A0A087X8R5_POEFO Loading...

Cytochrome c oxidase subunit 7C, mitochondrial

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

AlphaFold DB , UniProt , Accession A0A087X8R5, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 63 aa.

						>A0A087X8R5_POEFO|A0A087X8R5
MLGQAVRRFATSAVRSSHYAEGPGKNLPFSVDNKWRLLGMMVLFFGSGFTFPFIVVRHQLLKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	70.7	Confident	86.9	Confident	199 Å²	199	118.5 Å²	118.5	98%	0.98	62%	0.616	S	S	*	*				0	-56.1	0	-64.2	-63.1	175.6	0	0	112.3	G3 Q4 A5	M1-G3 PolarHBondContact O-N 3.43Å; M1-Q4 PolarHBondContact O-N 3.3Å; M1-A5 PolarHBondContact O-N 3.49Å
2	L	85.6	Confident	86.8	Confident	142 Å²	142	114.9 Å²	114.9	74%	0.743	61%	0.608	S	S	*	*	H	α-helix	trans	-60	-46.8	-176.2	-162	107.7	0	0	0	114.6	Q4 A5 V6	L2-Q4 VanDerWaalsContact C-N 3.31Å; L2-Q4 PolarHBondContact O-N 3.11Å; L2-A5 WeakPolarHBondContact O-CB 3.34Å; L2-A5 PolarHBondContact O-N 3.37Å; L2-V6 HydrophobicContact CD2-CG2 4.49Å; L2-V6 WeakPolarHBondContact O-CG2 3.26Å; L2-V6 PolarHBondContact O-N 3.19Å
3	G	87.2	Confident	86.6	Confident	54 Å²	54	110 Å²	110	56%	0.557	59%	0.594	S	S	*	*	H	α-helix	trans	-62.8	-33.1	-179.7	0	0	0	0	0	114.4	M1 R7	M1-G3 PolarHBondContact O-N 3.43Å; G3-R7 WeakPolarHBondContact O-CB 3.26Å; G3-R7 PolarHBondContact O-N 3.31Å
4	Q	86.7	Confident	86.6	Confident	120 Å²	120	109.1 Å²	109.1	56%	0.561	59%	0.593	S	S	*	*	H	α-helix	trans	-69.8	-38.1	172.5	-80.8	-175.5	-22.4	0	0	111.7	M1 L2 R7 R8	M1-Q4 PolarHBondContact O-N 3.3Å; L2-Q4 VanDerWaalsContact C-N 3.31Å; L2-Q4 PolarHBondContact O-N 3.11Å; Q4-R7 PolarHBondContact O-N 3.47Å; Q4-R8 WeakPolarHBondContact O-CB 3.21Å; Q4-R8 VanDerWaalsContact O-CG 3.24Å; Q4-R8 WeakPolarHBondContact O-CG 3.36Å; Q4-R8 PolarHBondContact O-N 3.46Å
5	A	89.4	Confident	86.4	Confident	58 Å²	58	114.7 Å²	114.7	48%	0.479	60%	0.602	S	S	.	*	H	α-helix	trans	-65.5	-44.2	175.9	0	0	0	0	0	111.7	M1 L2 R7 R8 F9	M1-A5 PolarHBondContact O-N 3.49Å; L2-A5 WeakPolarHBondContact O-CB 3.34Å; L2-A5 PolarHBondContact O-N 3.37Å; A5-R7 PolarHBondContact O-N 2.9Å; A5-R8 PolarHBondContact O-N 3.47Å; A5-F9 WeakPolarHBondContact O-CB 3.34Å; A5-F9 PolarHBondContact O-N 3.28Å
6	V	91.5	Very high	86	Confident	86 Å²	86	110.9 Å²	110.9	52%	0.521	59%	0.589	S	S	.	*	H	α-helix	trans	-60.6	-45.9	175	173.5	0	0	0	0	111	L2 R8 F9 A10	L2-V6 HydrophobicContact CD2-CG2 4.49Å; L2-V6 WeakPolarHBondContact O-CG2 3.26Å; L2-V6 PolarHBondContact O-N 3.19Å; V6-R8 PolarHBondContact O-N 2.92Å; V6-F9 PolarHBondContact O-N 2.66Å; V6-A10 WeakPolarHBondContact O-CB 3.09Å; V6-A10 PolarHBondContact O-N 3.17Å
7	R	89.4	Confident	85.7	Confident	190 Å²	190	110.1 Å²	110.1	72%	0.717	59%	0.594	S	S	*	*	H	α-helix	trans	-59.1	-48.6	176	-177.8	176.9	175.4	-178	-0.9	111.4	G3 Q4 A5 F9 A10 T11	G3-R7 WeakPolarHBondContact O-CB 3.26Å; G3-R7 PolarHBondContact O-N 3.31Å; Q4-R7 PolarHBondContact O-N 3.47Å; A5-R7 PolarHBondContact O-N 2.9Å; R7-F9 PolarHBondContact O-N 3.38Å; R7-A10 PolarHBondContact O-N 3.34Å; R7-T11 HydrophobicContact CG-CG2 4.41Å; R7-T11 WeakPolarHBondContact O-CB 3.25Å; R7-T11 WeakPolarHBondContact O-CG2 3.29Å; R7-T11 PolarHBondContact O-N 3.35Å; R7-T11 PolarHBondContact O-OG1 2.87Å
8	R	88.9	Confident	85.8	Confident	170 Å²	170	111.6 Å²	111.6	64%	0.642	60%	0.596	S	S	*	*	H	α-helix	trans	-59.7	-46.1	179.3	-75	173	-179.5	-175	1.1	111.5	Q4 A5 V6 T11 S12	Q4-R8 WeakPolarHBondContact O-CB 3.21Å; Q4-R8 VanDerWaalsContact O-CG 3.24Å; Q4-R8 WeakPolarHBondContact O-CG 3.36Å; Q4-R8 PolarHBondContact O-N 3.46Å; A5-R8 PolarHBondContact O-N 3.47Å; V6-R8 PolarHBondContact O-N 2.92Å; R8-T11 WeakPolarHBondContact CA-OG1 3.3Å; R8-T11 PolarHBondContact O-N 2.85Å; R8-T11 PolarHBondContact O-OG1 3.12Å; R8-S12 WeakPolarHBondContact O-CB 3.43Å; R8-S12 PolarHBondContact O-N 3.34Å; R8-S12 PolarHBondContact O-OG 3.22Å; R8-S12 VanDerWaalsContact O-OG 3.04Å
9	F	90.7	Very high	85.8	Confident	159 Å²	159	114 Å²	114	70%	0.697	60%	0.597	S	S	*	*	H	α-helix	trans	-60.4	-50.6	177.2	179.6	-97.3	0	0	0	112.1	A5 V6 R7 T11 S12 A13	A5-F9 WeakPolarHBondContact O-CB 3.34Å; A5-F9 PolarHBondContact O-N 3.28Å; V6-F9 PolarHBondContact O-N 2.66Å; R7-F9 PolarHBondContact O-N 3.38Å; F9-T11 VanDerWaalsContact C-N 3.35Å; F9-T11 PolarHBondContact O-N 2.82Å; F9-S12 PolarHBondContact O-N 3.47Å; F9-A13 PolarHBondContact O-N 3.15Å
10	A	89.2	Confident	85.9	Confident	48 Å²	48	111.7 Å²	111.7	40%	0.397	60%	0.595	S	S	.	*	H	α-helix	trans	-61.1	-42.5	179	0	0	0	0	0	111.8	V6 R7 S12 A13 V14	V6-A10 WeakPolarHBondContact O-CB 3.09Å; V6-A10 PolarHBondContact O-N 3.17Å; R7-A10 PolarHBondContact O-N 3.34Å; A10-S12 VanDerWaalsContact C-N 3.35Å; A10-S12 PolarHBondContact O-N 3.37Å; A10-A13 PolarHBondContact O-N 3.32Å; A10-V14 VanDerWaalsContact O-CG2 3.3Å; A10-V14 WeakPolarHBondContact O-CG2 3.45Å; A10-V14 PolarHBondContact O-N 2.97Å
11	T	86.9	Confident	85.9	Confident	78 Å²	78	112.9 Å²	112.9	48%	0.479	60%	0.597	S	S	.	*	H	α-helix	trans	-65.6	-36.7	176.9	50.9	0	0	0	0	112.9	R7 R8 F9 R15	R7-T11 HydrophobicContact CG-CG2 4.41Å; R7-T11 WeakPolarHBondContact O-CB 3.25Å; R7-T11 WeakPolarHBondContact O-CG2 3.29Å; R7-T11 PolarHBondContact O-N 3.35Å; R7-T11 PolarHBondContact O-OG1 2.87Å; R8-T11 WeakPolarHBondContact CA-OG1 3.3Å; R8-T11 PolarHBondContact O-N 2.85Å; R8-T11 PolarHBondContact O-OG1 3.12Å; F9-T11 VanDerWaalsContact C-N 3.35Å; F9-T11 PolarHBondContact O-N 2.82Å; T11-R15 WeakPolarHBondContact O-CB 3.44Å; T11-R15 PolarHBondContact O-N 2.94Å
12	S	84.8	Confident	86.9	Confident	75 Å²	75	105.4 Å²	105.4	52%	0.524	57%	0.572	S	S	.	*	H	α-helix	trans	-67.4	-42.8	176.2	-65.2	0	0	0	0	111.5	R8 F9 A10 R15 S16	R8-S12 WeakPolarHBondContact O-CB 3.43Å; R8-S12 PolarHBondContact O-N 3.34Å; R8-S12 PolarHBondContact O-OG 3.22Å; R8-S12 VanDerWaalsContact O-OG 3.04Å; F9-S12 PolarHBondContact O-N 3.47Å; A10-S12 VanDerWaalsContact C-N 3.35Å; A10-S12 PolarHBondContact O-N 3.37Å; S12-R15 PolarHBondContact O-N 2.88Å; S12-S16 WeakPolarHBondContact O-CB 3.28Å; S12-S16 PolarHBondContact O-N 3.28Å
13	A	85.2	Confident	87.3	Confident	51 Å²	51	105.1 Å²	105.1	42%	0.421	58%	0.578	S	S	.	*	H	α-helix	trans	-62.2	-43.1	176.7	0	0	0	0	0	112.1	F9 A10 R15 S16 S17	F9-A13 PolarHBondContact O-N 3.15Å; A10-A13 PolarHBondContact O-N 3.32Å; A13-R15 VanDerWaalsContact C-N 3.35Å; A13-R15 PolarHBondContact O-N 3.16Å; A13-S16 PolarHBondContact O-N 2.9Å; A13-S17 PolarHBondContact O-N 2.97Å; A13-S17 PolarHBondContact O-OG 3.26Å
14	V	86.3	Confident	87.7	Confident	97 Å²	97	103.3 Å²	103.3	59%	0.588	56%	0.56	S	S	*	*	H	α-helix	trans	-65.4	-36.9	176.1	171.8	0	0	0	0	112	A10 S17 H18	A10-V14 VanDerWaalsContact O-CG2 3.3Å; A10-V14 WeakPolarHBondContact O-CG2 3.45Å; A10-V14 PolarHBondContact O-N 2.97Å; V14-S17 PolarHBondContact O-OG 2.88Å; V14-H18 WeakPolarHBondContact O-CB 3.45Å; V14-H18 PolarHBondContact O-N 3.32Å
15	R	82.8	Confident	88	Confident	193 Å²	193	102.4 Å²	102.4	73%	0.728	55%	0.554	S	S	*	*	H	α-helix	trans	-69.2	-42.5	178	-177	179.5	173.6	122.8	-0.1	112	T11 S12 A13 H18	T11-R15 WeakPolarHBondContact O-CB 3.44Å; T11-R15 PolarHBondContact O-N 2.94Å; S12-R15 PolarHBondContact O-N 2.88Å; A13-R15 VanDerWaalsContact C-N 3.35Å; A13-R15 PolarHBondContact O-N 3.16Å; R15-H18 PolarHBondContact O-N 3.44Å
16	S	80.8	Confident	88.2	Confident	55 Å²	55	105.8 Å²	105.8	39%	0.385	56%	0.564	S	S	.	*	H	α-helix	trans	-65.9	-38.2	177.6	175.5	0	0	0	0	111.7	S12 A13 H18 Y19 E21	S12-S16 WeakPolarHBondContact O-CB 3.28Å; S12-S16 PolarHBondContact O-N 3.28Å; A13-S16 PolarHBondContact O-N 2.9Å; S16-H18 VanDerWaalsContact C-N 3.32Å; S16-H18 PolarHBondContact O-N 3.48Å; S16-Y19 VanDerWaalsContact O-O 3.07Å; S16-E21 WeakPolarHBondContact CA-OE1 3.3Å; S16-E21 VanDerWaalsContact CB-OE1 3.31Å; S16-E21 WeakPolarHBondContact CB-OE1 3.38Å; S16-E21 PolarHBondContact OG-OE1 3.21Å
17	S	81.3	Confident	88.3	Confident	96 Å²	96	105.1 Å²	105.1	67%	0.671	56%	0.557	S	S	*	*	H	α-helix	trans	-71.3	-24.6	178.1	66.5	0	0	0	0	114.3	A13 V14	A13-S17 PolarHBondContact O-N 2.97Å; A13-S17 PolarHBondContact O-OG 3.26Å; V14-S17 PolarHBondContact O-OG 2.88Å
18	H	87.2	Confident	88.6	Confident	138 Å²	138	102.2 Å²	102.2	64%	0.639	56%	0.563	S	S	*	*	H	α-helix	trans	-78.6	-28.1	-175.7	-169.7	-77.8	0	0	0	113.5	V14 R15 S16	V14-H18 WeakPolarHBondContact O-CB 3.45Å; V14-H18 PolarHBondContact O-N 3.32Å; R15-H18 PolarHBondContact O-N 3.44Å; S16-H18 VanDerWaalsContact C-N 3.32Å; S16-H18 PolarHBondContact O-N 3.48Å
19	Y	86.1	Confident	89	Confident	157 Å²	157	97.7 Å²	97.7	62%	0.616	55%	0.548	S	S	*	.	S	Bend	trans	-112.7	129.7	179.6	-67.3	-77.1	0	0	0	109.9	S16 E21	S16-Y19 VanDerWaalsContact O-O 3.07Å; Y19-E21 PolarHBondContact O-N 2.89Å; Y19-E21 VanDerWaalsContact O-N 3.12Å
20	A	86.8	Confident	89.2	Confident	67 Å²	67	91.5 Å²	91.5	55%	0.554	52%	0.524	S	S	*	.			trans	-62.3	119.3	175.3	0	0	0	0	0	109.4	K25	A20-K25 HydrophobicContact CB-CB 3.7Å; A20-K25 HydrophobicContact CB-CD 4.29Å; A20-K25 HydrophobicContact CB-CG 4.02Å; A20-K25 VanDerWaalsContact O-CB 3.29Å; A20-K25 WeakPolarHBondContact O-CB 3.33Å
21	E	87.3	Confident	89.6	Confident	137 Å²	137	91.6 Å²	91.6	64%	0.64	52%	0.52	S	S	*	.			trans	-91.6	160.1	176.7	-63.5	-175.2	-173.1	0	0	110.8	S16 Y19	S16-E21 WeakPolarHBondContact CA-OE1 3.3Å; S16-E21 VanDerWaalsContact CB-OE1 3.31Å; S16-E21 WeakPolarHBondContact CB-OE1 3.38Å; S16-E21 PolarHBondContact OG-OE1 3.21Å; Y19-E21 PolarHBondContact O-N 2.89Å; Y19-E21 VanDerWaalsContact O-N 3.12Å
22	G	90.2	Very high	90.1	Very high	43 Å²	43	93.4 Å²	93.4	44%	0.443	53%	0.527	S	S	.	.	S	Bend	trans	101.7	171.9	176.8	0	0	0	0	0	115.2	G24 K25	G22-G24 PolarHBondContact O-N 3.43Å; G22-K25 PolarHBondContact O-N 2.9Å
23	P	95.2	Very high	90.7	Very high	135 Å²	135	93.8 Å²	93.8	88%	0.877	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.5	131.5	-175.6	-25.8	35.3	0	0	0	112.6	K25	P23-K25 PolarHBondContact O-N 2.89Å
24	G	94.3	Very high	91.3	Very high	17 Å²	17	98.7 Å²	98.7	18%	0.175	54%	0.535	C	S	.	.	T	Hydrogen-bonded Turn	trans	79.1	-7.9	177.5	0	0	0	0	0	115.5	G22	G22-G24 PolarHBondContact O-N 3.43Å
25	K	93.8	Very high	91.9	Very high	101 Å²	101	102.6 Å²	102.6	44%	0.439	54%	0.539	S	S	.	.	T	Hydrogen-bonded Turn	trans	-93.5	-14.3	176.6	-60.3	-53.6	-173.9	-167.3	0	113.6	A20 G22 P23 L27 D32	A20-K25 HydrophobicContact CB-CB 3.7Å; A20-K25 HydrophobicContact CB-CD 4.29Å; A20-K25 HydrophobicContact CB-CG 4.02Å; A20-K25 VanDerWaalsContact O-CB 3.29Å; A20-K25 WeakPolarHBondContact O-CB 3.33Å; G22-K25 PolarHBondContact O-N 2.9Å; P23-K25 PolarHBondContact O-N 2.89Å; K25-L27 VanDerWaalsContact C-N 3.31Å; K25-D32 IonicContact NZ-OD1 2.91Å; K25-D32 PolarHBondContact NZ-OD1 3.41Å; K25-D32 IonicContact NZ-OD2 3.72Å
26	N	93	Very high	92.6	Very high	128 Å²	128	100 Å²	100	68%	0.684	53%	0.529	S	S	*	.	S	Bend	trans	-89.3	9.2	173.3	67.6	-22.3	0	0	0	113.8
27	L	95.1	Very high	93.5	Very high	73 Å²	73	99.5 Å²	99.5	38%	0.382	52%	0.522	S	S	.	.	S	Bend	trans	-101.4	146.2	-179.8	-62.5	175.7	0	0	0	110.6	K25 F29 V31	K25-L27 VanDerWaalsContact C-N 3.31Å; L27-F29 HydrophobicContact CB-CE1 4.49Å; L27-F29 HydrophobicContact CB-CZ 4.44Å; L27-F29 HydrophobicContact CD1-CE2 4.03Å; L27-F29 HydrophobicContact CD1-CZ 4.12Å; L27-F29 PolarHBondContact O-N 3.23Å; L27-F29 VanDerWaalsContact O-N 3.11Å; L27-V31 HydrophobicContact CD1-CG1 3.75Å
28	P	95	Very high	94.3	Very high	128 Å²	128	99.4 Å²	99.4	83%	0.831	51%	0.513	S	S	*	.	S	Bend	trans	-76.9	11.4	177.3	32.1	-34.4	0	0	0	113.5
29	F	96.4	Very high	94.8	Very high	75 Å²	75	94.4 Å²	94.4	33%	0.329	50%	0.499	S	S	.	.	S	Bend	trans	-144.7	151.1	176.6	53.5	-92.6	0	0	0	110	L27 V31 L37 M40 M41	L27-F29 HydrophobicContact CB-CE1 4.49Å; L27-F29 HydrophobicContact CB-CZ 4.44Å; L27-F29 HydrophobicContact CD1-CE2 4.03Å; L27-F29 HydrophobicContact CD1-CZ 4.12Å; L27-F29 PolarHBondContact O-N 3.23Å; L27-F29 VanDerWaalsContact O-N 3.11Å; F29-V31 HydrophobicContact CD2-CG1 4.2Å; F29-V31 HydrophobicContact CE2-CG1 3.98Å; F29-L37 HydrophobicContact CD2-CD1 3.83Å; F29-L37 HydrophobicContact CE2-CD1 3.71Å; F29-M40 HydrophobicContact CB-SD 4.46Å; F29-M41 HydrophobicContact CE2-CE 4.24Å; F29-M41 HydrophobicContact CZ-CE 4.28Å
30	S	95.9	Very high	95.4	Very high	30 Å²	30	90.1 Å²	90.1	21%	0.21	49%	0.485	C	S	.	.			trans	-75.9	136.7	-179.9	170.4	0	0	0	0	111.2	D32	S30-D32 PolarHBondContact OG-N 2.98Å; S30-D32 PolarHBondContact OG-OD2 2.9Å
31	V	97.4	Very high	96	Very high	49 Å²	49	89.5 Å²	89.5	30%	0.297	47%	0.472	S	S	.	.			trans	-108.8	6	172.1	-62.5	0	0	0	0	112.5	L27 F29 N33 L37	L27-V31 HydrophobicContact CD1-CG1 3.75Å; F29-V31 HydrophobicContact CD2-CG1 4.2Å; F29-V31 HydrophobicContact CE2-CG1 3.98Å; V31-N33 VanDerWaalsContact C-N 3.27Å; V31-N33 PolarHBondContact O-N 3.4Å; V31-L37 HydrophobicContact CB-CD2 4.19Å; V31-L37 HydrophobicContact CG1-CD1 4.12Å; V31-L37 HydrophobicContact CG1-CD2 4Å
32	D	96.9	Very high	96.5	Very high	117 Å²	117	87.3 Å²	87.3	63%	0.626	47%	0.468	S	S	*	.	S	Bend	trans	-68	-27.5	-171.8	-52.7	-57.8	0	0	0	112.2	K25 S30	K25-D32 IonicContact NZ-OD1 2.91Å; K25-D32 PolarHBondContact NZ-OD1 3.41Å; K25-D32 IonicContact NZ-OD2 3.72Å; S30-D32 PolarHBondContact OG-N 2.98Å; S30-D32 PolarHBondContact OG-OD2 2.9Å
33	N	98	Very high	96.9	Very high	82 Å²	82	91.4 Å²	91.4	44%	0.439	48%	0.479	S	S	.	.			trans	-119.9	114.3	174.9	-178.1	-26.1	0	0	0	110.9	V31 W35 R36 L37	V31-N33 VanDerWaalsContact C-N 3.27Å; V31-N33 PolarHBondContact O-N 3.4Å; N33-W35 VanDerWaalsContact C-N 3.29Å; N33-W35 PolarHBondContact O-N 3.43Å; N33-W35 WeakPolarHBondContact OD1-CB 3.46Å; N33-W35 PolarHBondContact OD1-N 3.47Å; N33-R36 HydrophobicContact CB-CB 4.06Å; N33-R36 PolarHBondContact O-N 3.08Å; N33-R36 PolarHBondContact OD1-N 2.96Å; N33-L37 WeakPolarHBondContact O-CB 3.37Å; N33-L37 PolarHBondContact O-N 2.71Å
34	K	97.8	Very high	97.1	Very high	155 Å²	155	91.8 Å²	91.8	67%	0.674	47%	0.467	S	S	*	.	H	α-helix	trans	-57.8	-34.8	-179.1	65.4	-175.6	174.9	-174.7	0	114.5	L38	K34-L38 VanDerWaalsContact O-CB 3.32Å; K34-L38 WeakPolarHBondContact O-CB 3.31Å; K34-L38 PolarHBondContact O-N 3.39Å
35	W	98.6	Very high	97.3	Very high	179 Å²	179	97.2 Å²	97.2	68%	0.678	49%	0.486	S	S	*	.	H	α-helix	trans	-74.5	-38.7	179.9	-63.8	114.8	0	0	0	111.9	N33 L38 G39	N33-W35 VanDerWaalsContact C-N 3.29Å; N33-W35 PolarHBondContact O-N 3.43Å; N33-W35 WeakPolarHBondContact OD1-CB 3.46Å; N33-W35 PolarHBondContact OD1-N 3.47Å; W35-L38 HydrophobicContact CE3-CD2 4.07Å; W35-L38 HydrophobicContact CZ3-CD2 4.14Å; W35-L38 PolarHBondContact O-N 2.78Å; W35-G39 PolarHBondContact O-N 3.47Å
36	R	98.2	Very high	97.5	Very high	139 Å²	139	93.7 Å²	93.7	53%	0.525	48%	0.478	S	S	.	.	H	α-helix	trans	-65.2	-44	172.6	-176	-178.7	174.4	-160.5	0.5	110.8	N33 G39 M40	N33-R36 HydrophobicContact CB-CB 4.06Å; N33-R36 PolarHBondContact O-N 3.08Å; N33-R36 PolarHBondContact OD1-N 2.96Å; R36-G39 PolarHBondContact O-N 3.2Å; R36-M40 HydrophobicContact CG-CE 4.46Å; R36-M40 HydrophobicContact CG-SD 4.43Å; R36-M40 WeakPolarHBondContact O-CG 3.33Å; R36-M40 PolarHBondContact O-N 2.92Å
37	L	98.5	Very high	97.8	Very high	44 Å²	44	90.9 Å²	90.9	23%	0.23	47%	0.468	C	S	.	.	H	α-helix	trans	-59.8	-47.8	176.1	178.7	61.1	0	0	0	111	F29 V31 N33 G39 M40 M41	F29-L37 HydrophobicContact CD2-CD1 3.83Å; F29-L37 HydrophobicContact CE2-CD1 3.71Å; V31-L37 HydrophobicContact CB-CD2 4.19Å; V31-L37 HydrophobicContact CG1-CD1 4.12Å; V31-L37 HydrophobicContact CG1-CD2 4Å; N33-L37 WeakPolarHBondContact O-CB 3.37Å; N33-L37 PolarHBondContact O-N 2.71Å; L37-G39 VanDerWaalsContact C-N 3.35Å; L37-G39 PolarHBondContact O-N 2.9Å; L37-M40 PolarHBondContact O-N 3.35Å; L37-M41 HydrophobicContact CD1-CE 4.31Å; L37-M41 HydrophobicContact CD1-CG 4.18Å; L37-M41 HydrophobicContact CG-CG 4.44Å; L37-M41 VanDerWaalsContact O-CG 3.31Å; L37-M41 WeakPolarHBondContact O-CG 3.32Å; L37-M41 PolarHBondContact O-N 3.02Å
38	L	98.7	Very high	97.9	Very high	93 Å²	93	89.7 Å²	89.7	49%	0.487	47%	0.474	S	S	.	.	H	α-helix	trans	-56.3	-49.6	175.9	177.8	64.8	0	0	0	111.2	K34 W35 M40 M41 V42	K34-L38 VanDerWaalsContact O-CB 3.32Å; K34-L38 WeakPolarHBondContact O-CB 3.31Å; K34-L38 PolarHBondContact O-N 3.39Å; W35-L38 HydrophobicContact CE3-CD2 4.07Å; W35-L38 HydrophobicContact CZ3-CD2 4.14Å; W35-L38 PolarHBondContact O-N 2.78Å; L38-M40 VanDerWaalsContact C-N 3.34Å; L38-M40 PolarHBondContact O-N 3.3Å; L38-M41 PolarHBondContact O-N 2.76Å; L38-V42 HydrophobicContact CD1-CG2 4.19Å; L38-V42 HydrophobicContact CG-CG2 4.48Å; L38-V42 WeakPolarHBondContact O-CG2 3.28Å; L38-V42 PolarHBondContact O-N 3.25Å
39	G	98.7	Very high	98.1	Very high	33 Å²	33	90.6 Å²	90.6	34%	0.34	47%	0.465	S	S	.	.	H	α-helix	trans	-57.3	-45.2	177	0	0	0	0	0	112.6	W35 R36 L37 V42 L43	W35-G39 PolarHBondContact O-N 3.47Å; R36-G39 PolarHBondContact O-N 3.2Å; L37-G39 VanDerWaalsContact C-N 3.35Å; L37-G39 PolarHBondContact O-N 2.9Å; G39-V42 PolarHBondContact O-N 3.26Å; G39-L43 WeakPolarHBondContact O-CG 3.24Å; G39-L43 PolarHBondContact O-N 2.91Å
40	M	98.4	Very high	98.2	Very high	67 Å²	67	90 Å²	90	33%	0.33	47%	0.467	S	S	.	.	H	α-helix	trans	-62	-43	176.2	-77.6	179.3	163.8	0	0	112.6	F29 R36 L37 L38 L43 F44	F29-M40 HydrophobicContact CB-SD 4.46Å; R36-M40 HydrophobicContact CG-CE 4.46Å; R36-M40 HydrophobicContact CG-SD 4.43Å; R36-M40 WeakPolarHBondContact O-CG 3.33Å; R36-M40 PolarHBondContact O-N 2.92Å; L37-M40 PolarHBondContact O-N 3.35Å; L38-M40 VanDerWaalsContact C-N 3.34Å; L38-M40 PolarHBondContact O-N 3.3Å; M40-L43 PolarHBondContact O-N 3.11Å; M40-F44 VanDerWaalsContact O-CB 3.3Å; M40-F44 WeakPolarHBondContact O-CB 3.12Å; M40-F44 PolarHBondContact O-N 3.02Å
41	M	98.6	Very high	98.3	Very high	55 Å²	55	95.1 Å²	95.1	27%	0.271	49%	0.486	S	S	.	.	H	α-helix	trans	-65.8	-43.4	178	-67.2	-62.3	96.2	0	0	111.8	F29 L37 L38 L43 F44 F45	F29-M41 HydrophobicContact CE2-CE 4.24Å; F29-M41 HydrophobicContact CZ-CE 4.28Å; L37-M41 HydrophobicContact CD1-CE 4.31Å; L37-M41 HydrophobicContact CD1-CG 4.18Å; L37-M41 HydrophobicContact CG-CG 4.44Å; L37-M41 VanDerWaalsContact O-CG 3.31Å; L37-M41 WeakPolarHBondContact O-CG 3.32Å; L37-M41 PolarHBondContact O-N 3.02Å; L38-M41 PolarHBondContact O-N 2.76Å; M41-L43 VanDerWaalsContact C-N 3.34Å; M41-L43 PolarHBondContact O-N 3.37Å; M41-F44 PolarHBondContact O-N 3.4Å; M41-F45 HydrophobicContact CB-CD2 4.27Å; M41-F45 HydrophobicContact CB-CE2 4.47Å; M41-F45 WeakPolarHBondContact O-CB 3.1Å; M41-F45 VanDerWaalsContact O-CD2 3.28Å; M41-F45 WeakPolarHBondContact O-CD2 3.46Å; M41-F45 PolarHBondContact O-N 2.91Å; M41-F45 HydrophobicContact SD-CD2 4.34Å; M41-F45 HydrophobicContact SD-CE2 3.66Å
42	V	98.6	Very high	98.4	Very high	91 Å²	91	96.1 Å²	96.1	55%	0.552	49%	0.494	S	S	*	.	H	α-helix	trans	-61.4	-43.5	176.2	170.8	0	0	0	0	110.9	L38 G39 G46	L38-V42 HydrophobicContact CD1-CG2 4.19Å; L38-V42 HydrophobicContact CG-CG2 4.48Å; L38-V42 WeakPolarHBondContact O-CG2 3.28Å; L38-V42 PolarHBondContact O-N 3.25Å; G39-V42 PolarHBondContact O-N 3.26Å; V42-G46 WeakPolarHBondContact O-CA 3.3Å; V42-G46 PolarHBondContact O-N 3.2Å
43	L	98.5	Very high	98.4	Very high	129 Å²	129	96.7 Å²	96.7	68%	0.675	49%	0.491	S	S	*	.	H	α-helix	trans	-67.4	-45.2	177.7	-70.5	174.6	0	0	0	112.1	G39 M40 M41 S47	G39-L43 WeakPolarHBondContact O-CG 3.24Å; G39-L43 PolarHBondContact O-N 2.91Å; M40-L43 PolarHBondContact O-N 3.11Å; M41-L43 VanDerWaalsContact C-N 3.34Å; M41-L43 PolarHBondContact O-N 3.37Å; L43-S47 WeakPolarHBondContact O-CB 3.47Å; L43-S47 PolarHBondContact O-N 2.63Å; L43-S47 PolarHBondContact O-OG 3.12Å
44	F	98.3	Very high	98.4	Very high	143 Å²	143	97.9 Å²	97.9	63%	0.627	50%	0.496	S	S	*	.	H	α-helix	trans	-64.7	-55.8	-178.5	-178.9	-105.7	0	0	0	111.8	M40 M41 S47 G48	M40-F44 VanDerWaalsContact O-CB 3.3Å; M40-F44 WeakPolarHBondContact O-CB 3.12Å; M40-F44 PolarHBondContact O-N 3.02Å; M41-F44 PolarHBondContact O-N 3.4Å; F44-S47 PolarHBondContact O-OG 3.44Å; F44-G48 PolarHBondContact O-N 3.28Å
45	F	98.6	Very high	98.5	Very high	131 Å²	131	93.1 Å²	93.1	58%	0.575	48%	0.48	S	S	*	.	H	α-helix	trans	-74.6	-40	-179.5	-66.6	-65.1	0	0	0	112.3	M41 S47 G48 F49	M41-F45 HydrophobicContact CB-CD2 4.27Å; M41-F45 HydrophobicContact CB-CE2 4.47Å; M41-F45 WeakPolarHBondContact O-CB 3.1Å; M41-F45 VanDerWaalsContact O-CD2 3.28Å; M41-F45 WeakPolarHBondContact O-CD2 3.46Å; M41-F45 PolarHBondContact O-N 2.91Å; M41-F45 HydrophobicContact SD-CD2 4.34Å; M41-F45 HydrophobicContact SD-CE2 3.66Å; F45-S47 PolarHBondContact O-N 3.32Å; F45-G48 PolarHBondContact O-N 3.47Å; F45-F49 VanDerWaalsContact O-CB 3.28Å; F45-F49 WeakPolarHBondContact O-CB 3.5Å; F45-F49 PolarHBondContact O-N 2.98Å
46	G	98.6	Very high	98.5	Very high	26 Å²	26	88.7 Å²	88.7	27%	0.268	47%	0.472	S	S	.	.	H	α-helix	trans	-63.4	-39.6	179.2	0	0	0	0	0	112.2	V42 F49 T50	V42-G46 WeakPolarHBondContact O-CA 3.3Å; V42-G46 PolarHBondContact O-N 3.2Å; G46-F49 PolarHBondContact O-N 3.02Å; G46-T50 VanDerWaalsContact O-CB 3.29Å; G46-T50 WeakPolarHBondContact O-CB 3.48Å; G46-T50 VanDerWaalsContact O-CG2 3.25Å; G46-T50 WeakPolarHBondContact O-CG2 3.46Å; G46-T50 PolarHBondContact O-N 3.5Å; G46-T50 PolarHBondContact O-OG1 3.27Å
47	S	98.4	Very high	98.5	Very high	69 Å²	69	89.9 Å²	89.9	48%	0.483	48%	0.477	S	S	.	.	H	α-helix	trans	-64.4	-48.3	174.4	61.9	0	0	0	0	111.8	L43 F44 F45 F49 T50 F51	L43-S47 WeakPolarHBondContact O-CB 3.47Å; L43-S47 PolarHBondContact O-N 2.63Å; L43-S47 PolarHBondContact O-OG 3.12Å; F44-S47 PolarHBondContact O-OG 3.44Å; F45-S47 PolarHBondContact O-N 3.32Å; S47-F49 VanDerWaalsContact C-N 3.31Å; S47-F49 PolarHBondContact O-N 3.01Å; S47-T50 PolarHBondContact O-N 3.01Å; S47-T50 PolarHBondContact O-OG1 3.38Å; S47-F51 VanDerWaalsContact O-CB 3.24Å; S47-F51 WeakPolarHBondContact O-CB 3.29Å; S47-F51 PolarHBondContact O-N 2.96Å
48	G	98.3	Very high	98.4	Very high	49 Å²	49	92.5 Å²	92.5	51%	0.505	49%	0.488	S	S	.	.	H	α-helix	trans	-59.3	-40.4	176.4	0	0	0	0	0	113.2	F44 F45 P52	F44-G48 PolarHBondContact O-N 3.28Å; F45-G48 PolarHBondContact O-N 3.47Å; G48-P52 VanDerWaalsContact O-CD 3.3Å; G48-P52 WeakPolarHBondContact O-CD 3.31Å
49	F	98.5	Very high	98.4	Very high	146 Å²	146	93.3 Å²	93.3	64%	0.64	49%	0.489	S	S	*	.	H	α-helix	trans	-71.1	-41.7	178.3	-179.7	-103.4	0	0	0	112.8	F45 G46 S47 P52 F53	F45-F49 VanDerWaalsContact O-CB 3.28Å; F45-F49 WeakPolarHBondContact O-CB 3.5Å; F45-F49 PolarHBondContact O-N 2.98Å; G46-F49 PolarHBondContact O-N 3.02Å; S47-F49 VanDerWaalsContact C-N 3.31Å; S47-F49 PolarHBondContact O-N 3.01Å; F49-P52 WeakPolarHBondContact O-CD 3.49Å; F49-F53 HydrophobicContact CD1-CE2 4.43Å; F49-F53 HydrophobicContact CE1-CE2 4.03Å; F49-F53 HydrophobicContact CE2-CE2 4.22Å; F49-F53 AromaticContact CZ-CE2 3.92Å; F49-F53 HydrophobicContact CZ-CE2 3.92Å; F49-F53 HydrophobicContact CZ-CZ 4.21Å; F49-F53 WeakPolarHBondContact O-CD2 3.47Å; F49-F53 VanDerWaalsContact O-CE2 3.26Å; F49-F53 WeakPolarHBondContact O-CE2 3.48Å
50	T	98.6	Very high	98.4	Very high	63 Å²	63	98.4 Å²	98.4	39%	0.387	51%	0.508	S	S	.	.	H	α-helix	trans	-78	-26	-177.5	53	0	0	0	0	113.2	G46 S47 F53 I54	G46-T50 VanDerWaalsContact O-CB 3.29Å; G46-T50 WeakPolarHBondContact O-CB 3.48Å; G46-T50 VanDerWaalsContact O-CG2 3.25Å; G46-T50 WeakPolarHBondContact O-CG2 3.46Å; G46-T50 PolarHBondContact O-N 3.5Å; G46-T50 PolarHBondContact O-OG1 3.27Å; S47-T50 PolarHBondContact O-N 3.01Å; S47-T50 PolarHBondContact O-OG1 3.38Å; T50-F53 PolarHBondContact O-N 3.21Å; T50-F53 VanDerWaalsContact O-N 3.16Å; T50-I54 PolarHBondContact O-N 3.04Å; T50-I54 VanDerWaalsContact O-N 3.15Å
51	F	98.4	Very high	98.3	Very high	137 Å²	137	100.4 Å²	100.4	60%	0.601	52%	0.519	S	S	*	.	H	α-helix	trans	-54.8	-48.4	-174.5	-178.9	-98.1	0	0	0	114.2	S47 F53 I54 V55	S47-F51 VanDerWaalsContact O-CB 3.24Å; S47-F51 WeakPolarHBondContact O-CB 3.29Å; S47-F51 PolarHBondContact O-N 2.96Å; F51-F53 VanDerWaalsContact C-N 3.32Å; F51-F53 PolarHBondContact O-N 2.96Å; F51-I54 PolarHBondContact O-N 2.84Å; F51-V55 HydrophobicContact CD1-CG2 4.14Å; F51-V55 HydrophobicContact CE1-CG2 3.76Å; F51-V55 HydrophobicContact CE2-CG2 4.16Å; F51-V55 HydrophobicContact CG-CG2 4.5Å; F51-V55 HydrophobicContact CZ-CG2 3.77Å; F51-V55 WeakPolarHBondContact O-CG2 3.41Å; F51-V55 PolarHBondContact O-N 3.47Å
52	P	98.4	Very high	98.1	Very high	70 Å²	70	103.2 Å²	103.2	46%	0.455	53%	0.53	S	S	.	.	H	α-helix	trans	-58.8	-39.9	178	-25	35.2	0	0	0	113.4	G48 F49 V55 V56	G48-P52 VanDerWaalsContact O-CD 3.3Å; G48-P52 WeakPolarHBondContact O-CD 3.31Å; F49-P52 WeakPolarHBondContact O-CD 3.49Å; P52-V55 PolarHBondContact O-N 3.43Å; P52-V56 WeakPolarHBondContact O-CG2 3.3Å; P52-V56 PolarHBondContact O-N 3.4Å
53	F	98.4	Very high	96.9	Very high	130 Å²	130	112 Å²	112	57%	0.57	56%	0.561	S	S	*	*	H	α-helix	trans	-66.4	-40.1	179.4	-60.8	-84.9	0	0	0	111.9	F49 T50 F51 V55 V56 R57	F49-F53 HydrophobicContact CD1-CE2 4.43Å; F49-F53 HydrophobicContact CE1-CE2 4.03Å; F49-F53 HydrophobicContact CE2-CE2 4.22Å; F49-F53 AromaticContact CZ-CE2 3.92Å; F49-F53 HydrophobicContact CZ-CE2 3.92Å; F49-F53 HydrophobicContact CZ-CZ 4.21Å; F49-F53 WeakPolarHBondContact O-CD2 3.47Å; F49-F53 VanDerWaalsContact O-CE2 3.26Å; F49-F53 WeakPolarHBondContact O-CE2 3.48Å; T50-F53 PolarHBondContact O-N 3.21Å; T50-F53 VanDerWaalsContact O-N 3.16Å; F51-F53 VanDerWaalsContact C-N 3.32Å; F51-F53 PolarHBondContact O-N 2.96Å; F53-V55 VanDerWaalsContact C-N 3.34Å; F53-V56 PolarHBondContact O-N 3.42Å; F53-R57 WeakPolarHBondContact O-CB 3.39Å; F53-R57 PolarHBondContact O-N 3.49Å
54	I	98.4	Very high	96.8	Very high	107 Å²	107	111.2 Å²	111.2	55%	0.549	56%	0.555	S	S	.	*	H	α-helix	trans	-63.9	-43.4	175.1	-65.1	171.5	0	0	0	110	T50 F51 R57 H58	T50-I54 PolarHBondContact O-N 3.04Å; T50-I54 VanDerWaalsContact O-N 3.15Å; F51-I54 PolarHBondContact O-N 2.84Å; I54-R57 PolarHBondContact O-N 2.94Å; I54-H58 VanDerWaalsContact O-CB 3.3Å; I54-H58 WeakPolarHBondContact O-CB 3.37Å; I54-H58 PolarHBondContact O-N 2.91Å
55	V	98.4	Very high	96.7	Very high	55 Å²	55	109.5 Å²	109.5	33%	0.333	55%	0.551	S	S	.	*	H	α-helix	trans	-62.4	-47.6	177.3	171.9	0	0	0	0	111	F51 P52 F53 R57 H58 Q59	F51-V55 HydrophobicContact CD1-CG2 4.14Å; F51-V55 HydrophobicContact CE1-CG2 3.76Å; F51-V55 HydrophobicContact CE2-CG2 4.16Å; F51-V55 HydrophobicContact CG-CG2 4.5Å; F51-V55 HydrophobicContact CZ-CG2 3.77Å; F51-V55 WeakPolarHBondContact O-CG2 3.41Å; F51-V55 PolarHBondContact O-N 3.47Å; P52-V55 PolarHBondContact O-N 3.43Å; F53-V55 VanDerWaalsContact C-N 3.34Å; V55-R57 PolarHBondContact O-N 3.39Å; V55-H58 WeakPolarHBondContact O-CB 3.34Å; V55-H58 PolarHBondContact O-N 3.29Å; V55-H58 VanDerWaalsContact O-N 3.17Å; V55-Q59 HydrophobicContact CG1-CG 4.49Å; V55-Q59 WeakPolarHBondContact O-CG 3.37Å; V55-Q59 PolarHBondContact O-N 3Å
56	V	98.5	Very high	96.6	Very high	85 Å²	85	108.3 Å²	108.3	52%	0.515	55%	0.55	S	S	.	*	H	α-helix	trans	-57.9	-49.5	176.1	169.2	0	0	0	0	110.5	P52 F53 H58 Q59 L60	P52-V56 WeakPolarHBondContact O-CG2 3.3Å; P52-V56 PolarHBondContact O-N 3.4Å; F53-V56 PolarHBondContact O-N 3.42Å; V56-H58 VanDerWaalsContact C-N 3.28Å; V56-H58 PolarHBondContact O-N 2.94Å; V56-Q59 PolarHBondContact O-N 2.93Å; V56-Q59 VanDerWaalsContact O-N 3.12Å; V56-L60 HydrophobicContact CG1-CD1 3.95Å; V56-L60 HydrophobicContact CG1-CG 4.34Å; V56-L60 WeakPolarHBondContact O-CG 3.44Å; V56-L60 PolarHBondContact O-N 3.49Å
57	R	98.1	Very high	96.5	Very high	165 Å²	165	113.2 Å²	113.2	62%	0.623	57%	0.567	S	S	*	*	H	α-helix	trans	-57.2	-43.4	176.3	-177.9	-179.4	-179.4	-81.3	-2	111.6	F53 I54 V55 Q59 L60 L61	F53-R57 WeakPolarHBondContact O-CB 3.39Å; F53-R57 PolarHBondContact O-N 3.49Å; I54-R57 PolarHBondContact O-N 2.94Å; V55-R57 PolarHBondContact O-N 3.39Å; R57-Q59 VanDerWaalsContact C-N 3.34Å; R57-Q59 PolarHBondContact O-N 2.91Å; R57-L60 PolarHBondContact O-N 3.49Å; R57-L61 HydrophobicContact CG-CD1 3.94Å; R57-L61 VanDerWaalsContact O-CG 3.26Å; R57-L61 WeakPolarHBondContact O-CG 3.24Å; R57-L61 PolarHBondContact O-N 2.91Å; R57-L61 VanDerWaalsContact O-N 3.11Å
58	H	98.1	Very high	96.4	Very high	99 Å²	99	115.9 Å²	115.9	46%	0.458	57%	0.572	S	S	.	*	H	α-helix	trans	-62.2	-41	177.8	174.5	74.8	0	0	0	111.9	I54 V55 V56 L61 K62	I54-H58 VanDerWaalsContact O-CB 3.3Å; I54-H58 WeakPolarHBondContact O-CB 3.37Å; I54-H58 PolarHBondContact O-N 2.91Å; V55-H58 WeakPolarHBondContact O-CB 3.34Å; V55-H58 PolarHBondContact O-N 3.29Å; V55-H58 VanDerWaalsContact O-N 3.17Å; V56-H58 VanDerWaalsContact C-N 3.28Å; V56-H58 PolarHBondContact O-N 2.94Å; H58-L61 PolarHBondContact O-N 3.24Å; H58-K62 WeakPolarHBondContact NE2-CE 3.42Å; H58-K62 PolarHBondContact NE2-NZ 3.49Å; H58-K62 WeakPolarHBondContact O-CG 3.44Å; H58-K62 PolarHBondContact O-N 3.37Å
59	Q	98.3	Very high	96.2	Very high	109 Å²	109	120.4 Å²	120.4	51%	0.509	58%	0.576	S	S	.	*	H	α-helix	trans	-67	-41.4	175.7	-64	-65.1	-0.3	0	0	112.5	V55 V56 R57 L61 K62	V55-Q59 HydrophobicContact CG1-CG 4.49Å; V55-Q59 WeakPolarHBondContact O-CG 3.37Å; V55-Q59 PolarHBondContact O-N 3Å; V56-Q59 PolarHBondContact O-N 2.93Å; V56-Q59 VanDerWaalsContact O-N 3.12Å; R57-Q59 VanDerWaalsContact C-N 3.34Å; R57-Q59 PolarHBondContact O-N 2.91Å; Q59-L61 PolarHBondContact O-N 3.06Å; Q59-K62 WeakPolarHBondContact O-CB 3.41Å; Q59-K62 PolarHBondContact O-N 3.48Å; Q59-K62 VanDerWaalsContact OE1-CD 3.23Å
60	L	97.8	Very high	96.1	Very high	140 Å²	140	118.6 Å²	118.6	73%	0.733	57%	0.572	S	S	*	*	H	α-helix	trans	-64.6	-27.5	177.5	-68.4	173.6	0	0	0	113.2	V56 R57	V56-L60 HydrophobicContact CG1-CD1 3.95Å; V56-L60 HydrophobicContact CG1-CG 4.34Å; V56-L60 WeakPolarHBondContact O-CG 3.44Å; V56-L60 PolarHBondContact O-N 3.49Å; R57-L60 PolarHBondContact O-N 3.49Å
61	L	97.5	Very high	95.9	Very high	110 Å²	110	122.8 Å²	122.8	58%	0.576	59%	0.586	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.2	-6.1	179.2	-67.1	174.8	0	0	0	113.5	R57 H58 Q59 K63	R57-L61 HydrophobicContact CG-CD1 3.94Å; R57-L61 VanDerWaalsContact O-CG 3.26Å; R57-L61 WeakPolarHBondContact O-CG 3.24Å; R57-L61 PolarHBondContact O-N 2.91Å; R57-L61 VanDerWaalsContact O-N 3.11Å; H58-L61 PolarHBondContact O-N 3.24Å; Q59-L61 PolarHBondContact O-N 3.06Å; L61-K63 PolarHBondContact O-N 3.32Å
62	K	93.5	Very high	95.7	Very high	113 Å²	113	121.7 Å²	121.7	49%	0.491	59%	0.585	S	S	.	*			trans	-75	121.9	169.8	-77.2	164.5	147.6	169.9	0	108.2	H58 Q59	H58-K62 WeakPolarHBondContact NE2-CE 3.42Å; H58-K62 PolarHBondContact NE2-NZ 3.49Å; H58-K62 WeakPolarHBondContact O-CG 3.44Å; H58-K62 PolarHBondContact O-N 3.37Å; Q59-K62 WeakPolarHBondContact O-CB 3.41Å; Q59-K62 PolarHBondContact O-N 3.48Å; Q59-K62 VanDerWaalsContact OE1-CD 3.23Å
63	K	72.7	Confident	95.4	Very high	277 Å²	277	126.4 Å²	126.4	100%	1.204	60%	0.597	S	S	*	*			trans	-85.4	0	166.1	-71.3	-171.5	178.6	-173.8	0	109.8	L61	L61-K63 PolarHBondContact O-N 3.32Å

Retrieved 63 of 63 residues in 95.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).