen-bonded Turn	trans	-82.1	0.2	177.3	-56.4	0	0	0	0	113.8	S76 M77 T78 V82 Y83 F84	S76-S80 WeakPolarHBondContact O-CB 3.38Å; S76-S80 PolarHBondContact O-N 2.93Å; S76-S80 PolarHBondContact O-OG 2.94Å; M77-S80 PolarHBondContact O-N 3.3Å; M77-S80 VanDerWaalsContact O-N 3.14Å; T78-S80 PolarHBondContact O-N 2.8Å; S80-V82 PolarHBondContact O-N 3.38Å; S80-V82 VanDerWaalsContact O-N 3.14Å; S80-Y83 WeakPolarHBondContact O-CB 3.39Å; S80-Y83 PolarHBondContact O-N 3.45Å; S80-F84 WeakPolarHBondContact O-CD2 3.3Å; S80-F84 PolarHBondContact O-N 2.87Å; S80-F84 VanDerWaalsContact O-N 3.17Å
81	S	97.6	Very high	98	Very high	48 Å²	48	91.7 Å²	91.7	34%	0.336	50%	0.498	S	S	.	.	H	α-helix	trans	-55.1	-33.8	-176.4	59.8	0	0	0	0	114.4	M77 T78 N79 F84 K85	M77-S81 PolarHBondContact O-N 3.45Å; T78-S81 WeakPolarHBondContact O-CB 3.38Å; T78-S81 PolarHBondContact O-N 2.94Å; T78-S81 VanDerWaalsContact O-N 3.07Å; T78-S81 PolarHBondContact O-OG 2.94Å; N79-S81 VanDerWaalsContact C-N 3.26Å; N79-S81 PolarHBondContact O-N 2.96Å; S81-F84 PolarHBondContact O-N 3.24Å; S81-K85 WeakPolarHBondContact O-CG 3.48Å; S81-K85 PolarHBondContact O-N 2.96Å
82	V	97.4	Very high	98	Very high	85 Å²	85	95.2 Å²	95.2	52%	0.515	50%	0.5	S	S	.	.	H	α-helix	trans	-63.5	-43.9	176.7	177	0	0	0	0	110.9	S80 K85 N86	S80-V82 PolarHBondContact O-N 3.38Å; S80-V82 VanDerWaalsContact O-N 3.14Å; V82-K85 PolarHBondContact O-N 3.15Å; V82-N86 PolarHBondContact O-N 3.39Å; V82-N86 PolarHBondContact O-ND2 2.88Å; V82-N86 PolarHBondContact O-OD1 3.04Å
83	Y	98	Very high	98	Very high	157 Å²	157	97 Å²	97	62%	0.616	50%	0.5	S	S	*	.	H	α-helix	trans	-65	-43.3	177.3	-58	-65.1	0	0	0	111.2	S80 K85 N86 I87	S80-Y83 WeakPolarHBondContact O-CB 3.39Å; S80-Y83 PolarHBondContact O-N 3.45Å; Y83-K85 VanDerWaalsContact C-N 3.33Å; Y83-K85 PolarHBondContact O-N 2.85Å; Y83-N86 PolarHBondContact O-N 2.7Å; Y83-I87 WeakPolarHBondContact O-CB 3.24Å; Y83-I87 WeakPolarHBondContact O-CD1 3.27Å; Y83-I87 VanDerWaalsContact O-CG1 3.24Å; Y83-I87 WeakPolarHBondContact O-CG1 3.12Å; Y83-I87 PolarHBondContact O-N 3.39Å
84	F	97.9	Very high	98	Very high	113 Å²	113	97.8 Å²	97.8	50%	0.496	51%	0.506	S	S	.	.	H	α-helix	trans	-60.2	-41.5	176.4	-61.6	-42.7	0	0	0	112.4	S80 S81 I87 D88	S80-F84 WeakPolarHBondContact O-CD2 3.3Å; S80-F84 PolarHBondContact O-N 2.87Å; S80-F84 VanDerWaalsContact O-N 3.17Å; S81-F84 PolarHBondContact O-N 3.24Å; F84-I87 PolarHBondContact O-N 2.82Å; F84-D88 WeakPolarHBondContact O-CB 3.43Å; F84-D88 PolarHBondContact O-N 3.41Å
85	K	98.1	Very high	98	Very high	140 Å²	140	98.1 Å²	98.1	61%	0.609	50%	0.503	S	S	*	.	H	α-helix	trans	-64.2	-41.7	174.9	-74.4	177.2	-179.5	179.3	0	112.7	S81 V82 Y83 D88 T89	S81-K85 WeakPolarHBondContact O-CG 3.48Å; S81-K85 PolarHBondContact O-N 2.96Å; V82-K85 PolarHBondContact O-N 3.15Å; Y83-K85 VanDerWaalsContact C-N 3.33Å; Y83-K85 PolarHBondContact O-N 2.85Å; K85-D88 PolarHBondContact O-N 3.03Å; K85-T89 WeakPolarHBondContact O-CB 3.36Å; K85-T89 PolarHBondContact O-N 3.3Å; K85-T89 PolarHBondContact O-OG1 3.35Å
86	N	98.3	Very high	97.9	Very high	86 Å²	86	94.9 Å²	94.9	46%	0.46	50%	0.495	S	S	.	.	H	α-helix	trans	-64.1	-44.2	177.8	-69.6	-11.4	0	0	0	111	V82 Y83 T89 L90	V82-N86 PolarHBondContact O-N 3.39Å; V82-N86 PolarHBondContact O-ND2 2.88Å; V82-N86 PolarHBondContact O-OD1 3.04Å; Y83-N86 PolarHBondContact O-N 2.7Å; N86-T89 PolarHBondContact O-N 3.3Å; N86-L90 WeakPolarHBondContact O-CB 3.46Å; N86-L90 WeakPolarHBondContact O-CG 2.95Å; N86-L90 PolarHBondContact O-N 2.85Å
87	I	98.3	Very high	97.9	Very high	94 Å²	94	97.3 Å²	97.3	48%	0.482	50%	0.5	S	S	.	.	H	α-helix	trans	-61.1	-48.8	176	-67.4	163.4	0	0	0	110.6	Y83 F84 T89 L90 L91	Y83-I87 WeakPolarHBondContact O-CB 3.24Å; Y83-I87 WeakPolarHBondContact O-CD1 3.27Å; Y83-I87 VanDerWaalsContact O-CG1 3.24Å; Y83-I87 WeakPolarHBondContact O-CG1 3.12Å; Y83-I87 PolarHBondContact O-N 3.39Å; F84-I87 PolarHBondContact O-N 2.82Å; I87-T89 VanDerWaalsContact C-N 3.33Å; I87-T89 PolarHBondContact O-N 2.98Å; I87-L90 PolarHBondContact O-N 3.36Å; I87-L91 HydrophobicContact CG2-CD1 3.88Å; I87-L91 HydrophobicContact CG2-CG 4.39Å; I87-L91 WeakPolarHBondContact O-CB 3.48Å; I87-L91 VanDerWaalsContact O-CG 3.3Å; I87-L91 WeakPolarHBondContact O-CG 3.26Å; I87-L91 PolarHBondContact O-N 2.94Å
88	D	98	Very high	97.9	Very high	69 Å²	69	98.9 Å²	98.9	37%	0.369	50%	0.504	S	S	.	.	H	α-helix	trans	-57.7	-45.1	177.2	174.7	81.3	0	0	0	111.7	F84 K85 L91 R92	F84-D88 WeakPolarHBondContact O-CB 3.43Å; F84-D88 PolarHBondContact O-N 3.41Å; K85-D88 PolarHBondContact O-N 3.03Å; D88-L91 PolarHBondContact O-N 3.47Å; D88-R92 VanDerWaalsContact CG-NE 3.34Å; D88-R92 WeakPolarHBondContact O-CG 3.41Å; D88-R92 PolarHBondContact O-N 3.29Å; D88-R92 IonicContact OD1-CZ 3.45Å; D88-R92 IonicContact OD1-NE 3.19Å; D88-R92 PolarHBondContact OD1-NE 3.29Å; D88-R92 IonicContact OD1-NH2 2.89Å; D88-R92 PolarHBondContact OD1-NH2 2.96Å; D88-R92 IonicContact OD2-CZ 3.66Å; D88-R92 IonicContact OD2-NE 2.81Å; D88-R92 PolarHBondContact OD2-NE 2.99Å; D88-R92 IonicContact OD2-NH2 3.59Å
89	T	98.4	Very high	97.8	Very high	65 Å²	65	100.1 Å²	100.1	40%	0.399	50%	0.504	S	S	.	.	H	α-helix	trans	-62.4	-47.6	179.5	-57.1	0	0	0	0	111.6	K85 N86 I87 L91 R92 Q93	K85-T89 WeakPolarHBondContact O-CB 3.36Å; K85-T89 PolarHBondContact O-N 3.3Å; K85-T89 PolarHBondContact O-OG1 3.35Å; N86-T89 PolarHBondContact O-N 3.3Å; I87-T89 VanDerWaalsContact C-N 3.33Å; I87-T89 PolarHBondContact O-N 2.98Å; T89-L91 VanDerWaalsContact C-N 3.34Å; T89-L91 PolarHBondContact O-N 3.49Å; T89-R92 PolarHBondContact O-N 3.5Å; T89-Q93 WeakPolarHBondContact O-CG 3.45Å; T89-Q93 PolarHBondContact O-N 3.47Å
90	L	98.4	Very high	97.6	Very high	109 Å²	109	99.8 Å²	99.8	57%	0.571	50%	0.498	S	S	*	.	H	α-helix	trans	-62.9	-40.9	179	-75.4	169.1	0	0	0	111.8	N86 I87 Q93 A94	N86-L90 WeakPolarHBondContact O-CB 3.46Å; N86-L90 WeakPolarHBondContact O-CG 2.95Å; N86-L90 PolarHBondContact O-N 2.85Å; I87-L90 PolarHBondContact O-N 3.36Å; L90-Q93 PolarHBondContact O-N 2.96Å; L90-A94 WeakPolarHBondContact O-CB 3.31Å; L90-A94 PolarHBondContact O-N 3.27Å
91	L	98.4	Very high	97.4	Very high	105 Å²	105	102.5 Å²	102.5	55%	0.55	51%	0.509	S	S	.	.	H	α-helix	trans	-62.9	-43.8	176.6	-73.3	173.3	0	0	0	111.6	I87 D88 T89 Q93 A94 I95	I87-L91 HydrophobicContact CG2-CD1 3.88Å; I87-L91 HydrophobicContact CG2-CG 4.39Å; I87-L91 WeakPolarHBondContact O-CB 3.48Å; I87-L91 VanDerWaalsContact O-CG 3.3Å; I87-L91 WeakPolarHBondContact O-CG 3.26Å; I87-L91 PolarHBondContact O-N 2.94Å; D88-L91 PolarHBondContact O-N 3.47Å; T89-L91 VanDerWaalsContact C-N 3.34Å; T89-L91 PolarHBondContact O-N 3.49Å; L91-Q93 PolarHBondContact O-N 3.49Å; L91-A94 PolarHBondContact O-N 3.4Å; L91-I95 WeakPolarHBondContact O-CD1 3.35Å; L91-I95 VanDerWaalsContact O-CG1 3.25Å; L91-I95 WeakPolarHBondContact O-CG1 3.45Å; L91-I95 PolarHBondContact O-N 2.94Å
92	R	98.2	Very high	97.2	Very high	154 Å²	154	103.7 Å²	103.7	58%	0.581	52%	0.518	S	S	*	.	H	α-helix	trans	-60.7	-45.7	175.4	-70.8	174.1	-169.3	-72.3	-13.6	111.9	D88 T89 A94 I95 T96	D88-R92 VanDerWaalsContact CG-NE 3.34Å; D88-R92 WeakPolarHBondContact O-CG 3.41Å; D88-R92 PolarHBondContact O-N 3.29Å; D88-R92 IonicContact OD1-CZ 3.45Å; D88-R92 IonicContact OD1-NE 3.19Å; D88-R92 PolarHBondContact OD1-NE 3.29Å; D88-R92 IonicContact OD1-NH2 2.89Å; D88-R92 PolarHBondContact OD1-NH2 2.96Å; D88-R92 IonicContact OD2-CZ 3.66Å; D88-R92 IonicContact OD2-NE 2.81Å; D88-R92 PolarHBondContact OD2-NE 2.99Å; D88-R92 IonicContact OD2-NH2 3.59Å; T89-R92 PolarHBondContact O-N 3.5Å; R92-A94 PolarHBondContact O-N 3.41Å; R92-I95 PolarHBondContact O-N 2.9Å; R92-T96 PolarHBondContact O-N 3.45Å; R92-T96 PolarHBondContact O-OG1 3.43Å
93	Q	98.1	Very high	96.8	Very high	116 Å²	116	104.7 Å²	104.7	54%	0.542	52%	0.52	S	S	.	.	H	α-helix	trans	-60.2	-45	177.2	-73	175.4	-19.8	0	0	111.7	T89 L90 L91 I95 T96 M97	T89-Q93 WeakPolarHBondContact O-CG 3.45Å; T89-Q93 PolarHBondContact O-N 3.47Å; L90-Q93 PolarHBondContact O-N 2.96Å; L91-Q93 PolarHBondContact O-N 3.49Å; Q93-I95 VanDerWaalsContact C-N 3.34Å; Q93-I95 PolarHBondContact O-N 3.14Å; Q93-T96 PolarHBondContact O-N 2.97Å; Q93-M97 WeakPolarHBondContact O-CB 3.36Å; Q93-M97 PolarHBondContact O-N 3.42Å
94	A	98.3	Very high	96.2	Very high	59 Å²	59	104.9 Å²	104.9	49%	0.488	52%	0.521	S	S	.	.	H	α-helix	trans	-62.1	-40.6	177.9	0	0	0	0	0	112.2	L90 L91 R92 M97 K98	L90-A94 WeakPolarHBondContact O-CB 3.31Å; L90-A94 PolarHBondContact O-N 3.27Å; L91-A94 PolarHBondContact O-N 3.4Å; R92-A94 PolarHBondContact O-N 3.41Å; A94-M97 PolarHBondContact O-N 2.83Å; A94-K98 WeakPolarHBondContact O-CB 3.45Å; A94-K98 PolarHBondContact O-N 3.01Å
95	I	97.5	Very high	95.3	Very high	98 Å²	98	103.5 Å²	103.5	50%	0.503	52%	0.519	S	S	.	.	H	α-helix	trans	-61.8	-51.1	175.5	-68.9	163.6	0	0	0	110.5	L91 R92 Q93 M97 K98 E99	L91-I95 WeakPolarHBondContact O-CD1 3.35Å; L91-I95 VanDerWaalsContact O-CG1 3.25Å; L91-I95 WeakPolarHBondContact O-CG1 3.45Å; L91-I95 PolarHBondContact O-N 2.94Å; R92-I95 PolarHBondContact O-N 2.9Å; Q93-I95 VanDerWaalsContact C-N 3.34Å; Q93-I95 PolarHBondContact O-N 3.14Å; I95-M97 VanDerWaalsContact C-N 3.31Å; I95-M97 PolarHBondContact O-N 3.39Å; I95-K98 WeakPolarHBondContact O-CB 3.42Å; I95-K98 PolarHBondContact O-N 3.19Å; I95-E99 PolarHBondContact O-N 2.83Å
96	T	97.6	Very high	94.2	Very high	69 Å²	69	98.4 Å²	98.4	42%	0.423	51%	0.506	S	S	.	.	H	α-helix	trans	-60.2	-42.2	179	-58.2	0	0	0	0	111.8	R92 Q93 K98 E99 Q100	R92-T96 PolarHBondContact O-N 3.45Å; R92-T96 PolarHBondContact O-OG1 3.43Å; Q93-T96 PolarHBondContact O-N 2.97Å; T96-K98 VanDerWaalsContact C-N 3.35Å; T96-K98 PolarHBondContact O-N 3.4Å; T96-E99 PolarHBondContact O-N 3.22Å; T96-Q100 WeakPolarHBondContact O-CG 3.43Å; T96-Q100 PolarHBondContact O-N 2.9Å
97	M	97.1	Very high	92.7	Very high	121 Å²	121	103.5 Å²	103.5	60%	0.596	52%	0.518	S	S	*	.	H	α-helix	trans	-63.7	-41	178.4	-168.5	176.7	-125.8	0	0	111.6	Q93 A94 I95 Q100 I101	Q93-M97 WeakPolarHBondContact O-CB 3.36Å; Q93-M97 PolarHBondContact O-N 3.42Å; A94-M97 PolarHBondContact O-N 2.83Å; I95-M97 VanDerWaalsContact C-N 3.31Å; I95-M97 PolarHBondContact O-N 3.39Å; M97-Q100 PolarHBondContact O-N 3.39Å; M97-I101 HydrophobicContact CG-CD1 4.08Å; M97-I101 VanDerWaalsContact O-CG1 3.28Å; M97-I101 WeakPolarHBondContact O-CG1 3.33Å; M97-I101 PolarHBondContact O-N 2.98Å
98	K	96.4	Very high	91	Very high	155 Å²	155	108.2 Å²	108.2	67%	0.674	53%	0.53	S	S	*	.	H	α-helix	trans	-59.3	-46.9	173.9	-178.9	-157	169.9	-170	0	111.4	A94 I95 T96 I101 S102	A94-K98 WeakPolarHBondContact O-CB 3.45Å; A94-K98 PolarHBondContact O-N 3.01Å; I95-K98 WeakPolarHBondContact O-CB 3.42Å; I95-K98 PolarHBondContact O-N 3.19Å; T96-K98 VanDerWaalsContact C-N 3.35Å; T96-K98 PolarHBondContact O-N 3.4Å; K98-I101 PolarHBondContact O-N 3.36Å; K98-S102 WeakPolarHBondContact O-CB 3.38Å; K98-S102 PolarHBondContact O-N 3.15Å
99	E	95.5	Very high	89.3	Confident	112 Å²	112	111.7 Å²	111.7	52%	0.523	54%	0.544	S	S	.	.	H	α-helix	trans	-62.1	-43.6	179.2	-74.1	177	171.7	0	0	111.9	I95 T96 I101 S102 N103	I95-E99 PolarHBondContact O-N 2.83Å; T96-E99 PolarHBondContact O-N 3.22Å; E99-I101 PolarHBondContact O-N 2.94Å; E99-S102 PolarHBondContact O-N 3.16Å; E99-N103 WeakPolarHBondContact O-CB 3.16Å; E99-N103 PolarHBondContact O-N 3.46Å; E99-N103 PolarHBondContact O-ND2 2.97Å
100	Q	94.4	Very high	87.4	Confident	106 Å²	106	114.3 Å²	114.3	50%	0.495	56%	0.556	S	S	.	*	H	α-helix	trans	-57.2	-51.9	174.6	-71.8	174.6	-7.3	0	0	110.9	T96 M97 S102 N103 Y104	T96-Q100 WeakPolarHBondContact O-CG 3.43Å; T96-Q100 PolarHBondContact O-N 2.9Å; M97-Q100 PolarHBondContact O-N 3.39Å; Q100-S102 VanDerWaalsContact C-N 3.33Å; Q100-S102 PolarHBondContact O-N 3.42Å; Q100-N103 PolarHBondContact O-N 2.75Å; Q100-Y104 WeakPolarHBondContact O-CD2 3.46Å; Q100-Y104 PolarHBondContact O-N 2.9Å
101	I	93.6	Very high	85.5	Confident	91 Å²	91	114.7 Å²	114.7	47%	0.467	56%	0.559	S	S	.	*	H	α-helix	trans	-59.7	-44.1	179.2	-66.9	165.5	0	0	0	111	M97 K98 E99 N103 Y104 N105	M97-I101 HydrophobicContact CG-CD1 4.08Å; M97-I101 VanDerWaalsContact O-CG1 3.28Å; M97-I101 WeakPolarHBondContact O-CG1 3.33Å; M97-I101 PolarHBondContact O-N 2.98Å; K98-I101 PolarHBondContact O-N 3.36Å; E99-I101 PolarHBondContact O-N 2.94Å; I101-N103 VanDerWaalsContact C-N 3.31Å; I101-N103 PolarHBondContact O-N 3.39Å; I101-Y104 PolarHBondContact O-N 3.16Å; I101-N105 WeakPolarHBondContact O-CB 3.32Å; I101-N105 PolarHBondContact O-N 3.02Å
102	S	92.8	Very high	83.6	Confident	74 Å²	74	113.6 Å²	113.6	52%	0.517	56%	0.564	S	S	.	*	H	α-helix	trans	-59.5	-42.8	177.5	-169.5	0	0	0	0	111.6	K98 E99 Q100 N105 G106	K98-S102 WeakPolarHBondContact O-CB 3.38Å; K98-S102 PolarHBondContact O-N 3.15Å; E99-S102 PolarHBondContact O-N 3.16Å; Q100-S102 VanDerWaalsContact C-N 3.33Å; Q100-S102 PolarHBondContact O-N 3.42Å; S102-N105 PolarHBondContact O-N 2.97Å; S102-G106 PolarHBondContact O-N 3.4Å
103	N	90.2	Very high	81.6	Confident	106 Å²	106	111.9 Å²	111.9	57%	0.567	57%	0.571	S	S	*	*	H	α-helix	trans	-68	-39.3	178.2	-69.6	-17.6	0	0	0	112.3	E99 Q100 I101 R107	E99-N103 WeakPolarHBondContact O-CB 3.16Å; E99-N103 PolarHBondContact O-N 3.46Å; E99-N103 PolarHBondContact O-ND2 2.97Å; Q100-N103 PolarHBondContact O-N 2.75Å; I101-N103 VanDerWaalsContact C-N 3.31Å; I101-N103 PolarHBondContact O-N 3.39Å; N103-R107 WeakPolarHBondContact O-CG 3.49Å; N103-R107 PolarHBondContact O-N 2.95Å; N103-R107 VanDerWaalsContact O-N 3.12Å
104	Y	84.1	Confident	79.4	Confident	160 Å²	160	110.2 Å²	110.2	63%	0.627	57%	0.572	S	S	*	*	H	α-helix	trans	-64.6	-42.8	173.4	-84.3	-75.1	0	0	0	112	Q100 I101 R107 R108	Q100-Y104 WeakPolarHBondContact O-CD2 3.46Å; Q100-Y104 PolarHBondContact O-N 2.9Å; I101-Y104 PolarHBondContact O-N 3.16Å; Y104-R107 PolarHBondContact O-N 3.36Å; Y104-R108 PolarHBondContact O-N 3.01Å
105	N	80.1	Confident	77.2	Confident	85 Å²	85	112 Å²	112	46%	0.455	58%	0.581	S	S	.	*	H	α-helix	trans	-69.5	-37.7	178.7	-77.5	8.3	0	0	0	112.4	I101 S102 R108 Q109	I101-N105 WeakPolarHBondContact O-CB 3.32Å; I101-N105 PolarHBondContact O-N 3.02Å; S102-N105 PolarHBondContact O-N 2.97Å; N105-R108 PolarHBondContact O-N 3.39Å; N105-Q109 PolarHBondContact O-N 3.33Å
106	G	74.1	Confident	75	Confident	32 Å²	32	113 Å²	113	33%	0.33	59%	0.594	S	S	.	*	H	α-helix	trans	-63.4	-39.2	173.9	0	0	0	0	0	112.7	S102 Q109 N110	S102-G106 PolarHBondContact O-N 3.4Å; G106-Q109 PolarHBondContact O-N 3.11Å; G106-N110 PolarHBondContact O-N 3.46Å; G106-N110 VanDerWaalsContact O-N 3.17Å
107	R	67.1	Low	73	Confident	193 Å²	193	114 Å²	114	73%	0.728	61%	0.609	S	S	*	*	H	α-helix	trans	-65	-41.6	172.8	-75.1	-179.7	177.2	-175.7	-0.5	112.3	N103 Y104 N110 D111	N103-R107 WeakPolarHBondContact O-CG 3.49Å; N103-R107 PolarHBondContact O-N 2.95Å; N103-R107 VanDerWaalsContact O-N 3.12Å; Y104-R107 PolarHBondContact O-N 3.36Å; R107-N110 PolarHBondContact O-N 3.22Å; R107-D111 PolarHBondContact O-N 2.87Å
108	R	63.6	Low	70.8	Confident	194 Å²	194	114.2 Å²	114.2	73%	0.732	62%	0.62	S	S	*	*	H	α-helix	trans	-64	-36.9	176.3	-80.6	-176.9	166.3	-173.8	-3.6	113.4	Y104 N105 A112	Y104-R108 PolarHBondContact O-N 3.01Å; N105-R108 PolarHBondContact O-N 3.39Å; R108-A112 WeakPolarHBondContact O-CB 3.38Å; R108-A112 PolarHBondContact O-N 3.03Å; R108-A112 VanDerWaalsContact O-N 3.14Å
109	Q	60.6	Low	69.1	Low	141 Å²	141	112.5 Å²	112.5	66%	0.659	63%	0.627	S	S	*	*	H	α-helix	trans	-67.4	-40.7	174.8	-75.5	-175.5	16.5	0	0	111.9	N105 G106 T113	N105-Q109 PolarHBondContact O-N 3.33Å; G106-Q109 PolarHBondContact O-N 3.11Å; Q109-T113 PolarHBondContact O-N 3.28Å; Q109-T113 PolarHBondContact O-OG1 3.5Å
110	N	59	Low	67.2	Low	120 Å²	120	111.5 Å²	111.5	64%	0.642	64%	0.638	S	S	*	*	H	α-helix	trans	-65.7	-39.9	177.1	-74.5	-3.5	0	0	0	112.3	G106 R107 T113 S114	G106-N110 PolarHBondContact O-N 3.46Å; G106-N110 VanDerWaalsContact O-N 3.17Å; R107-N110 PolarHBondContact O-N 3.22Å; N110-T113 PolarHBondContact O-N 3.38Å; N110-S114 PolarHBondContact O-N 3.25Å; N110-S114 PolarHBondContact O-OG 3.34Å
111	D	58.5	Low	65.3	Low	118 Å²	118	112.4 Å²	112.4	63%	0.631	65%	0.653	S	S	*	*	H	α-helix	trans	-70.4	-34.5	-179.1	-148.7	5.4	0	0	0	112.7	R107 T113 S114	R107-D111 PolarHBondContact O-N 2.87Å; D111-T113 PolarHBondContact O-N 2.96Å; D111-S114 WeakPolarHBondContact CA-OG 3.13Å; D111-S114 PolarHBondContact O-N 2.66Å; D111-S114 PolarHBondContact O-OG 3.45Å; D111-S114 VanDerWaalsContact O-OG 3.11Å
112	A	58.1	Low	63.7	Low	81 Å²	81	112.4 Å²	112.4	67%	0.669	67%	0.666	S	S	*	*	H	α-helix	trans	-67.2	-20.4	173	0	0	0	0	0	113.4	R108	R108-A112 WeakPolarHBondContact O-CB 3.38Å; R108-A112 PolarHBondContact O-N 3.03Å; R108-A112 VanDerWaalsContact O-N 3.14Å
113	T	56.2	Low	61.8	Low	119 Å²	119	114.8 Å²	114.8	73%	0.73	68%	0.681	S	S	*	*	H	α-helix	trans	-94.7	-10.6	-179.7	-34.4	0	0	0	0	112.5	Q109 N110 D111	Q109-T113 PolarHBondContact O-N 3.28Å; Q109-T113 PolarHBondContact O-OG1 3.5Å; N110-T113 PolarHBondContact O-N 3.38Å; D111-T113 PolarHBondContact O-N 2.96Å
114	S	53.5	Low	60.2	Low	80 Å²	80	118.9 Å²	118.9	56%	0.559	70%	0.696	S	S	*	*			trans	-100.1	7.6	-179	43	0	0	0	0	115.6	N110 D111	N110-S114 PolarHBondContact O-N 3.25Å; N110-S114 PolarHBondContact O-OG 3.34Å; D111-S114 WeakPolarHBondContact CA-OG 3.13Å; D111-S114 PolarHBondContact O-N 2.66Å; D111-S114 PolarHBondContact O-OG 3.45Å; D111-S114 VanDerWaalsContact O-OG 3.11Å
115	S	50.3	Low	58.8	Low	96 Å²	96	118.8 Å²	118.8	67%	0.671	71%	0.707	S	S	*	*	P	Polyproline II helix	trans	-71.7	123.1	170.1	-80	0	0	0	0	110.7	A117	S115-A117 PolarHBondContact O-N 2.95Å
116	P	52.5	Low	57.8	Low	121 Å²	121	120.2 Å²	120.2	79%	0.786	72%	0.723	S	S	*	*	P	Polyproline II helix	trans	-70.1	133.2	176.2	30.3	-31.5	0	0	0	109
117	A	54.8	Low	57	Low	89 Å²	89	124.8 Å²	124.8	74%	0.736	75%	0.747	S	S	*	*	P	Polyproline II helix	trans	-56.2	139.3	177.2	0	0	0	0	0	110.8	S115 S119	S115-A117 PolarHBondContact O-N 2.95Å; A117-S119 PolarHBondContact O-N 3.49Å
118	P	52.1	Low	56.4	Low	125 Å²	125	119.9 Å²	119.9	81%	0.812	75%	0.748	S	S	*	*	P	Polyproline II helix	trans	-65.9	121.5	173.8	27.1	-30	0	0	0	108.5	A120	P118-A120 PolarHBondContact O-N 2.97Å
119	S	59.8	Low	55.8	Low	120 Å²	120	116.1 Å²	116.1	84%	0.839	75%	0.751	S	S	*	*	P	Polyproline II helix	trans	-51.3	117.6	176.5	11.2	0	0	0	0	110.8	A117	A117-S119 PolarHBondContact O-N 3.49Å
120	A	55.3	Low	55.1	Low	90 Å²	90	118.8 Å²	118.8	74%	0.744	79%	0.786	S	S	*	*	P	Polyproline II helix	trans	-62.7	140.3	176.1	0	0	0	0	0	111	P118	P118-A120 PolarHBondContact O-N 2.97Å
121	P	54.3	Low	54.9	Low	126 Å²	126	118.8 Å²	118.8	82%	0.818	79%	0.793	S	S	*	*	P	Polyproline II helix	trans	-74.6	138.6	176.1	30.8	-31.1	0	0	0	110.3
122	A	61.4	Low	54.8	Low	90 Å²	90	118.8 Å²	118.8	74%	0.744	80%	0.801	S	S	*	*	P	Polyproline II helix	trans	-62.7	144.7	179.5	0	0	0	0	0	112	Q124	A122-Q124 PolarHBondContact O-N 3.34Å
123	P	53.2	Low	54.6	Low	125 Å²	125	120.9 Å²	120.9	81%	0.812	81%	0.809	S	S	*	*	P	Polyproline II helix	trans	-73.6	119.3	-179.4	29	-30.8	0	0	0	110.3	N125	P123-N125 PolarHBondContact O-N 3.5Å
124	Q	55.8	Low	54.5	Low	191 Å²	191	121 Å²	121	89%	0.893	81%	0.813	S	S	*	*			trans	-80.1	113.8	165.3	-80.5	-178.3	-20.8	0	0	108.8	A122 S126	A122-Q124 PolarHBondContact O-N 3.34Å; Q124-S126 PolarHBondContact O-N 2.91Å
125	N	54.7	Low	54.5	Low	159 Å²	159	123.6 Å²	123.6	85%	0.85	83%	0.829	S	S	*	*			trans	-67.7	120.6	169.2	-92.9	-9.5	0	0	0	110.1	P123	P123-N125 PolarHBondContact O-N 3.5Å
126	S	58.8	Low	54.8	Low	114 Å²	114	125.4 Å²	125.4	80%	0.797	84%	0.84	S	S	*	*			trans	-68.6	153.1	164.3	-41.5	0	0	0	0	111.1	Q124	Q124-S126 PolarHBondContact O-N 2.91Å
127	P	57.7	Low	55	Low	128 Å²	128	125.7 Å²	125.7	83%	0.831	84%	0.843	S	S	*	*			trans	-107.9	157.4	147.2	22.8	-6.6	0	0	0	112.1
128	A	54.3	Low	55	Low	90 Å²	90	128.5 Å²	128.5	74%	0.744	85%	0.852	S	S	*	*			trans	-72.4	153.3	-165	0	0	0	0	0	115.8
129	S	50.6	Low	55.2	Low	116 Å²	116	128.8 Å²	128.8	81%	0.811	86%	0.855	S	S	*	*			trans	29.7	125.5	135.7	-50.4	0	0	0	0	120.5
130	S	46.9	Very low	54.8	Low	197 Å²	197	129.6 Å²	129.6	100%	1.378	86%	0.856	S	S	*	*				-167.7	0	108.6	-109.9	0	0	0	0	111.3

Retrieved 130 of 130 residues in 54.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).