A0A087X862_POEFO Loading...

Mitochondrial import receptor subunit TOM7 homolog

AlphaFold DB , UniProt , Accession A0A087X862, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 55 aa.

						>A0A087X862_POEFO|A0A087X862
MAKLSKETKQRLQQLFQCSQFVIRWGFIPTVLYLGFKRGADPGMPEPTLLSLLWG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.2	Very low	82	Confident	237 Å²	237	133.4 Å²	133.4	100%	1.167	66%	0.662	S	S	*	*				0	115.5	0	-75.6	-147.9	-88.3	0	0	108.9	K3	M1-K3 PolarHBondContact O-N 3.14Å; M1-K3 VanDerWaalsContact O-N 3.14Å
2	A	65.1	Low	83.1	Confident	103 Å²	103	127.6 Å²	127.6	85%	0.851	63%	0.634	S	S	*	*			trans	-59.5	117.2	174.9	0	0	0	0	0	109.4	L4	A2-L4 PolarHBondContact O-N 3.44Å; A2-L4 VanDerWaalsContact O-N 3.1Å
3	K	74.8	Confident	84.1	Confident	215 Å²	215	127.2 Å²	127.2	94%	0.935	63%	0.629	S	S	*	*			trans	-75.9	97.4	175.9	-98.3	-179.4	175.3	177.9	0	108.2	M1 S5	M1-K3 PolarHBondContact O-N 3.14Å; M1-K3 VanDerWaalsContact O-N 3.14Å; K3-S5 PolarHBondContact O-N 3.1Å
4	L	78.9	Confident	84.9	Confident	85 Å²	85	127.6 Å²	127.6	45%	0.445	63%	0.629	S	S	.	*			trans	-58.9	131.5	166.4	-85.1	156.8	0	0	0	109.8	A2 T8 K9 L12	A2-L4 PolarHBondContact O-N 3.44Å; A2-L4 VanDerWaalsContact O-N 3.1Å; L4-T8 HydrophobicContact CD2-CG2 3.38Å; L4-K9 HydrophobicContact CB-CD 4.37Å; L4-K9 HydrophobicContact CB-CG 3.72Å; L4-K9 WeakPolarHBondContact O-CE 3.49Å; L4-L12 HydrophobicContact CD1-CD1 4.24Å; L4-L12 HydrophobicContact CD2-CD1 4.27Å
5	S	85.4	Confident	85.7	Confident	70 Å²	70	126.5 Å²	126.5	49%	0.49	63%	0.626	S	S	.	*			trans	-58.1	149.4	170.7	-179.7	0	0	0	0	110.2	K3 E7 T8 K9	K3-S5 PolarHBondContact O-N 3.1Å; S5-E7 PolarHBondContact O-N 3.01Å; S5-T8 PolarHBondContact O-N 3.07Å; S5-T8 VanDerWaalsContact O-N 3.08Å; S5-K9 PolarHBondContact O-N 3.24Å
6	K	87.1	Confident	86.4	Confident	188 Å²	188	126.7 Å²	126.7	82%	0.817	62%	0.622	S	S	*	*	H	α-helix	trans	-54.4	-40.4	179.6	-69.6	-175.9	179.6	-179.6	0	111.4	K9 Q10	K6-K9 PolarHBondContact O-N 3.26Å; K6-Q10 PolarHBondContact O-N 3.07Å; K6-Q10 VanDerWaalsContact O-N 3.07Å
7	E	90	Very high	87	Confident	103 Å²	103	126.1 Å²	126.1	48%	0.481	62%	0.618	S	S	.	*	H	α-helix	trans	-62	-46.5	177.3	-174.6	-176.7	174.2	0	0	112.1	S5 K9 Q10 R11	S5-E7 PolarHBondContact O-N 3.01Å; E7-K9 VanDerWaalsContact C-N 3.3Å; E7-K9 PolarHBondContact O-N 2.91Å; E7-Q10 PolarHBondContact O-N 3.37Å; E7-R11 WeakPolarHBondContact O-CG 3.01Å; E7-R11 PolarHBondContact O-N 3.02Å; E7-R11 IonicContact OE1-CZ 2.64Å; E7-R11 VanDerWaalsContact OE1-CZ 3.24Å; E7-R11 IonicContact OE1-NE 3.24Å; E7-R11 PolarHBondContact OE1-NE 3.38Å; E7-R11 IonicContact OE1-NH2 3.34Å; E7-R11 PolarHBondContact OE1-NH2 3.36Å
8	T	91.4	Very high	87.6	Confident	61 Å²	61	123.3 Å²	123.3	37%	0.374	61%	0.612	S	S	.	*	H	α-helix	trans	-63.6	-38	179.4	-41.5	0	0	0	0	111.4	L4 S5 L12	L4-T8 HydrophobicContact CD2-CG2 3.38Å; S5-T8 PolarHBondContact O-N 3.07Å; S5-T8 VanDerWaalsContact O-N 3.08Å; T8-L12 HydrophobicContact CG2-CD1 4.36Å; T8-L12 WeakPolarHBondContact O-CB 3.42Å; T8-L12 PolarHBondContact O-N 3.08Å
9	K	91.1	Very high	88	Confident	118 Å²	118	120.1 Å²	120.1	51%	0.513	60%	0.603	S	S	.	*	H	α-helix	trans	-63.3	-43.6	175.1	-68	-174	-179.6	-172.8	0	112	L4 S5 K6 E7 L12 Q13	L4-K9 HydrophobicContact CB-CD 4.37Å; L4-K9 HydrophobicContact CB-CG 3.72Å; L4-K9 WeakPolarHBondContact O-CE 3.49Å; S5-K9 PolarHBondContact O-N 3.24Å; K6-K9 PolarHBondContact O-N 3.26Å; E7-K9 VanDerWaalsContact C-N 3.3Å; E7-K9 PolarHBondContact O-N 2.91Å; K9-L12 PolarHBondContact O-N 3.22Å; K9-Q13 WeakPolarHBondContact O-CB 3.27Å; K9-Q13 PolarHBondContact O-N 2.95Å
10	Q	94.8	Very high	88.4	Confident	133 Å²	133	120.8 Å²	120.8	62%	0.621	60%	0.604	S	S	*	*	H	α-helix	trans	-64.4	-44.4	179.5	-173.3	176	-1.6	0	0	111.7	K6 E7 L12 Q13 Q14	K6-Q10 PolarHBondContact O-N 3.07Å; K6-Q10 VanDerWaalsContact O-N 3.07Å; E7-Q10 PolarHBondContact O-N 3.37Å; Q10-L12 PolarHBondContact O-N 3.37Å; Q10-Q13 PolarHBondContact O-N 3.42Å; Q10-Q14 PolarHBondContact O-N 3.41Å
11	R	95.1	Very high	88.8	Confident	154 Å²	154	121.3 Å²	121.3	58%	0.581	60%	0.602	S	S	*	*	H	α-helix	trans	-61.7	-42.6	175.7	-68.4	-179.1	-176.7	-158.1	1.6	112	E7 Q14 L15	E7-R11 WeakPolarHBondContact O-CG 3.01Å; E7-R11 PolarHBondContact O-N 3.02Å; E7-R11 IonicContact OE1-CZ 2.64Å; E7-R11 VanDerWaalsContact OE1-CZ 3.24Å; E7-R11 IonicContact OE1-NE 3.24Å; E7-R11 PolarHBondContact OE1-NE 3.38Å; E7-R11 IonicContact OE1-NH2 3.34Å; E7-R11 PolarHBondContact OE1-NH2 3.36Å; R11-Q14 PolarHBondContact O-N 2.91Å; R11-L15 WeakPolarHBondContact O-CG 3.44Å; R11-L15 PolarHBondContact O-N 3.37Å
12	L	95.7	Very high	91.2	Very high	64 Å²	64	114 Å²	114	34%	0.335	57%	0.571	S	S	.	*	H	α-helix	trans	-60.8	-45.7	174.6	-88.3	162.2	0	0	0	111.6	L4 T8 K9 Q10 Q14 L15 F16	L4-L12 HydrophobicContact CD1-CD1 4.24Å; L4-L12 HydrophobicContact CD2-CD1 4.27Å; T8-L12 HydrophobicContact CG2-CD1 4.36Å; T8-L12 WeakPolarHBondContact O-CB 3.42Å; T8-L12 PolarHBondContact O-N 3.08Å; K9-L12 PolarHBondContact O-N 3.22Å; Q10-L12 PolarHBondContact O-N 3.37Å; L12-Q14 VanDerWaalsContact C-N 3.32Å; L12-Q14 PolarHBondContact O-N 2.9Å; L12-L15 WeakPolarHBondContact O-CB 3.44Å; L12-L15 PolarHBondContact O-N 3.48Å; L12-F16 HydrophobicContact CB-CE2 4.31Å; L12-F16 HydrophobicContact CD2-CE2 4.02Å; L12-F16 WeakPolarHBondContact O-CD2 3.46Å; L12-F16 PolarHBondContact O-N 3.46Å
13	Q	95	Very high	92.7	Very high	122 Å²	122	114.7 Å²	114.7	57%	0.57	56%	0.559	S	S	*	*	H	α-helix	trans	-61.7	-41.6	178.6	-171.8	171	-3.1	0	0	111.8	K9 Q10 F16 Q17	K9-Q13 WeakPolarHBondContact O-CB 3.27Å; K9-Q13 PolarHBondContact O-N 2.95Å; Q10-Q13 PolarHBondContact O-N 3.42Å; Q13-F16 PolarHBondContact O-N 2.84Å; Q13-Q17 WeakPolarHBondContact O-CG 3.44Å; Q13-Q17 PolarHBondContact O-N 3.25Å
14	Q	96.4	Very high	93.7	Very high	133 Å²	133	113.5 Å²	113.5	62%	0.621	55%	0.549	S	S	*	.	H	α-helix	trans	-64.1	-41.8	175.1	-172.4	176.7	-0.9	0	0	112	Q10 R11 L12 Q17 C18	Q10-Q14 PolarHBondContact O-N 3.41Å; R11-Q14 PolarHBondContact O-N 2.91Å; L12-Q14 VanDerWaalsContact C-N 3.32Å; L12-Q14 PolarHBondContact O-N 2.9Å; Q14-Q17 PolarHBondContact O-N 2.94Å; Q14-C18 WeakPolarHBondContact O-CB 3.3Å; Q14-C18 PolarHBondContact O-N 3.39Å
15	L	97.1	Very high	94.4	Very high	112 Å²	112	117 Å²	117	59%	0.586	56%	0.556	S	S	*	*	H	α-helix	trans	-59.2	-48.2	173.8	-79.1	167.1	0	0	0	111.1	R11 L12 Q17 C18 S19	R11-L15 WeakPolarHBondContact O-CG 3.44Å; R11-L15 PolarHBondContact O-N 3.37Å; L12-L15 WeakPolarHBondContact O-CB 3.44Å; L12-L15 PolarHBondContact O-N 3.48Å; L15-Q17 PolarHBondContact O-N 3.41Å; L15-C18 PolarHBondContact O-N 2.99Å; L15-S19 WeakPolarHBondContact O-CB 3.39Å; L15-S19 PolarHBondContact O-N 2.9Å; L15-S19 PolarHBondContact O-OG 2.96Å
16	F	96.3	Very high	95	Very high	129 Å²	129	114.9 Å²	114.9	57%	0.566	55%	0.545	S	S	*	.	H	α-helix	trans	-60.1	-43.6	178.4	-75.3	-62	0	0	0	112.5	L12 Q13 S19 Q20	L12-F16 HydrophobicContact CB-CE2 4.31Å; L12-F16 HydrophobicContact CD2-CE2 4.02Å; L12-F16 WeakPolarHBondContact O-CD2 3.46Å; L12-F16 PolarHBondContact O-N 3.46Å; Q13-F16 PolarHBondContact O-N 2.84Å; F16-S19 PolarHBondContact O-N 3.22Å; F16-Q20 WeakPolarHBondContact O-CB 3.35Å; F16-Q20 VanDerWaalsContact O-CG 3.27Å; F16-Q20 WeakPolarHBondContact O-CG 3.45Å; F16-Q20 PolarHBondContact O-N 3.48Å
17	Q	95.9	Very high	95.4	Very high	117 Å²	117	112.2 Å²	112.2	55%	0.547	53%	0.534	S	S	.	.	H	α-helix	trans	-63.9	-43	177.1	-74.1	-175.4	-16.1	0	0	112	Q13 Q14 L15 Q20 F21	Q13-Q17 WeakPolarHBondContact O-CG 3.44Å; Q13-Q17 PolarHBondContact O-N 3.25Å; Q14-Q17 PolarHBondContact O-N 2.94Å; L15-Q17 PolarHBondContact O-N 3.41Å; Q17-Q20 PolarHBondContact O-N 3.01Å; Q17-F21 WeakPolarHBondContact O-CB 3.47Å; Q17-F21 PolarHBondContact O-N 3.34Å
18	C	97.5	Very high	95.5	Very high	76 Å²	76	112.6 Å²	112.6	51%	0.514	54%	0.538	S	S	.	.	H	α-helix	trans	-63.6	-47.1	177.4	-168.4	0	0	0	0	111	Q14 L15 Q20 F21 V22	Q14-C18 WeakPolarHBondContact O-CB 3.3Å; Q14-C18 PolarHBondContact O-N 3.39Å; L15-C18 PolarHBondContact O-N 2.99Å; C18-Q20 VanDerWaalsContact C-N 3.35Å; C18-Q20 PolarHBondContact O-N 2.64Å; C18-F21 WeakPolarHBondContact O-CB 3.24Å; C18-F21 PolarHBondContact O-N 3.35Å; C18-V22 WeakPolarHBondContact O-CG2 3.47Å; C18-V22 PolarHBondContact O-N 2.98Å
19	S	96.6	Very high	95.6	Very high	62 Å²	62	113.2 Å²	113.2	43%	0.434	54%	0.543	S	S	.	.	H	α-helix	trans	-60.6	-42.5	176.6	-60.1	0	0	0	0	112.2	L15 F16 F21 V22 I23	L15-S19 WeakPolarHBondContact O-CB 3.39Å; L15-S19 PolarHBondContact O-N 2.9Å; L15-S19 PolarHBondContact O-OG 2.96Å; F16-S19 PolarHBondContact O-N 3.22Å; S19-F21 VanDerWaalsContact C-N 3.34Å; S19-F21 PolarHBondContact O-N 2.93Å; S19-V22 PolarHBondContact O-N 3.42Å; S19-I23 WeakPolarHBondContact O-CB 3.37Å; S19-I23 VanDerWaalsContact O-CG1 3.3Å; S19-I23 WeakPolarHBondContact O-CG1 3.15Å; S19-I23 PolarHBondContact O-N 3.37Å
20	Q	96.4	Very high	95.8	Very high	134 Å²	134	111.3 Å²	111.3	63%	0.626	54%	0.542	S	S	*	.	H	α-helix	trans	-61.3	-42.8	175.6	-77.9	178.1	-15	0	0	111.9	F16 Q17 C18 R24	F16-Q20 WeakPolarHBondContact O-CB 3.35Å; F16-Q20 VanDerWaalsContact O-CG 3.27Å; F16-Q20 WeakPolarHBondContact O-CG 3.45Å; F16-Q20 PolarHBondContact O-N 3.48Å; Q17-Q20 PolarHBondContact O-N 3.01Å; C18-Q20 VanDerWaalsContact C-N 3.35Å; C18-Q20 PolarHBondContact O-N 2.64Å; Q20-R24 VanDerWaalsContact O-CB 3.24Å; Q20-R24 WeakPolarHBondContact O-CB 3.43Å; Q20-R24 PolarHBondContact O-N 3.06Å
21	F	96.6	Very high	95.7	Very high	131 Å²	131	108.7 Å²	108.7	58%	0.575	53%	0.534	S	S	*	.	H	α-helix	trans	-62.2	-48.2	176.3	178.2	-93.5	0	0	0	111.6	Q17 C18 S19 I23 R24 W25	Q17-F21 WeakPolarHBondContact O-CB 3.47Å; Q17-F21 PolarHBondContact O-N 3.34Å; C18-F21 WeakPolarHBondContact O-CB 3.24Å; C18-F21 PolarHBondContact O-N 3.35Å; S19-F21 VanDerWaalsContact C-N 3.34Å; S19-F21 PolarHBondContact O-N 2.93Å; F21-I23 PolarHBondContact O-N 3.47Å; F21-R24 PolarHBondContact O-N 2.92Å; F21-W25 AromaticContact CD2-CD1 3.47Å; F21-W25 VanDerWaalsContact CD2-CD1 3.47Å; F21-W25 AromaticContact CD2-NE1 3.77Å; F21-W25 AromaticContact CE2-CD1 3.33Å; F21-W25 HydrophobicContact CE2-CG 4.35Å; F21-W25 AromaticContact CE2-NE1 3.53Å; F21-W25 AromaticContact CZ-CD1 3.81Å; F21-W25 HydrophobicContact CZ-CG 4.5Å; F21-W25 PolarHBondContact O-N 3.01Å
22	V	97.5	Very high	95.5	Very high	85 Å²	85	104.3 Å²	104.3	52%	0.515	52%	0.522	S	S	.	.	H	α-helix	trans	-62.7	-43.1	179.9	172.1	0	0	0	0	111.3	C18 S19 G26	C18-V22 WeakPolarHBondContact O-CG2 3.47Å; C18-V22 PolarHBondContact O-N 2.98Å; S19-V22 PolarHBondContact O-N 3.42Å; V22-G26 WeakPolarHBondContact O-CA 3.12Å; V22-G26 PolarHBondContact O-N 2.73Å
23	I	96.7	Very high	95.2	Very high	117 Å²	117	108 Å²	108	60%	0.6	53%	0.533	S	S	*	.	H	α-helix	trans	-67	-47.2	178.1	-68	168.3	0	0	0	110.2	S19 F21 W25 F27	S19-I23 WeakPolarHBondContact O-CB 3.37Å; S19-I23 VanDerWaalsContact O-CG1 3.3Å; S19-I23 WeakPolarHBondContact O-CG1 3.15Å; S19-I23 PolarHBondContact O-N 3.37Å; F21-I23 PolarHBondContact O-N 3.47Å; I23-W25 VanDerWaalsContact C-N 3.33Å; I23-W25 PolarHBondContact O-N 3.34Å; I23-F27 WeakPolarHBondContact O-CB 3.47Å; I23-F27 PolarHBondContact O-N 2.9Å
24	R	95.4	Very high	95.1	Very high	190 Å²	190	107 Å²	107	72%	0.717	53%	0.531	S	S	*	.	H	α-helix	trans	-62.2	-39.5	-175.7	-172.4	161.2	106.9	164.9	4.2	112.9	Q20 F21	Q20-R24 VanDerWaalsContact O-CB 3.24Å; Q20-R24 WeakPolarHBondContact O-CB 3.43Å; Q20-R24 PolarHBondContact O-N 3.06Å; F21-R24 PolarHBondContact O-N 2.92Å
25	W	95.4	Very high	94.7	Very high	158 Å²	158	102.6 Å²	102.6	60%	0.598	52%	0.521	S	S	*	.	H	α-helix	trans	-98.9	-23.3	-178	-66.1	110.2	0	0	0	114	F21 I23 P29	F21-W25 AromaticContact CD2-CD1 3.47Å; F21-W25 VanDerWaalsContact CD2-CD1 3.47Å; F21-W25 AromaticContact CD2-NE1 3.77Å; F21-W25 AromaticContact CE2-CD1 3.33Å; F21-W25 HydrophobicContact CE2-CG 4.35Å; F21-W25 AromaticContact CE2-NE1 3.53Å; F21-W25 AromaticContact CZ-CD1 3.81Å; F21-W25 HydrophobicContact CZ-CG 4.5Å; F21-W25 PolarHBondContact O-N 3.01Å; I23-W25 VanDerWaalsContact C-N 3.33Å; I23-W25 PolarHBondContact O-N 3.34Å; W25-P29 WeakPolarHBondContact O-CD 3.34Å; W25-P29 VanDerWaalsContact O-CG 3.24Å; W25-P29 WeakPolarHBondContact O-CG 3.39Å
26	G	96.3	Very high	94.2	Very high	25 Å²	25	100.1 Å²	100.1	26%	0.258	51%	0.506	S	S	.	.	H	α-helix	trans	-88.5	-25.3	-178.2	0	0	0	0	0	113.9	V22 I28 P29 T30	V22-G26 WeakPolarHBondContact O-CA 3.12Å; V22-G26 PolarHBondContact O-N 2.73Å; G26-I28 PolarHBondContact O-N 3.04Å; G26-P29 WeakPolarHBondContact O-CD 3.32Å; G26-T30 WeakPolarHBondContact O-CB 3.37Å; G26-T30 PolarHBondContact O-N 3.35Å; G26-T30 PolarHBondContact O-OG1 3.48Å
27	F	95.5	Very high	93.7	Very high	133 Å²	133	101.1 Å²	101.1	58%	0.583	51%	0.51	S	S	*	.	H	α-helix	trans	-58.1	-54.1	-175.9	-179.4	-103.1	0	0	0	112.9	I23 T30 V31	I23-F27 WeakPolarHBondContact O-CB 3.47Å; I23-F27 PolarHBondContact O-N 2.9Å; F27-T30 PolarHBondContact O-N 3.19Å; F27-V31 HydrophobicContact CD2-CG2 4.4Å; F27-V31 HydrophobicContact CE1-CG2 4.18Å; F27-V31 HydrophobicContact CE2-CG2 4.04Å; F27-V31 HydrophobicContact CZ-CG2 3.93Å; F27-V31 WeakPolarHBondContact O-CG2 3.38Å; F27-V31 PolarHBondContact O-N 3.31Å
28	I	93.5	Very high	93.2	Very high	111 Å²	111	106 Å²	106	57%	0.569	52%	0.523	S	S	*	.	H	α-helix	trans	-63.1	-50	-177.6	-63.7	173.3	0	0	0	111.5	G26 T30 V31 L32	G26-I28 PolarHBondContact O-N 3.04Å; I28-T30 VanDerWaalsContact C-N 3.31Å; I28-T30 PolarHBondContact O-N 2.93Å; I28-V31 PolarHBondContact O-N 3.03Å; I28-L32 HydrophobicContact CG2-CD1 3.91Å; I28-L32 HydrophobicContact CG2-CG 4.3Å; I28-L32 WeakPolarHBondContact O-CB 3.05Å; I28-L32 WeakPolarHBondContact O-CG 3.08Å; I28-L32 PolarHBondContact O-N 3.27Å
29	P	93.8	Very high	92.4	Very high	73 Å²	73	103.9 Å²	103.9	47%	0.474	51%	0.514	S	S	.	.	H	α-helix	trans	-56.7	-41	175.6	-27.8	35.3	0	0	0	113.8	W25 G26 L32 Y33	W25-P29 WeakPolarHBondContact O-CD 3.34Å; W25-P29 VanDerWaalsContact O-CG 3.24Å; W25-P29 WeakPolarHBondContact O-CG 3.39Å; G26-P29 WeakPolarHBondContact O-CD 3.32Å; P29-L32 PolarHBondContact O-N 2.99Å; P29-Y33 WeakPolarHBondContact O-CB 3.24Å; P29-Y33 PolarHBondContact O-N 3.37Å
30	T	94.9	Very high	91.6	Very high	79 Å²	79	102.9 Å²	102.9	49%	0.485	51%	0.51	S	S	.	.	H	α-helix	trans	-65.8	-44.8	178.4	-59.7	0	0	0	0	111.7	G26 F27 I28 L32 Y33 L34	G26-T30 WeakPolarHBondContact O-CB 3.37Å; G26-T30 PolarHBondContact O-N 3.35Å; G26-T30 PolarHBondContact O-OG1 3.48Å; F27-T30 PolarHBondContact O-N 3.19Å; I28-T30 VanDerWaalsContact C-N 3.31Å; I28-T30 PolarHBondContact O-N 2.93Å; T30-L32 PolarHBondContact O-N 3.08Å; T30-Y33 PolarHBondContact O-N 3.31Å; T30-L34 HydrophobicContact CG2-CD1 4.23Å; T30-L34 WeakPolarHBondContact O-CG 3.41Å; T30-L34 PolarHBondContact O-N 3.5Å
31	V	92.5	Very high	90.9	Very high	77 Å²	77	101.6 Å²	101.6	47%	0.467	51%	0.507	S	S	.	.	H	α-helix	trans	-62.4	-43.7	177.1	170.9	0	0	0	0	111	F27 I28 L34 G35	F27-V31 HydrophobicContact CD2-CG2 4.4Å; F27-V31 HydrophobicContact CE1-CG2 4.18Å; F27-V31 HydrophobicContact CE2-CG2 4.04Å; F27-V31 HydrophobicContact CZ-CG2 3.93Å; F27-V31 WeakPolarHBondContact O-CG2 3.38Å; F27-V31 PolarHBondContact O-N 3.31Å; I28-V31 PolarHBondContact O-N 3.03Å; V31-L34 PolarHBondContact O-N 2.93Å; V31-G35 PolarHBondContact O-N 2.93Å
32	L	90.9	Very high	90.2	Very high	63 Å²	63	101.8 Å²	101.8	33%	0.33	52%	0.522	S	S	.	.	H	α-helix	trans	-59.7	-49.8	176.1	-74.3	174.3	0	0	0	111.2	I28 P29 T30 L34 G35 F36 L52	I28-L32 HydrophobicContact CG2-CD1 3.91Å; I28-L32 HydrophobicContact CG2-CG 4.3Å; I28-L32 WeakPolarHBondContact O-CB 3.05Å; I28-L32 WeakPolarHBondContact O-CG 3.08Å; I28-L32 PolarHBondContact O-N 3.27Å; P29-L32 PolarHBondContact O-N 2.99Å; T30-L32 PolarHBondContact O-N 3.08Å; L32-L34 VanDerWaalsContact C-N 3.29Å; L32-L34 PolarHBondContact O-N 3.47Å; L32-G35 PolarHBondContact O-N 3.33Å; L32-G35 VanDerWaalsContact O-N 3.08Å; L32-F36 HydrophobicContact CB-CD2 4.4Å; L32-F36 HydrophobicContact CB-CE2 4.21Å; L32-F36 HydrophobicContact CD2-CE2 4.44Å; L32-F36 WeakPolarHBondContact O-CD2 3.49Å; L32-F36 PolarHBondContact O-N 3.49Å; L32-L52 HydrophobicContact CD2-CD1 4.04Å; L32-L52 HydrophobicContact CD2-CD2 4.33Å
33	Y	89.9	Confident	89.3	Confident	141 Å²	141	102 Å²	102	55%	0.553	54%	0.54	S	S	*	.	H	α-helix	trans	-55.5	-44	177.8	173.4	-100.5	0	0	0	112.2	P29 T30 F36 K37	P29-Y33 WeakPolarHBondContact O-CB 3.24Å; P29-Y33 PolarHBondContact O-N 3.37Å; T30-Y33 PolarHBondContact O-N 3.31Å; Y33-F36 PolarHBondContact O-N 3.23Å; Y33-K37 HydrophobicContact CE1-CD 3.98Å; Y33-K37 WeakPolarHBondContact O-CB 3.5Å; Y33-K37 PolarHBondContact O-N 3.15Å
34	L	91.6	Very high	88.6	Confident	101 Å²	101	102.6 Å²	102.6	53%	0.529	54%	0.542	S	S	.	.	H	α-helix	trans	-65.8	-39.4	177.2	-68.6	172.5	0	0	0	112	T30 V31 L32 K37 R38	T30-L34 HydrophobicContact CG2-CD1 4.23Å; T30-L34 WeakPolarHBondContact O-CG 3.41Å; T30-L34 PolarHBondContact O-N 3.5Å; V31-L34 PolarHBondContact O-N 2.93Å; L32-L34 VanDerWaalsContact C-N 3.29Å; L32-L34 PolarHBondContact O-N 3.47Å; L34-K37 PolarHBondContact O-N 2.94Å; L34-R38 WeakPolarHBondContact O-CB 3.3Å; L34-R38 PolarHBondContact O-N 3.14Å
35	G	88.3	Confident	87.8	Confident	40 Å²	40	98.9 Å²	98.9	41%	0.412	54%	0.543	S	S	.	.	H	α-helix	trans	-60.8	-49.2	174.9	0	0	0	0	0	112.4	V31 L32 R38 G39	V31-G35 PolarHBondContact O-N 2.93Å; L32-G35 PolarHBondContact O-N 3.33Å; L32-G35 VanDerWaalsContact O-N 3.08Å; G35-R38 PolarHBondContact O-N 3.05Å; G35-G39 PolarHBondContact O-N 2.98Å
36	F	86.9	Confident	86.9	Confident	61 Å²	61	99 Å²	99	27%	0.268	55%	0.55	S	S	.	*	H	α-helix	trans	-63.6	-41.1	175.4	-71.7	-69.8	0	0	0	112.3	L32 Y33 R38 G39 P47 L49 L52	L32-F36 HydrophobicContact CB-CD2 4.4Å; L32-F36 HydrophobicContact CB-CE2 4.21Å; L32-F36 HydrophobicContact CD2-CE2 4.44Å; L32-F36 WeakPolarHBondContact O-CD2 3.49Å; L32-F36 PolarHBondContact O-N 3.49Å; Y33-F36 PolarHBondContact O-N 3.23Å; F36-R38 PolarHBondContact O-N 3.43Å; F36-G39 PolarHBondContact O-N 3.46Å; F36-G39 VanDerWaalsContact O-N 3.13Å; F36-P47 HydrophobicContact CD1-CB 3.85Å; F36-P47 HydrophobicContact CD1-CG 3.78Å; F36-P47 VanDerWaalsContact CD1-O 3.24Å; F36-P47 WeakPolarHBondContact CD1-O 3.41Å; F36-P47 VanDerWaalsContact CE1-C 3.45Å; F36-P47 HydrophobicContact CE1-CB 3.77Å; F36-P47 HydrophobicContact CE1-CG 4.24Å; F36-P47 WeakPolarHBondContact CE1-O 3.39Å; F36-L49 HydrophobicContact CE2-CD2 3.75Å; F36-L49 HydrophobicContact CE2-CG 4.45Å; F36-L49 HydrophobicContact CZ-CD2 3.67Å; F36-L49 HydrophobicContact CZ-CG 4.04Å; F36-L52 HydrophobicContact CE1-CD1 3.89Å; F36-L52 HydrophobicContact CE2-CD1 3.87Å; F36-L52 HydrophobicContact CZ-CD1 3.24Å
37	K	85.6	Confident	86	Confident	149 Å²	149	100 Å²	100	65%	0.648	55%	0.552	S	S	*	*	H	α-helix	trans	-67.2	-35.2	-179.8	-176.7	175.3	-179	172	0	112.9	Y33 L34 G39	Y33-K37 HydrophobicContact CE1-CD 3.98Å; Y33-K37 WeakPolarHBondContact O-CB 3.5Å; Y33-K37 PolarHBondContact O-N 3.15Å; L34-K37 PolarHBondContact O-N 2.94Å; K37-G39 PolarHBondContact O-N 3.32Å
38	R	86.3	Confident	85.4	Confident	220 Å²	220	97.1 Å²	97.1	83%	0.83	55%	0.545	S	S	*	.	H	α-helix	trans	-65.1	-29.9	173.4	-178.5	174.1	173.7	165.4	-2.7	111.4	L34 G35 F36	L34-R38 WeakPolarHBondContact O-CB 3.3Å; L34-R38 PolarHBondContact O-N 3.14Å; G35-R38 PolarHBondContact O-N 3.05Å; F36-R38 PolarHBondContact O-N 3.43Å
39	G	80.3	Confident	84.8	Confident	32 Å²	32	97.3 Å²	97.3	33%	0.33	55%	0.547	S	S	.	.			trans	74.6	178.1	-177.6	0	0	0	0	0	112.4	G35 F36 K37	G35-G39 PolarHBondContact O-N 2.98Å; F36-G39 PolarHBondContact O-N 3.46Å; F36-G39 VanDerWaalsContact O-N 3.13Å; K37-G39 PolarHBondContact O-N 3.32Å
40	A	79.6	Confident	84.2	Confident	41 Å²	41	99.7 Å²	99.7	34%	0.339	56%	0.555	S	S	.	*	P	Polyproline II helix	trans	-84.1	156.3	175.5	0	0	0	0	0	111.2	M44 P45	A40-M44 HydrophobicContact CB-CB 3.77Å; A40-P45 WeakPolarHBondContact CB-O 3.46Å
41	D	82.4	Confident	83.5	Confident	107 Å²	107	98.7 Å²	98.7	57%	0.572	55%	0.551	S	S	*	*	P	Polyproline II helix	trans	-62.2	153	171.5	-69	-48	0	0	0	110.9	G43 M44	D41-G43 PolarHBondContact O-N 3.13Å; D41-G43 VanDerWaalsContact O-N 3.14Å; D41-M44 WeakPolarHBondContact O-CB 3.44Å; D41-M44 PolarHBondContact O-N 3.33Å
42	P	80	Confident	82.9	Confident	135 Å²	135	99.8 Å²	99.8	88%	0.877	55%	0.554	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.8	121.6	-177.3	-22.1	30.9	0	0	0	111.9
43	G	79.9	Confident	82.6	Confident	88 Å²	88	103 Å²	103	91%	0.907	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	98.1	-3.4	-177.8	0	0	0	0	0	115.1	D41	D41-G43 PolarHBondContact O-N 3.13Å; D41-G43 VanDerWaalsContact O-N 3.14Å
44	M	81.9	Confident	82	Confident	130 Å²	130	106.4 Å²	106.4	64%	0.64	58%	0.583	S	S	*	*	S	Bend	trans	-100.7	143.5	172.2	-69.5	-103.5	-108.2	0	0	110.9	A40 D41	A40-M44 HydrophobicContact CB-CB 3.77Å; D41-M44 WeakPolarHBondContact O-CB 3.44Å; D41-M44 PolarHBondContact O-N 3.33Å
45	P	77.8	Confident	80.5	Confident	112 Å²	112	107.6 Å²	107.6	73%	0.727	62%	0.62	S	S	*	*	P	Polyproline II helix	trans	-64.4	146.5	175.3	26.5	-32.3	0	0	0	110.6	A40	A40-P45 WeakPolarHBondContact CB-O 3.46Å
46	E	77.1	Confident	80.1	Confident	162 Å²	162	111 Å²	111	76%	0.757	63%	0.63	S	S	*	*	P	Polyproline II helix	trans	-59.4	137.4	178.3	-69.8	-173	167.4	0	0	110.6	T48	E46-T48 PolarHBondContact O-N 3.49Å
47	P	78.2	Confident	79.8	Confident	45 Å²	45	113.6 Å²	113.6	29%	0.292	65%	0.649	S	S	.	*	P	Polyproline II helix	trans	-59.8	133.4	174.2	22.9	-30	0	0	0	108.8	F36	F36-P47 HydrophobicContact CD1-CB 3.85Å; F36-P47 HydrophobicContact CD1-CG 3.78Å; F36-P47 VanDerWaalsContact CD1-O 3.24Å; F36-P47 WeakPolarHBondContact CD1-O 3.41Å; F36-P47 VanDerWaalsContact CE1-C 3.45Å; F36-P47 HydrophobicContact CE1-CB 3.77Å; F36-P47 HydrophobicContact CE1-CG 4.24Å; F36-P47 WeakPolarHBondContact CE1-O 3.39Å
48	T	81.9	Confident	79.4	Confident	73 Å²	73	111.7 Å²	111.7	45%	0.448	65%	0.649	S	S	.	*			trans	-117.8	154.9	173.9	61.1	0	0	0	0	109.8	E46 L50 S51 L52	E46-T48 PolarHBondContact O-N 3.49Å; T48-L50 PolarHBondContact O-N 2.93Å; T48-S51 PolarHBondContact N-OG 3.31Å; T48-S51 PolarHBondContact O-N 2.89Å; T48-S51 PolarHBondContact O-OG 3.2Å; T48-S51 PolarHBondContact OG1-N 3.49Å; T48-S51 PolarHBondContact OG1-OG 2.97Å; T48-L52 PolarHBondContact O-N 3.24Å
49	L	81.5	Confident	79	Confident	115 Å²	115	105.3 Å²	105.3	60%	0.602	64%	0.639	S	S	*	*	H	α-helix	trans	-60.5	-32.1	176.5	-72.1	169	0	0	0	111.9	F36 L52 L53	F36-L49 HydrophobicContact CE2-CD2 3.75Å; F36-L49 HydrophobicContact CE2-CG 4.45Å; F36-L49 HydrophobicContact CZ-CD2 3.67Å; F36-L49 HydrophobicContact CZ-CG 4.04Å; L49-L52 PolarHBondContact O-N 3.3Å; L49-L53 VanDerWaalsContact O-CG 3.3Å; L49-L53 WeakPolarHBondContact O-CG 3.22Å; L49-L53 PolarHBondContact O-N 3.45Å; L49-L53 VanDerWaalsContact O-N 3.15Å
50	L	81.3	Confident	79	Confident	123 Å²	123	109.9 Å²	109.9	64%	0.644	66%	0.658	S	S	*	*	H	α-helix	trans	-68.1	-42.9	177.7	-76.1	163.2	0	0	0	112.1	T48 L52 L53 W54	T48-L50 PolarHBondContact O-N 2.93Å; L50-L52 VanDerWaalsContact C-N 3.3Å; L50-L52 PolarHBondContact O-N 3.27Å; L50-L53 PolarHBondContact O-N 3.41Å; L50-W54 WeakPolarHBondContact O-CB 3.24Å; L50-W54 PolarHBondContact O-N 3.27Å
51	S	78.7	Confident	78.9	Confident	57 Å²	57	114.5 Å²	114.5	40%	0.399	68%	0.679	S	S	.	*	H	α-helix	trans	-66.7	-31.9	177.2	61.2	0	0	0	0	112.6	T48 G55	T48-S51 PolarHBondContact N-OG 3.31Å; T48-S51 PolarHBondContact O-N 2.89Å; T48-S51 PolarHBondContact O-OG 3.2Å; T48-S51 PolarHBondContact OG1-N 3.49Å; T48-S51 PolarHBondContact OG1-OG 2.97Å; S51-G55 WeakPolarHBondContact O-CA 3.14Å; S51-G55 PolarHBondContact O-N 2.91Å
52	L	81.8	Confident	78.7	Confident	100 Å²	100	115 Å²	115	52%	0.524	69%	0.687	S	S	.	*	H	α-helix	trans	-72	-31.9	175.3	-91.8	154	0	0	0	114.2	L32 F36 T48 L49 L50	L32-L52 HydrophobicContact CD2-CD1 4.04Å; L32-L52 HydrophobicContact CD2-CD2 4.33Å; F36-L52 HydrophobicContact CE1-CD1 3.89Å; F36-L52 HydrophobicContact CE2-CD1 3.87Å; F36-L52 HydrophobicContact CZ-CD1 3.24Å; T48-L52 PolarHBondContact O-N 3.24Å; L49-L52 PolarHBondContact O-N 3.3Å; L50-L52 VanDerWaalsContact C-N 3.3Å; L50-L52 PolarHBondContact O-N 3.27Å
53	L	82.7	Confident	78.6	Confident	132 Å²	132	113.5 Å²	113.5	69%	0.691	67%	0.672	S	S	*	*	H	α-helix	trans	-89.4	-29	-178.1	-69.9	171.2	0	0	0	112.9	L49 L50	L49-L53 VanDerWaalsContact O-CG 3.3Å; L49-L53 WeakPolarHBondContact O-CG 3.22Å; L49-L53 PolarHBondContact O-N 3.45Å; L49-L53 VanDerWaalsContact O-N 3.15Å; L50-L53 PolarHBondContact O-N 3.41Å
54	W	77.4	Confident	78.5	Confident	211 Å²	211	115.6 Å²	115.6	80%	0.799	65%	0.653	S	S	*	*	H	α-helix	trans	-115.3	-7.1	-173.2	-71.2	124.4	0	0	0	116.4	L50	L50-W54 WeakPolarHBondContact O-CB 3.24Å; L50-W54 PolarHBondContact O-N 3.27Å
55	G	61.3	Low	78.1	Confident	127 Å²	127	114.3 Å²	114.3	100%	1.309	65%	0.654	S	S	*	*			trans	56.2	0	167.6	0	0	0	0	0	115.2	S51	S51-G55 WeakPolarHBondContact O-CA 3.14Å; S51-G55 PolarHBondContact O-N 2.91Å

Retrieved 55 of 55 residues in 15.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).